HHsearch results for GI: 254780636 and protein with PDBid: 1y97_A

>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5
Probab=98.58  E-value=2.5e-07  Score=60.56  Aligned_cols=82  Identities=20%  Similarity=0.158  Sum_probs=55.0

Q ss_pred             CCCEEECCC-CHHHHHHHHHH---HCCC--C-CHHHHHHHHHHHHH---------HCCCHHHHHHHHHHHCCCCCCCCEE
Q ss_conf             640230100-00168886542---0000--0-00457898865211---------0000008877765420024675200
Q gi|254780636|r   74 KREKIFHYG-RFDIAVLFYTF---GVRV--R-PVFCTKIASRLTRT---------YTNQHGLKDNLKELLGINISKAQQS  137 (207)
Q Consensus        74 ~i~KV~Hn~-~~D~~~L~~~~---gi~~--~-~i~DT~ias~l~~~---------~~~~~~L~~L~~~~lg~~ldK~~q~  137 (207)
                      ....|+||+ +||..+|.+.+   |+.+  . ...||+-.++.+..         ...+++|.+|++++.|..       
T Consensus       113 ~~~~v~hn~~~FD~~~L~~~~~r~~~~~~~~~~~iDtl~~~~~l~~~~~~~~~~~~~~~~~L~~l~~~~~~~~-------  185 (238)
T 1y97_A          113 PICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAE-------  185 (238)
T ss_dssp             SEEEEETTTTTTHHHHHHHHHHHHTCCCCTTCEEEEHHHHHHHHHHHC----------CCSHHHHHHHHHSSC-------
T ss_pred             CCEEEEECCHHHHHHHHHHHHHHHCCCCCCCCEEEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCC-------
T ss_conf             8269996518778999999999808988889878778999999735075444566668858999999964999-------


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3656544323689999864599999999999999
Q gi|254780636|r  138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL  171 (207)
Q Consensus       138 SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l~~~L  171 (207)
                               ..+-+-|..||..+.+|+.++...+
T Consensus       186 ---------~~~aH~Al~Da~~t~~i~~~l~~~~  210 (238)
T 1y97_A          186 ---------PSAAHSAEGDVHTLLLIFLHRAAEL  210 (238)
T ss_dssp             ---------CC---CHHHHHHHHHHHHHHTHHHH
T ss_pred             ---------CCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             ---------8978898999999999999999999