HHsearch results for GI: 254780636 and protein with PDBid: 2p51_A

>2p51_A SPCC18.06C protein; DEDD nuclease fold, hydrolase, gene regulation; 1.40A {Schizosaccharomyces pombe} PDB: 3g0z_A 3g10_A
Probab=97.31  E-value=0.00094  Score=39.80  Aligned_cols=140  Identities=18%  Similarity=0.244  Sum_probs=84.0

Q ss_pred             HCCCCCCEEEECCCCCCCCC-----C--------------CEEEEEEEE----ECCC------CEEEECCC----CCCCC
Q ss_conf             42489827997177789854-----4--------------507999984----1894------28997465----77857
Q gi|254780636|r   16 AARYVDAIAVDTETLGLMPR-----R--------------DRLCIVQLS----PGDG------TVDIIRIA----AGQKN   62 (207)
Q Consensus        16 ~l~~~~~iaiDtEt~~l~~~-----~--------------~~l~LiQl~----~~~~------~~~l~~~~----~~~~~   62 (207)
                      .++..+.||+|||++|+...     .              +.+.+||++    ..++      .++-+.+.    .....
T Consensus        41 ~I~~~~fVAiDtEFpGiv~~p~~~~~~t~d~rY~~lr~nVd~l~iIQlGLt~~~~~g~~p~~~~twqFNF~f~~~~d~~~  120 (333)
T 2p51_A           41 LIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYA  120 (333)
T ss_dssp             HTTTSCEEEEEEECCCCCCCCCSCCSSSHHHHHHHHHHHHHHSCCCEEEEEEECTTSCCCTTCSEEEEEBCCCTTTSCCC
T ss_pred             HHHCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEEEEEECCCCCCCCCEEEEEEEEECCCCCCCC
T ss_conf             98459989995331772567876668978999999997542145147999977258887888637999879778665504


Q ss_pred             C-----------------------HHHHH------HHHCCCCCEEECCCCHHHHHHHHHHH----------------CCC
Q ss_conf             0-----------------------67767------77323640230100001688865420----------------000
Q gi|254780636|r   63 A-----------------------PNLVG------MLVDEKREKIFHYGRFDIAVLFYTFG----------------VRV   97 (207)
Q Consensus        63 ~-----------------------~~L~~------ll~d~~i~KV~Hn~~~D~~~L~~~~g----------------i~~   97 (207)
                      +                       ..+.+      ++-++++.||.|++.+|+..|.+.+-                ...
T Consensus       121 ~~SI~fL~~~G~DF~k~~~~GI~~~~F~ell~~sglv~~~~v~Wvtfhg~yD~~yLlk~l~g~~LP~~~~eF~~~l~~~F  200 (333)
T 2p51_A          121 PESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYF  200 (333)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHCBCHHHHHHHHHTTTSSSCTTCEEEESSCHHHHHHHHHHHHCSCCCSSHHHHHHHHHHHS
T ss_pred             HHHHHHHHHCCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHC
T ss_conf             78999999749677889860998888899998505541688739980661679999999708878867899999999977


Q ss_pred             CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             0004578988652110000008877765420024675200365654432368999986459999999999999997
Q gi|254780636|r   98 RPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQR  173 (207)
Q Consensus        98 ~~i~DT~ias~l~~~~~~~~~L~~L~~~~lg~~ldK~~q~SdW~~rpLs~~Qi~YAA~Dv~~l~~L~~~l~~~L~~  173 (207)
                      ..++||...++-+.+  .+-||..+++. ||+.   ..         -++   +=|..|+..+..+|-+|.+..-.
T Consensus       201 P~vYD~Kyia~~~~~--~~~gL~~lA~~-L~v~---r~---------g~~---HqAGsDSllT~~~F~kl~~~~f~  258 (333)
T 2p51_A          201 PKNYDIKYIMKSVLN--NSKGLQDIADD-LQIH---RI---------GPQ---HQAGSDALLTARIFFEIRSRYFD  258 (333)
T ss_dssp             SSEEEHHHHHTTTTC--CCCCHHHHHHH-TTCC---CC---------SCT---TSHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHCCC--CCCCHHHHHHH-CCCC---CC---------CCC---CCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             628718999976156--67659999997-4998---76---------776---45305899999999999998659