HHsearch alignment for GI: 254780636 and conserved domain: cd06133

>cd06133 ERI-1_3'hExo_like This subfamily is composed of Caenorhabditis elegans ERI-1, human 3' exonuclease (3'hExo), Drosophila exonuclease snipper (snp), and similar proteins from eukaryotes and bacteria. These are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. ERI-1 has been implicated in the degradation of small interfering RNAs (RNAi). 3'hExo participates in the degradation of histone mRNAs. Snp is a non-essential exonuclease that efficiently degrades structured RNA and DNA substrates as long as there is a minimum of 2 nucleotides in the 3' overhang to initiate degradation. Snp is not a functional homolog of either ERI-1 or 3'hExo.
Probab=98.19  E-value=4.4e-05  Score=48.82  Aligned_cols=130  Identities=13%  Similarity=0.169  Sum_probs=74.7

Q ss_pred             CEEEECCCCCCCCCCCE---EEEEEEEE-----CCCCE-----EEECCCCCCCC-----------------C-------H
Q ss_conf             27997177789854450---79999841-----89428-----99746577857-----------------0-------6
Q gi|254780636|r   22 AIAVDTETLGLMPRRDR---LCIVQLSP-----GDGTV-----DIIRIAAGQKN-----------------A-------P   64 (207)
Q Consensus        22 ~iaiDtEt~~l~~~~~~---l~LiQl~~-----~~~~~-----~l~~~~~~~~~-----------------~-------~   64 (207)
T Consensus         1 yvv~D~EtTg~~~~~~~~~~~eIIeIgav~vd~~~~~i~~~f~~lI~P~~~~~i~~~i~~itGIt~~~l~~ap~~~~v~~   80 (176)
T cd06133           1 YLVIDFEATCWEGNSKPDYPNEIIEIGAVLVDVKTKEIIDTFSSYVKPVINPKLSDFCTELTGITQEDVDNAPSFPEVLK   80 (176)
T ss_pred             CEEEEEECCCCCCCCCCCCCCCEEEEEEEEEECCCCEEEEEEEEEECCCCCCCCCHHHHHHHCCCHHHHHCCCCHHHHHH
T ss_conf             98999726899878898999707999999998799979899999975876887898899773818878707863999999


Q ss_pred             HHHHHHHCCCCCEEECCCCHHHHHHHHHH---HCC-C----CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCE
Q ss_conf             77677732364023010000168886542---000-0----000457898865211000000887776542002467520
Q gi|254780636|r   65 NLVGMLVDEKREKIFHYGRFDIAVLFYTF---GVR-V----RPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ  136 (207)
Q Consensus        65 ~L~~ll~d~~i~KV~Hn~~~D~~~L~~~~---gi~-~----~~i~DT~ias~l~~~~~~~~~L~~L~~~~lg~~ldK~~q  136 (207)
T Consensus        81 ~f~~~i~~~~~~~~~~~~~fD~~~l~~~~~~~~~~~~~~~~~~~iD~~~~~~~~~~~~~~~sL~~l~~~-~gi~~~~---  156 (176)
T cd06133          81 EFLEWLGKNGKYAFVTWGDWDLKDLLQNQCKYKIINLPPFFRQWIDLKKEFAKFYGLKKRTGLSKALEY-LGLEFEG---  156 (176)
T ss_pred             HHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHH-CCCCCCC---
T ss_conf             999997269857999606002999999999978998873011120499999998188889899999998-6999999---


Q ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             0365654432368999986459999999999
Q gi|254780636|r  137 SSDWSADDLSDEQLQYAASDVVHLHALRLQF  167 (207)
Q Consensus       137 ~SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l  167 (207)
T Consensus       157 ------------~~H~AL~DA~~ta~v~~~l  175 (176)
T cd06133         157 ------------RHHRGLDDARNIARILKRL  175 (176)
T ss_pred             ------------CCCCCHHHHHHHHHHHHHH
T ss_conf             ------------8858599999999999987