BLAST/PSIBLAST alignment of GI: 254780636 and GI: 218508865 at iteration 1
>gi|218508865|ref|ZP_03506743.1| ribonuclease III protein [Rhizobium etli Brasil 5] Length = 208
>gi|327190020|gb|EGE57137.1| ribonuclease III protein [Rhizobium etli CNPAF512] Length = 208
 Score =  309 bits (791), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 147/205 (71%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL+RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLSRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISK QQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDVDISKTQQSSDWAAETLSQAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208