HHsearch results for GI: 254780636 and protein with PDBid: 1qht_A

>1qht_A Protein (DNA polymerase); archaea, hyperthermostable, family B polymerase, POL alpha family polymerase, transferase; 2.10A {Thermococcus SP} SCOP: c.55.3.5 e.8.1.1 PDB: 1tgo_A 2vwj_A* 2vwk_A* 1wns_A* 1wn7_A 1qqc_A* 3a2f_A* 2jgu_A* 1d5a_A
Probab=97.56  E-value=0.0023  Score=37.56  Aligned_cols=165  Identities=18%  Similarity=0.189  Sum_probs=91.9

Q ss_pred             EEECCCCCCHHH----HC--------CCCCCEEEECCCCCCC---CCCCEEEEEEEEECCCCEEEECCCCCC--------
Q ss_conf             153257888578----42--------4898279971777898---544507999984189428997465778--------
Q gi|254780636|r    4 IRVHEGDIPAEC----AA--------RYVDAIAVDTETLGLM---PRRDRLCIVQLSPGDGTVDIIRIAAGQ--------   60 (207)
Q Consensus         4 ~~~~~~dl~~~~----~l--------~~~~~iaiDtEt~~l~---~~~~~l~LiQl~~~~~~~~l~~~~~~~--------   60 (207)
                      +.+++.|+|-..    +.        ..-.++++|.||.+..   +..+++..|.++...... ++......        
T Consensus       107 ~~~~E~dI~~~~r~lid~~l~p~~~~~~l~i~s~DIE~~~~~~~~~~~d~I~~Is~~~~~~~~-vi~~~~~d~~~v~~~~  185 (775)
T 1qht_A          107 VDIYEYDIPFAKRYLIDKGLIPMEGDEELTMLAFAIATLYHEGEEFGTGPILMISYADGSEAR-VITWKKIDLPYVDVVS  185 (775)
T ss_dssp             EEEESCSSCHHHHHHHHTTCCTTCSCCCCCEEEEEEEECCCTTCCTTCSCEEEEEEECSSCEE-EEESSCCCCSSEEECS
T ss_pred             CCEECCCCCCHHEEEEECCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCEEEEEEECCCCCE-EEECCCCCCCEEEECC
T ss_conf             635715888054277877878567899836999998757876888777988999996389707-9967787876278719


Q ss_pred             ---CCCHHHHHHH--HCCCCCEEECCC-CHHHHHHHHH---HHCC----------------------CCC--HHHHHHHH
Q ss_conf             ---5706776777--323640230100-0016888654---2000----------------------000--04578988
Q gi|254780636|r   61 ---KNAPNLVGML--VDEKREKIFHYG-RFDIAVLFYT---FGVR----------------------VRP--VFCTKIAS  107 (207)
Q Consensus        61 ---~~~~~L~~ll--~d~~i~KV~Hn~-~~D~~~L~~~---~gi~----------------------~~~--i~DT~ias  107 (207)
                         .....+..++  .||+|+ +|||. .||+..|...   +|+.                      ..+  ++|+.-..
T Consensus       186 ~E~~LL~~F~~~i~~~dPDII-~GyN~~~FDlpyL~~R~~~l~i~~~~~r~~~~~~~~~~~~~~~~~i~Gri~iDl~~~~  264 (775)
T 1qht_A          186 TEKEMIKRFLRVVREKDPDVL-ITYNGDNFDFAYLKKRCEELGIKFTLGRDGSEPKIQRMGDRFAVEVKGRIHFDLYPVI  264 (775)
T ss_dssp             CHHHHHHHHHHHHHHHCCSEE-EESSTTTTHHHHHHHHHHHTTCCCCCSTTSCCCEEEEETTEEEEECTTSEEEEHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCEE-EECCCCCCCHHHHHHHHHHHCCCCEECCCCCCCCEEECCCEEEEEECCEEEEEHHHHH
T ss_conf             999999999999987199889-8708877529999999998298101035688765434486689988798999839999


Q ss_pred             HHHHHHCCCHHHHHHHHHHHCCCCCCC--CE-ECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             652110000008877765420024675--20-03656544323689999864599999999999999
Q gi|254780636|r  108 RLTRTYTNQHGLKDNLKELLGINISKA--QQ-SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL  171 (207)
Q Consensus       108 ~l~~~~~~~~~L~~L~~~~lg~~ldK~--~q-~SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l~~~L  171 (207)
                      +-. ....+++|.+++++++|.....-  .. .--|...+-...-+.|+..||..+..|..++....
T Consensus       265 ~~~-~~l~sy~L~~Va~~~lg~~K~d~~~~~i~~~~~~~~~~~~~~~Y~~~D~~lv~~L~~kl~~~~  330 (775)
T 1qht_A          265 RRT-INLPTYTLEAVYEAVFGKPKEKVYAEEIAQAWESGEGLERVARYSMEDAKVTYELGREFFPME  330 (775)
T ss_dssp             HHH-SCCSCCCHHHHHHHHHCCCCCCCCHHHHHHHHTTTCSHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHH-CCCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             764-667666689999998499755569999999875263299999996999999999988787999