HHsearch alignment for GI: 254780636 and conserved domain: smart00479

>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases.
Probab=98.77  E-value=4.4e-08  Score=66.22  Aligned_cols=131  Identities=20%  Similarity=0.266  Sum_probs=80.6

Q ss_pred             CEEEECCCCCCCCCCCEEEEEEEEE----CCCC---E-EEECCCC-CC--------------CC-------CHHHHHHHH
Q ss_conf             2799717778985445079999841----8942---8-9974657-78--------------57-------067767773
Q gi|254780636|r   22 AIAVDTETLGLMPRRDRLCIVQLSP----GDGT---V-DIIRIAA-GQ--------------KN-------APNLVGMLV   71 (207)
Q Consensus        22 ~iaiDtEt~~l~~~~~~l~LiQl~~----~~~~---~-~l~~~~~-~~--------------~~-------~~~L~~ll~   71 (207)
T Consensus         2 ~v~~D~ETTGl~~~~~~I--ieigav~~~~~~~~~~~~~~i~P~~~i~~~~~~i~GIt~~~l~~~~~~~~v~~~~~~~l~   79 (169)
T smart00479        2 LVVIDCETTGLDPGKDEI--IEIAAVDVDGGRIIVVFDTYVKPDRPITDYATEIHGITPEMLDDAPTFEEVLEELLEFLK   79 (169)
T ss_pred             EEEEEEECCCCCCCCCEE--EEEEEEEEECCEEEEEEEEEECCCCCCCHHHHHHCCCCCHHCCCCCCHHHHHHHHHHHHC
T ss_conf             999998527999999869--999999999998878889887999999989986318472120458669999999998604


Q ss_pred             CCCCCEEECCCCHHHHHHHHHHH---CC---CCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCC
Q ss_conf             23640230100001688865420---00---0000457898865211000000887776542002467520036565443
Q gi|254780636|r   72 DEKREKIFHYGRFDIAVLFYTFG---VR---VRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDL  145 (207)
Q Consensus        72 d~~i~KV~Hn~~~D~~~L~~~~g---i~---~~~i~DT~ias~l~~~~~~~~~L~~L~~~~lg~~ldK~~q~SdW~~rpL  145 (207)
T Consensus        80 ~~~~-v~~~~~~fD~~~L~~~~~~~~~~~~~~~~~~dt~~~~~~~~~-~~~~~L~~l~~~-~~i~~~---------~---  144 (169)
T smart00479       80 GKIL-VAGNALNFDLRFLKLEHPRLGIKDPPKNPVIDTLKLARALNP-GRKYSLKKLAER-LGLEVI---------G---  144 (169)
T ss_pred             CCCC-HHCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCC-CCCHHHHHHHHH-CCCCCC---------C---
T ss_conf             8745-103679999999999999818998866524629999999758-854589999998-599989---------9---


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             236899998645999999999999999
Q gi|254780636|r  146 SDEQLQYAASDVVHLHALRLQFTEKLQ  172 (207)
Q Consensus       146 s~~Qi~YAA~Dv~~l~~L~~~l~~~L~  172 (207)
T Consensus       145 ---~~H~Al~Da~~t~~v~~~l~~~~~  168 (169)
T smart00479      145 ---RAHRALDDARATAKLFKKLVERLL  168 (169)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             ---992979999999999999997724