HHsearch results for GI: 254780636 and protein with PDBid: 3ikm_A

>3ikm_A DNA polymerase subunit gamma-1; human mitochondrial DNA polymerase, disease mutation, DNA replication, DNA-binding, DNA-directed DNA polymerase; HET: DNA; 3.24A {Homo sapiens}
Probab=98.19  E-value=2.3e-06  Score=54.93  Aligned_cols=99  Identities=16%  Similarity=0.132  Sum_probs=68.4

Q ss_pred             CCCCEEECCCCHHHHHHHHHHHCCCCC--HHHHHHHHHHHHH--------------------------------------
Q ss_conf             364023010000168886542000000--0457898865211--------------------------------------
Q gi|254780636|r   73 EKREKIFHYGRFDIAVLFYTFGVRVRP--VFCTKIASRLTRT--------------------------------------  112 (207)
Q Consensus        73 ~~i~KV~Hn~~~D~~~L~~~~gi~~~~--i~DT~ias~l~~~--------------------------------------  112 (207)
                      +++ -||||..||-......+.+...+  ++|||=++--..|                                      
T Consensus       194 ~rl-VVGHNVsyDRaRi~EeY~l~~s~~rFlDTMSLHvavsGm~S~QR~~w~~~kk~~~~~~~~~~~~~~~~~~~~~~~~  272 (1172)
T 3ikm_A          194 EQL-VVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPA  272 (1172)
T ss_dssp             CCC-CBCBCSSSSTTGGGTSSCSSCCCCCCCBTTHHHHHHSCCCHHHHHHHHHHHHC-----------------------
T ss_pred             CCE-EEECCCCCCHHHHHHHHHHCCCCCEEEEHHHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             637-9856755108888888731456763221034655402566242689987423132200123333321333212652


Q ss_pred             --------HCC--CHHHHHHHHHHH-CCCCCCCCEECCCCCCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             --------000--000887776542-002467520036565443------2368999986459999999999999997
Q gi|254780636|r  113 --------YTN--QHGLKDNLKELL-GINISKAQQSSDWSADDL------SDEQLQYAASDVVHLHALRLQFTEKLQR  173 (207)
Q Consensus       113 --------~~~--~~~L~~L~~~~l-g~~ldK~~q~SdW~~rpL------s~~Qi~YAA~Dv~~l~~L~~~l~~~L~~  173 (207)
                              .+.  ..||.++.+-+| |+.+||+.|- .+..-++      -++-+.|||.||.++.++|.++-+...+
T Consensus       273 ~~~~~W~~~sS~~~NSL~dV~~lhcg~~~ldK~~Rd-~Fv~~~~~dI~~~fq~Lm~YCA~DV~aT~~V~~kl~P~Fle  349 (1172)
T 3ikm_A          273 ISSWDWLDISSVNSNSLAEVHRLYVGGPPLEKEPRE-LFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLE  349 (1172)
T ss_dssp             ---CCCCCCCCTTSHHHHHHHTCSSCSCS--SCSSS-STTTTCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCHHHCCCCCCCCHHHHHHHHCCCCCCCHHHHH-HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHH
T ss_conf             234330002344536499999974799877877888-88529999999989999999998899999999987768785