BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780636|ref|YP_003065049.1| ribonuclease D [Candidatus
Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780636|ref|YP_003065049.1| ribonuclease D [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040313|gb|ACT57109.1| ribonuclease D [Candidatus Liberibacter asiaticus str. psy62]
          Length = 207

 Score =  430 bits (1105), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ
Sbjct: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK
Sbjct: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA
Sbjct: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
           TSCCNFLMDRAELDLLGWENVDIFSHS
Sbjct: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207


>gi|315122172|ref|YP_004062661.1| ribonuclease D [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495574|gb|ADR52173.1| ribonuclease D [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 209

 Score =  353 bits (907), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 166/206 (80%), Positives = 183/206 (88%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MTTIRVH GDIP EC ARY   IAVDTETLGL+PRRDRLC+VQLSPGDGT DIIRIAA Q
Sbjct: 1   MTTIRVHNGDIPTECIARYTGPIAVDTETLGLIPRRDRLCVVQLSPGDGTADIIRIAAEQ 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           KNAPNLV ML +E +EKIFHY RFDIAVLFYTFGVRV+P+FCTKIASRLTRTY ++HGLK
Sbjct: 61  KNAPNLVTMLANETQEKIFHYARFDIAVLFYTFGVRVKPIFCTKIASRLTRTYIDRHGLK 120

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           DNL+ELLG++ISK QQ SDWS DDLS EQLQYAASDVVHLHALR +F  KLQ LGRSD+A
Sbjct: 121 DNLRELLGVDISKKQQLSDWSEDDLSHEQLQYAASDVVHLHALREKFIAKLQSLGRSDVA 180

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
           ++C NFLM RAELDLLGW+N+DIFSH
Sbjct: 181 SACFNFLMSRAELDLLGWDNIDIFSH 206


>gi|332716830|ref|YP_004444296.1| Ribonuclease D [Agrobacterium sp. H13-3]
 gi|325063515|gb|ADY67205.1| Ribonuclease D [Agrobacterium sp. H13-3]
          Length = 208

 Score =  313 bits (801), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY+ AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYLGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D  R+KIFHYGRFDIAVLF+TFGV   PVFCTKIASRLTRTYT++HGLKDN
Sbjct: 64  APNLTHMLADPARQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLTRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISKAQQSSDW+A+ LS  QL+YAASDV+HLHALR + T +L R GR D A +
Sbjct: 124 LKEMLEVDISKAQQSSDWAAEKLSPAQLEYAASDVLHLHALRDKLTHRLVRDGRLDHADA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGW+  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWDETDIFAHS 208


>gi|222147114|ref|YP_002548071.1| ribonuclease D [Agrobacterium vitis S4]
 gi|221734104|gb|ACM35067.1| ribonuclease D [Agrobacterium vitis S4]
          Length = 208

 Score =  312 bits (799), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 173/206 (83%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           +TIR HEGDI +E AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIA GQ+
Sbjct: 3   STIRYHEGDISSEDAARYTRAIAIDTETLGLIPRRDRLCVVQLSPGDGTADVIRIAPGQR 62

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  REKIFHYGRFDIAVLF+TFGV   PVFCTKIASRL+RTYT++HGLKD
Sbjct: 63  QAPNLTALLEDPTREKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLSRTYTDRHGLKD 122

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
           NLKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT
Sbjct: 123 NLKEMLDVDVSKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLVRDGRMDHAT 182

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 183 ACFEFLPTRAKLDLLGWEETDIFAHS 208


>gi|209551599|ref|YP_002283516.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537355|gb|ACI57290.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 208

 Score =  311 bits (796), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 172/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIA+GQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIASGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTNPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISKAQQSSDW+A+ LS  QL+YAASDV++LHALR + TE+L R GR D AT+
Sbjct: 124 LKEMLDVDISKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTERLLRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|222084303|ref|YP_002542832.1| RNAse D protein [Agrobacterium radiobacter K84]
 gi|221721751|gb|ACM24907.1| RNAse D protein [Agrobacterium radiobacter K84]
          Length = 208

 Score =  310 bits (793), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIA+GQ  
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLIPRRDRLCVVQLSPGDGTADIIRIASGQSQ 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV ML D  R+KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVAMLADTTRQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLCRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKELL ++ISKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR + A +
Sbjct: 124 LKELLEVDISKAQQSSDWAAEKLSPAQLEYAASDVLYLHALRDKLTARLVRDGRMEHAEA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|86355756|ref|YP_467648.1| RNAse D protein [Rhizobium etli CFN 42]
 gi|86279858|gb|ABC88921.1| RNAse D protein [Rhizobium etli CFN 42]
          Length = 208

 Score =  309 bits (791), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADIIRIAAGQKA 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTNPVFCTKIASRLCRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDVDVSKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|195970213|ref|NP_384368.2| hypothetical protein SMc00342 [Sinorhizobium meliloti 1021]
 gi|307306427|ref|ZP_07586171.1| 3'-5' exonuclease [Sinorhizobium meliloti BL225C]
 gi|307319314|ref|ZP_07598743.1| 3'-5' exonuclease [Sinorhizobium meliloti AK83]
 gi|187904130|emb|CAC41699.2| Probable ribonuclease D [Sinorhizobium meliloti 1021]
 gi|306895150|gb|EFN25907.1| 3'-5' exonuclease [Sinorhizobium meliloti AK83]
 gi|306902269|gb|EFN32866.1| 3'-5' exonuclease [Sinorhizobium meliloti BL225C]
          Length = 208

 Score =  309 bits (791), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI    AARY  AIA+DTETLGL+PRRDRLC+VQLS GDGT D+IRI+AGQK 
Sbjct: 4   TIRFHEGDISETDAARYTGAIAIDTETLGLVPRRDRLCVVQLSSGDGTADVIRISAGQKQ 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV ML D  R+KIFH+GRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVSMLADPTRQKIFHFGRFDIAVLFHTFGVTASPVFCTKIASRLARTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKELL I+ISK QQSSDW+AD LS  QL+YAASDV+HLHALR + T +L R GR +LA +
Sbjct: 124 LKELLDIDISKQQQSSDWAADILSPAQLEYAASDVLHLHALRDKLTARLLRDGRMELAEA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFSFLPTRAKLDLLGWEEADIFAHS 208


>gi|218508865|ref|ZP_03506743.1| ribonuclease III protein [Rhizobium etli Brasil 5]
 gi|327190020|gb|EGE57137.1| ribonuclease III protein [Rhizobium etli CNPAF512]
          Length = 208

 Score =  309 bits (791), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 147/205 (71%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL+RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLSRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISK QQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDVDISKTQQSSDWAAETLSQAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|218661189|ref|ZP_03517119.1| ribonuclease III protein [Rhizobium etli IE4771]
          Length = 208

 Score =  308 bits (790), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L I+ISK QQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDIDISKTQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|116249870|ref|YP_765708.1| ribonuclease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254518|emb|CAK05592.1| putative ribonuclease [Rhizobium leguminosarum bv. viciae 3841]
          Length = 208

 Score =  308 bits (789), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A   ARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIAAGQK 
Sbjct: 4   TIRYHEGDISAADVARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADIIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TF V   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFSVTTTPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + TE+L R GR D AT+
Sbjct: 124 LKEMLDVDVSKAQQSSDWAAERLSPAQLEYAASDVLYLHALRDKLTERLIRDGRYDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|150398650|ref|YP_001329117.1| 3'-5' exonuclease [Sinorhizobium medicae WSM419]
 gi|150030165|gb|ABR62282.1| 3'-5' exonuclease [Sinorhizobium medicae WSM419]
          Length = 208

 Score =  308 bits (789), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI    AARY  AIA+DTETLGL+PRRDRLC+VQLS GDGT D+IRIAAGQK 
Sbjct: 4   TIRFHEGDISEADAARYRGAIAIDTETLGLVPRRDRLCVVQLSSGDGTADVIRIAAGQKQ 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV ML D  R+KIFH+GRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVAMLSDPARQKIFHFGRFDIAVLFHTFGVTASPVFCTKIASRLARTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKELL ++ISK QQSSDW+AD LS  QL+YAASDV+HLHALR + T +L R GR +LA +
Sbjct: 124 LKELLDVDISKQQQSSDWAADILSPAQLEYAASDVLHLHALRDKLTARLLRDGRMELAEA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFSFLPTRAKLDLLGWEETDIFAHS 208


>gi|241207041|ref|YP_002978137.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860931|gb|ACS58598.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 208

 Score =  308 bits (788), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 149/205 (72%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADIIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           A NLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  ARNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTATPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + TE+L R GR D AT+
Sbjct: 124 LKEMLDVDVSKAQQSSDWAAERLSPAQLEYAASDVLYLHALRDKLTERLIRDGRYDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|190889732|ref|YP_001976274.1| ribonuclease III protein [Rhizobium etli CIAT 652]
 gi|190695011|gb|ACE89096.1| ribonuclease III protein [Rhizobium etli CIAT 652]
          Length = 208

 Score =  308 bits (788), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 147/205 (71%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL+RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLSRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISK QQSSDW A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDVDISKTQQSSDWGAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|218670593|ref|ZP_03520264.1| ribonuclease III protein [Rhizobium etli GR56]
          Length = 208

 Score =  306 bits (785), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 147/205 (71%), Positives = 169/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI    AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISTADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L I+ISK QQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDIDISKTQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|15890866|ref|NP_356538.1| ribonuclease D [Agrobacterium tumefaciens str. C58]
 gi|15159163|gb|AAK89323.1| ribonuclease D [Agrobacterium tumefaciens str. C58]
          Length = 208

 Score =  305 bits (780), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI AE AARY  AIA+DTETLGL+PRRDRLC+VQLS GDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAEDAARYKGAIAIDTETLGLVPRRDRLCVVQLSSGDGTADVIRIAAGQKQ 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV ML D  R+KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVHMLADPARQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLCRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR + A +
Sbjct: 124 LKEMLEVDISKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRIEHADA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGW+  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWDETDIFAHS 208


>gi|227824096|ref|YP_002828069.1| 3'-5' exonuclease [Sinorhizobium fredii NGR234]
 gi|227343098|gb|ACP27316.1| 3'-5' exonuclease [Sinorhizobium fredii NGR234]
          Length = 208

 Score =  297 bits (761), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 151/205 (73%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRFHEGDISAADAARYAGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV ML D  R+KIFH+GRFDIAVLF+TFGV   PVFCTKIASRLTRTYT++HGLKDN
Sbjct: 64  APNLVRMLADPARQKIFHFGRFDIAVLFHTFGVTSTPVFCTKIASRLTRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKELL ++ISK QQSSDW+AD LS  QL+YAASDV+HLHALR + T +L R GR + A +
Sbjct: 124 LKELLDVDISKQQQSSDWAADILSPAQLEYAASDVLHLHALRDKLTARLIRDGRMEHADA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEETDIFAHS 208


>gi|163757673|ref|ZP_02164762.1| putative ribonuclease [Hoeflea phototrophica DFL-43]
 gi|162285175|gb|EDQ35457.1| putative ribonuclease [Hoeflea phototrophica DFL-43]
          Length = 207

 Score =  290 bits (742), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 136/207 (65%), Positives = 163/207 (78%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+GDI  +  ARY   IAVDTETLGL+PRRDRLC+VQLSPGDG+ D+I+IA GQ
Sbjct: 1   MADIRAHKGDISDQAMARYTGDIAVDTETLGLVPRRDRLCVVQLSPGDGSADVIQIAKGQ 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L D KR K+FHYGRFDIAVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 61  KRAPNLVALLTDRKRRKLFHYGRFDIAVLYNAFGVTTEPVFCTKIASRLTRTYTDRHGLK 120

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +ELL +++SK QQSSDW+A+ L+  QL+YAASDV+HLHAL  + TE+LQR  R   A
Sbjct: 121 DVTRELLEVDLSKQQQSSDWAAETLTPAQLEYAASDVLHLHALTAKLTERLQRDDREAHA 180

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GWE  DIF+HS
Sbjct: 181 KACFEFLPTRAKLDLMGWEETDIFAHS 207


>gi|75674370|ref|YP_316791.1| 3'-5' exonuclease [Nitrobacter winogradskyi Nb-255]
 gi|74419240|gb|ABA03439.1| 3'-5' exonuclease [Nitrobacter winogradskyi Nb-255]
          Length = 206

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/205 (60%), Positives = 155/205 (75%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P +  ARY  + A+DTET+GL P RDRLC+VQ+SPGDG+ D+I+IA GQ++
Sbjct: 2   TIRLHRGDLPHQDLARYTGSAAIDTETMGLKPHRDRLCVVQMSPGDGSADVIQIARGQRD 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL+ +L D    KIFH+ RFD+A L+  FGV  RPV+CTKIASRL RTYT++HGLKD 
Sbjct: 62  APNLIKLLKDPAIVKIFHFARFDLAALYNAFGVMPRPVYCTKIASRLIRTYTDRHGLKDL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELL I++SK QQSSDW +  LSD QL YAASDV+HLHALR +    L R  RS LA +
Sbjct: 122 VRELLSIDLSKQQQSSDWGSPTLSDAQLAYAASDVLHLHALRDKLEATLAREDRSALAQA 181

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GWE  DIF+HS
Sbjct: 182 CFEFLPSRAMLDLAGWETEDIFAHS 206


>gi|110636308|ref|YP_676516.1| 3'-5' exonuclease [Mesorhizobium sp. BNC1]
 gi|110287292|gb|ABG65351.1| 3'-5' exonuclease [Chelativorans sp. BNC1]
          Length = 205

 Score =  263 bits (673), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 163/206 (79%), Gaps = 3/206 (1%)

Query: 3   TIRVHEGDIPAECAARY-VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           TIR H+ D+P    +RY VDA+A+DTETLGL P RDRLC+VQLSPGDGT D+++IAAGQ+
Sbjct: 2   TIRFHQYDLPD--LSRYDVDAVAIDTETLGLNPHRDRLCVVQLSPGDGTADVVQIAAGQR 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L + +  K+FHY RFDIAVL+++FGV   PVFCTKIASRLTRTYT++HGLKD
Sbjct: 60  RAPNLVALLRNRRITKLFHYARFDIAVLYHSFGVMPDPVFCTKIASRLTRTYTDRHGLKD 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL +N+SKAQQSSDW+A+ L+ EQL+YAASDV++LH L     ++L R GR+  A 
Sbjct: 120 ICYELLQVNLSKAQQSSDWAAEQLTPEQLEYAASDVLYLHRLADVLQQRLMRDGRAREAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA+LDL+GW+  DIF+HS
Sbjct: 180 ACFKFLPTRAKLDLMGWDEQDIFAHS 205


>gi|118589455|ref|ZP_01546861.1| 3'-5' exonuclease [Stappia aggregata IAM 12614]
 gi|118438155|gb|EAV44790.1| 3'-5' exonuclease [Stappia aggregata IAM 12614]
          Length = 206

 Score =  262 bits (669), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 156/205 (76%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H+GD+P   A    +A+AVD+ETLGL P RDRLC+VQLSPGDG+ D+++IA GQ  
Sbjct: 2   TIRYHKGDLPDLKAYETANAVAVDSETLGLNPHRDRLCVVQLSPGDGSADVVQIARGQSE 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ++ D  + KIFH+ RFD+AVL +   +RV PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 62  APNLAALMTDTSKPKIFHFARFDVAVLQHYLNIRVSPVWCTKIASKLVRTYTDRHGLKDI 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLG+ +SK QQSSDW+A+ LSD QL YAASDV+HLHAL+ +    L+R  R+ +A +
Sbjct: 122 TRELLGVELSKQQQSSDWAAETLSDAQLAYAASDVLHLHALKERLEMMLEREERTHIAEA 181

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RAELDL GWE  DIF+HS
Sbjct: 182 CFDFLPTRAELDLKGWEENDIFAHS 206


>gi|319408044|emb|CBI81698.1| Ribonuclease D [Bartonella schoenbuchensis R1]
          Length = 206

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT IRVH+GD+P      +VDAIAVDTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MTEIRVHQGDLP-NLDNYHVDAIAVDTETLGLQPYRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFG+    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVKLLEDKAITKIFHFGRFDLAILAHTFGIMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+ + LS  Q++YAASDV++LH L+  F  +L+R  R ++A
Sbjct: 120 EICSELLNVNISKQQQSSDWATETLSRAQIEYAASDVLYLHRLKSVFETRLKREERENVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW   DIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWTETDIFAHS 206


>gi|328545553|ref|YP_004305662.1| 3'-5' exonuclease [polymorphum gilvum SL003B-26A1]
 gi|326415294|gb|ADZ72357.1| 3'-5' exonuclease, putative [Polymorphum gilvum SL003B-26A1]
          Length = 206

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 155/205 (75%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H+ D+P   A     A+AVDTETLGL P RDRLC+VQLSPGDGT D+++IA GQ+ 
Sbjct: 2   TIRHHKTDLPDLSAYDAAQAVAVDTETLGLNPHRDRLCVVQLSPGDGTADVVQIARGQRA 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D  + KIFH+ RFD+AVL +  G+ V PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 62  APNLARLLTDPAKMKIFHFARFDLAVLRHNLGIEVAPVWCTKIASKLVRTYTDRHGLKDI 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLG+++SK QQSSDW+A+ L+D QL YAASDV+HLHALR +    L+R  R+ LA +
Sbjct: 122 TRELLGVDLSKQQQSSDWAAETLTDAQLAYAASDVLHLHALREKLAAMLEREERTALARA 181

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL+GWE  DIF+H+
Sbjct: 182 CYEFLPTRAALDLMGWEEQDIFAHT 206


>gi|163867544|ref|YP_001608743.1| hypothetical protein Btr_0277 [Bartonella tribocorum CIP 105476]
 gi|161017190|emb|CAK00748.1| Ribonuclease D [Bartonella tribocorum CIP 105476]
          Length = 206

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 130/207 (62%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P        DAIA+DTETLGL P RDRLC+VQ+SPGDGT DII+IA GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYKTDAIAIDTETLGLQPHRDRLCVVQISPGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           KNAPNLV +L D    KIFH+GRFD+A+L +TFGV    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  KNAPNLVKLLEDNAVTKIFHFGRFDLAILAHTFGVMPEAVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L+  F E+L+R  R  +A
Sbjct: 120 EICNELLNVNISKQQQSSDWAAETLSQAQIEYAASDVLYLHRLKAIFEERLRREERESVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  VDIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWSEVDIFAHS 206


>gi|319781433|ref|YP_004140909.1| 3'-5' exonuclease [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167321|gb|ADV10859.1| 3'-5' exonuclease [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 206

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/207 (60%), Positives = 158/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+ D+P + +   V A+A+DTETLGL P RDRLC+VQ+SPGDG+ D+I+IA GQ
Sbjct: 1   MADIRFHKNDLP-DLSHYNVGAVAIDTETLGLNPHRDRLCVVQISPGDGSADVIQIAPGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L +    K+FHYGRFD+AVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 60  KKAPNLVSLLRNRGVTKLFHYGRFDLAVLYNAFGVMPEPVFCTKIASRLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D   ELLG+ +SKAQQSSDW+A+ LS EQL+YAASDV++LH LR     +L R GR+  A
Sbjct: 120 DICFELLGVGLSKAQQSSDWAAETLSPEQLEYAASDVLYLHRLRDVLAGRLARDGRTKEA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GW+  DIF+HS
Sbjct: 180 DACFRFLPTRAKLDLMGWDEEDIFAHS 206


>gi|254505241|ref|ZP_05117392.1| 3'-5' exonuclease, putative [Labrenzia alexandrii DFL-11]
 gi|222441312|gb|EEE47991.1| 3'-5' exonuclease, putative [Labrenzia alexandrii DFL-11]
          Length = 223

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/207 (57%), Positives = 155/207 (74%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           + TIR H+GD+P   A     A+AVD+ETLGL P RDRLC+VQLSPGDG+ D+++IA GQ
Sbjct: 17  VMTIRYHKGDLPDLSAYETASAVAVDSETLGLNPHRDRLCVVQLSPGDGSADVVQIARGQ 76

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +  D  + KIFH+ RFD+AVL +  G+ V PV+CTKIAS+L RTYT++HGLK
Sbjct: 77  TEAPNLAALFTDAAKPKIFHFARFDVAVLRHYLGIHVTPVWCTKIASKLVRTYTDRHGLK 136

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +ELLG+ +SK QQSSDW+A+ LSD QL YAASDV+HLH L+ +    L+R  R+++A
Sbjct: 137 DITRELLGVELSKQQQSSDWAAETLSDAQLAYAASDVLHLHDLKAKLEMMLEREERTNIA 196

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RAELDL GWE  DIF+HS
Sbjct: 197 EACFSFLPVRAELDLKGWEENDIFAHS 223


>gi|209883609|ref|YP_002287466.1| 3'-5' exonuclease [Oligotropha carboxidovorans OM5]
 gi|209871805|gb|ACI91601.1| 3'-5' exonuclease [Oligotropha carboxidovorans OM5]
          Length = 204

 Score =  258 bits (659), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 153/205 (74%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY  ++A+DTETLGL P RDRLC+VQLS GDGT D+++I AG  +
Sbjct: 2   TIRLHRGDLPD--LSRYTHSVAIDTETLGLNPHRDRLCVVQLSNGDGTADVVQIPAGHTD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    K+FH+ RFDIAVL + FGV  +P++CTKIAS+L RTYT++HGLKD 
Sbjct: 60  APNLKKLLADPMVTKLFHFARFDIAVLEHAFGVMTQPIYCTKIASKLVRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELLG+ ISK QQSSDW A+ LS+ QL YAASDV+HLHALR +    L R  R DLA S
Sbjct: 120 VRELLGVEISKQQQSSDWGAEKLSEAQLTYAASDVLHLHALREKLDTMLARENRMDLAKS 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW+  DIF+HS
Sbjct: 180 CFEFLPTRARLDLQGWDETDIFAHS 204


>gi|239830972|ref|ZP_04679301.1| 3'-5' exonuclease [Ochrobactrum intermedium LMG 3301]
 gi|239823239|gb|EEQ94807.1| 3'-5' exonuclease [Ochrobactrum intermedium LMG 3301]
          Length = 205

 Score =  258 bits (658), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 157/205 (76%), Gaps = 1/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H+ D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK 
Sbjct: 2   TIRFHKNDLP-NLDHYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQKK 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D    KIFH+GRFD+AVL +TFG   +PVFCTKIAS+LTRTYT++HGLK+ 
Sbjct: 61  APNLVKLLKDRSITKIFHFGRFDLAVLAHTFGTMPQPVFCTKIASKLTRTYTDRHGLKEL 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A +
Sbjct: 121 CNELLDVSISKQQQSSDWAAETLSAAQLEYAASDVLYLHRLKAVLEQRLERDGRAKQAEA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ELDL+GW   DIF+HS
Sbjct: 181 CFKFLPTRSELDLMGWPEDDIFAHS 205


>gi|13472866|ref|NP_104433.1| hypothetical protein mll3296 [Mesorhizobium loti MAFF303099]
 gi|14023613|dbj|BAB50219.1| mll3296 [Mesorhizobium loti MAFF303099]
          Length = 206

 Score =  257 bits (657), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+ D+P + +   V A+A+DTETLGL P RDRLC+VQ+SPGDG+ D+I+IA GQ
Sbjct: 1   MADIRFHKHDLP-DLSHYNVGAVAIDTETLGLNPHRDRLCLVQISPGDGSADVIQIAPGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L +    K+FH+GRFD+AVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 60  KKAPNLVSLLRNRSVTKLFHFGRFDLAVLYNAFGVMPEPVFCTKIASRLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D   ELLG+ +SKAQQSSDW+A+ LS EQL+YAASDV++LH LR     +L R GR+  A
Sbjct: 120 DICFELLGVGLSKAQQSSDWAAETLSPEQLEYAASDVLYLHRLRDVLAGRLAREGRTKEA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GW+  DIF+HS
Sbjct: 180 DACFRFLPTRAKLDLMGWDEEDIFAHS 206


>gi|17988111|ref|NP_540745.1| ribonuclease D [Brucella melitensis bv. 1 str. 16M]
 gi|62289101|ref|YP_220894.1| 3-5 exonuclease family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699039|ref|YP_413613.1| 3'-5' exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|148559185|ref|YP_001258158.1| 3'-5' exonuclease family protein [Brucella ovis ATCC 25840]
 gi|189023376|ref|YP_001934144.1| 3'-5' exonuclease [Brucella abortus S19]
 gi|225626663|ref|ZP_03784702.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|225851660|ref|YP_002731893.1| hypothetical protein BMEA_A0127 [Brucella melitensis ATCC 23457]
 gi|237814593|ref|ZP_04593591.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|254690430|ref|ZP_05153684.1| hypothetical protein Babob68_09714 [Brucella abortus bv. 6 str.
           870]
 gi|254694918|ref|ZP_05156746.1| hypothetical protein Babob3T_09702 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696124|ref|ZP_05157952.1| hypothetical protein Babob28_00020 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700933|ref|ZP_05162761.1| hypothetical protein Bsuib55_08749 [Brucella suis bv. 5 str. 513]
 gi|254707182|ref|ZP_05169010.1| hypothetical protein BpinM_09468 [Brucella pinnipedialis
           M163/99/10]
 gi|254709273|ref|ZP_05171084.1| hypothetical protein BpinB_03206 [Brucella pinnipedialis B2/94]
 gi|254713304|ref|ZP_05175115.1| hypothetical protein BcetM6_08117 [Brucella ceti M644/93/1]
 gi|254716342|ref|ZP_05178153.1| hypothetical protein BcetM_07890 [Brucella ceti M13/05/1]
 gi|254731461|ref|ZP_05190039.1| hypothetical protein Babob42_09744 [Brucella abortus bv. 4 str.
           292]
 gi|256030796|ref|ZP_05444410.1| hypothetical protein BpinM2_09123 [Brucella pinnipedialis
           M292/94/1]
 gi|256045912|ref|ZP_05448786.1| hypothetical protein Bmelb1R_15494 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060264|ref|ZP_05450439.1| hypothetical protein Bneo5_07870 [Brucella neotomae 5K33]
 gi|256112626|ref|ZP_05453547.1| hypothetical protein Bmelb3E_08085 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158817|ref|ZP_05456678.1| hypothetical protein BcetM4_08038 [Brucella ceti M490/95/1]
 gi|256254202|ref|ZP_05459738.1| hypothetical protein BcetB_07895 [Brucella ceti B1/94]
 gi|256258682|ref|ZP_05464218.1| hypothetical protein Babob9C_15316 [Brucella abortus bv. 9 str.
           C68]
 gi|256264829|ref|ZP_05467361.1| 3'-5' exonuclease [Brucella melitensis bv. 2 str. 63/9]
 gi|256368584|ref|YP_003106090.1| 3'-5' exonuclease family protein [Brucella microti CCM 4915]
 gi|260169700|ref|ZP_05756511.1| 3'-5' exonuclease family protein [Brucella sp. F5/99]
 gi|260546398|ref|ZP_05822138.1| 3'-5' exonuclease [Brucella abortus NCTC 8038]
 gi|260563197|ref|ZP_05833683.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. 16M]
 gi|260755977|ref|ZP_05868325.1| 3'-5' exonuclease [Brucella abortus bv. 6 str. 870]
 gi|260759201|ref|ZP_05871549.1| 3'-5' exonuclease [Brucella abortus bv. 4 str. 292]
 gi|260760489|ref|ZP_05872835.1| 3'-5' exonuclease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884998|ref|ZP_05896612.1| 3'-5' exonuclease [Brucella abortus bv. 9 str. C68]
 gi|261215252|ref|ZP_05929533.1| 3'-5' exonuclease [Brucella abortus bv. 3 str. Tulya]
 gi|261218123|ref|ZP_05932404.1| 3'-5' exonuclease [Brucella ceti M13/05/1]
 gi|261221350|ref|ZP_05935631.1| 3'-5' exonuclease [Brucella ceti B1/94]
 gi|261314663|ref|ZP_05953860.1| 3'-5' exonuclease [Brucella pinnipedialis M163/99/10]
 gi|261316779|ref|ZP_05955976.1| 3'-5' exonuclease [Brucella pinnipedialis B2/94]
 gi|261321030|ref|ZP_05960227.1| 3'-5' exonuclease [Brucella ceti M644/93/1]
 gi|261324237|ref|ZP_05963434.1| 3'-5' exonuclease [Brucella neotomae 5K33]
 gi|261751448|ref|ZP_05995157.1| 3'-5' exonuclease [Brucella suis bv. 5 str. 513]
 gi|261759236|ref|ZP_06002945.1| 3'-5' exonuclease [Brucella sp. F5/99]
 gi|265987850|ref|ZP_06100407.1| 3'-5' exonuclease [Brucella pinnipedialis M292/94/1]
 gi|265992324|ref|ZP_06104881.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994066|ref|ZP_06106623.1| 3'-5' exonuclease [Brucella melitensis bv. 3 str. Ether]
 gi|265997310|ref|ZP_06109867.1| 3'-5' exonuclease [Brucella ceti M490/95/1]
 gi|294851524|ref|ZP_06792197.1| ribonuclease D [Brucella sp. NVSL 07-0026]
 gi|297247517|ref|ZP_06931235.1| 3'-5' exonuclease [Brucella abortus bv. 5 str. B3196]
 gi|306842591|ref|ZP_07475240.1| 3'-5' exonuclease [Brucella sp. BO2]
 gi|17983864|gb|AAL53009.1| ribonuclease d [Brucella melitensis bv. 1 str. 16M]
 gi|62195233|gb|AAX73533.1| 3-5 exonuclease family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615140|emb|CAJ10073.1| 3'-5' exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|148370442|gb|ABQ60421.1| 3'-5' exonuclease family protein [Brucella ovis ATCC 25840]
 gi|189018948|gb|ACD71670.1| 3'-5' exonuclease [Brucella abortus S19]
 gi|225618320|gb|EEH15363.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|225640025|gb|ACN99938.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237789430|gb|EEP63640.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|255998742|gb|ACU47141.1| 3'-5' exonuclease family protein [Brucella microti CCM 4915]
 gi|260096505|gb|EEW80381.1| 3'-5' exonuclease [Brucella abortus NCTC 8038]
 gi|260153213|gb|EEW88305.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. 16M]
 gi|260669519|gb|EEX56459.1| 3'-5' exonuclease [Brucella abortus bv. 4 str. 292]
 gi|260670924|gb|EEX57745.1| 3'-5' exonuclease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676085|gb|EEX62906.1| 3'-5' exonuclease [Brucella abortus bv. 6 str. 870]
 gi|260874526|gb|EEX81595.1| 3'-5' exonuclease [Brucella abortus bv. 9 str. C68]
 gi|260916859|gb|EEX83720.1| 3'-5' exonuclease [Brucella abortus bv. 3 str. Tulya]
 gi|260919934|gb|EEX86587.1| 3'-5' exonuclease [Brucella ceti B1/94]
 gi|260923212|gb|EEX89780.1| 3'-5' exonuclease [Brucella ceti M13/05/1]
 gi|261293720|gb|EEX97216.1| 3'-5' exonuclease [Brucella ceti M644/93/1]
 gi|261296002|gb|EEX99498.1| 3'-5' exonuclease [Brucella pinnipedialis B2/94]
 gi|261300217|gb|EEY03714.1| 3'-5' exonuclease [Brucella neotomae 5K33]
 gi|261303689|gb|EEY07186.1| 3'-5' exonuclease [Brucella pinnipedialis M163/99/10]
 gi|261739220|gb|EEY27216.1| 3'-5' exonuclease [Brucella sp. F5/99]
 gi|261741201|gb|EEY29127.1| 3'-5' exonuclease [Brucella suis bv. 5 str. 513]
 gi|262551778|gb|EEZ07768.1| 3'-5' exonuclease [Brucella ceti M490/95/1]
 gi|262765047|gb|EEZ10968.1| 3'-5' exonuclease [Brucella melitensis bv. 3 str. Ether]
 gi|263003390|gb|EEZ15683.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095285|gb|EEZ18912.1| 3'-5' exonuclease [Brucella melitensis bv. 2 str. 63/9]
 gi|264660047|gb|EEZ30308.1| 3'-5' exonuclease [Brucella pinnipedialis M292/94/1]
 gi|294820113|gb|EFG37112.1| ribonuclease D [Brucella sp. NVSL 07-0026]
 gi|297174686|gb|EFH34033.1| 3'-5' exonuclease [Brucella abortus bv. 5 str. B3196]
 gi|306287236|gb|EFM58724.1| 3'-5' exonuclease [Brucella sp. BO2]
 gi|326408140|gb|ADZ65205.1| 3'-5' exonuclease [Brucella melitensis M28]
 gi|326537851|gb|ADZ86066.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 205

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 155/205 (75%), Gaps = 1/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK 
Sbjct: 2   TIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQKK 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+ 
Sbjct: 61  APNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKEI 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A +
Sbjct: 121 CSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAEA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ELDL+GW   DIF+HS
Sbjct: 181 CFKFLPTRSELDLMGWAESDIFAHS 205


>gi|158425553|ref|YP_001526845.1| 3'-5' exonuclease [Azorhizobium caulinodans ORS 571]
 gi|158332442|dbj|BAF89927.1| 3'-5' exonuclease [Azorhizobium caulinodans ORS 571]
          Length = 206

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/207 (60%), Positives = 155/207 (74%), Gaps = 4/207 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ-- 60
           TIR+H GD+P       V  +A+DTETLGL P RDRLC+VQLS GDGT D+++I AG   
Sbjct: 2   TIRLHRGDLPDSFQPAPV--VAIDTETLGLKPHRDRLCVVQLSNGDGTADVVQIPAGATA 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           ++APNLV ML D    K+FH+GRFDIAVL +TFGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 60  ESAPNLVRMLADPNVVKLFHFGRFDIAVLLHTFGVTTAPVFCTKIASRLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D ++ELLG+++SK QQSSDW+A +L+D QL YAASDV+HLHA + +    L R GR+ LA
Sbjct: 120 DLVRELLGVDLSKQQQSSDWAASELTDAQLAYAASDVLHLHACKEKLEAMLARDGRTALA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
             C  FL  RA LDL GW + DIF+HS
Sbjct: 180 AECFKFLPARAALDLAGWPDEDIFAHS 206


>gi|90420956|ref|ZP_01228860.1| 3'-5' exonuclease [Aurantimonas manganoxydans SI85-9A1]
 gi|90334734|gb|EAS48510.1| 3'-5' exonuclease [Aurantimonas manganoxydans SI85-9A1]
          Length = 205

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 157/205 (76%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIRVH+GD+P    +RY   +A+DTETLGL  RRDRLC+VQLSPGDGT D+++IA GQ  
Sbjct: 2   TIRVHKGDLPD--ISRYTGPVAIDTETLGLDTRRDRLCVVQLSPGDGTADVVQIAKGQSE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APN+  +L D  + KIFHY RFD+A L++ FGV    +FCTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNITALLKDPAKTKIFHYARFDVAALYHAFGVMTDGIFCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +E++G++ISK QQSSDW+A+ LS  Q++YAASDV++LH +     ++L+R  R +LA +
Sbjct: 120 AREMVGVDISKQQQSSDWAAETLSQAQVEYAASDVLYLHDIMGGLYKRLEREDRMELAKA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDL GW++ DIFSHS
Sbjct: 180 CFTFLPTRAKLDLAGWDDEDIFSHS 204


>gi|260460457|ref|ZP_05808708.1| 3'-5' exonuclease [Mesorhizobium opportunistum WSM2075]
 gi|259033562|gb|EEW34822.1| 3'-5' exonuclease [Mesorhizobium opportunistum WSM2075]
          Length = 206

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/207 (60%), Positives = 157/207 (75%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+ D+P +     V A+A+DTETLGL P RDRLC+VQ+SPGDG+ D+I+IA GQ
Sbjct: 1   MADIRFHKHDLP-DLTHYNVGAVAIDTETLGLNPHRDRLCVVQISPGDGSADVIQIAPGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L +    K+FHYGRFD+AVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 60  KKAPNLVSLLRNRGITKLFHYGRFDLAVLYNAFGVMPEPVFCTKIASRLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D   ELLG+ +SKAQQSSDW+A+ LS EQL+YAASDV++LH LR   + +L R GR+  A
Sbjct: 120 DICFELLGVGLSKAQQSSDWAAEILSPEQLEYAASDVLYLHRLRDVLSGRLARDGRTKEA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GW   DIF+HS
Sbjct: 180 DACFRFLPTRAKLDLMGWGEEDIFAHS 206


>gi|306844394|ref|ZP_07476984.1| 3'-5' exonuclease [Brucella sp. BO1]
 gi|306275207|gb|EFM56957.1| 3'-5' exonuclease [Brucella sp. BO1]
          Length = 205

 Score =  255 bits (652), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 155/205 (75%), Gaps = 1/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK 
Sbjct: 2   TIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIDAGQKK 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+ 
Sbjct: 61  APNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKEI 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A +
Sbjct: 121 CSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAEA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ELDL+GW   DIF+HS
Sbjct: 181 CFKFLPTRSELDLMGWAESDIFAHS 205


>gi|39933126|ref|NP_945402.1| 3'-5' exonuclease [Rhodopseudomonas palustris CGA009]
 gi|39652751|emb|CAE25490.1| 3'-5' exonuclease [Rhodopseudomonas palustris CGA009]
          Length = 204

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 154/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  +
Sbjct: 2   TIRLHRGDLPD--LSRYTHSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGATD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L+ TFGV  +PV+CTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNLKKLLGDPAVVKIFHFARFDLAALYKTFGVMPQPVYCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELLGI++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L R  R+DLA +
Sbjct: 120 VRELLGIDLSKQQQSSDWGADSLSDAQLAYAASDVLHLHALRDRLDTMLARENRTDLAAA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW   DIF+HS
Sbjct: 180 CFGFLPVRARLDLDGWSEEDIFAHS 204


>gi|153007480|ref|YP_001368695.1| 3'-5' exonuclease [Ochrobactrum anthropi ATCC 49188]
 gi|151559368|gb|ABS12866.1| 3'-5' exonuclease [Ochrobactrum anthropi ATCC 49188]
          Length = 205

 Score =  255 bits (651), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 155/205 (75%), Gaps = 1/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H+ D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK 
Sbjct: 2   TIRFHKNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQKK 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D    KIFH+GRFD+AVL   FG   +PVFCTKIAS+LTRTYT++HGLK+ 
Sbjct: 61  APNLVKLLKDRSITKIFHFGRFDLAVLAQAFGTMPQPVFCTKIASKLTRTYTDRHGLKEL 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A +
Sbjct: 121 CNELLDVSISKQQQSSDWAAETLSAAQLEYAASDVLYLHRLKAVLEQRLERDGRAKQAEA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ELDL+GW   DIF+HS
Sbjct: 181 CFKFLPTRSELDLMGWPEDDIFAHS 205


>gi|192288480|ref|YP_001989085.1| 3'-5' exonuclease [Rhodopseudomonas palustris TIE-1]
 gi|192282229|gb|ACE98609.1| 3'-5' exonuclease [Rhodopseudomonas palustris TIE-1]
          Length = 204

 Score =  255 bits (651), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 154/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY +++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  +
Sbjct: 2   TIRLHRGDLPD--LSRYTNSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGATD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L+  FGV  +PV+CTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNLKKLLGDPAVVKIFHFARFDLAALYKAFGVMPQPVYCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELLGI++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L R  R+DLA +
Sbjct: 120 VRELLGIDLSKQQQSSDWGADSLSDAQLAYAASDVLHLHALRDKLDTMLARENRTDLAAA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW   DIF+HS
Sbjct: 180 CFGFLPIRARLDLDGWSEEDIFAHS 204


>gi|316931442|ref|YP_004106424.1| 3'-5' exonuclease [Rhodopseudomonas palustris DX-1]
 gi|315599156|gb|ADU41691.1| 3'-5' exonuclease [Rhodopseudomonas palustris DX-1]
          Length = 211

 Score =  254 bits (650), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 154/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  +
Sbjct: 9   TIRLHRGDLPD--LSRYTHSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPLGATD 66

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L+  FGV  +PV+CTKIASRLTRTYT++HGLKD 
Sbjct: 67  APNLKKLLGDPAVVKIFHFARFDLAALYKAFGVMPQPVYCTKIASRLTRTYTDRHGLKDL 126

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELLGI++SK QQSSDW A+ LSD QL YAASDV+HLHALR +    L R GR+DLA +
Sbjct: 127 VRELLGIDLSKQQQSSDWGAESLSDAQLAYAASDVLHLHALRDKLDTMLAREGRTDLAAA 186

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW   DIF+HS
Sbjct: 187 CFGFLPVRARLDLDGWSEEDIFAHS 211


>gi|319406582|emb|CBI80224.1| Ribonuclease D [Bartonella sp. 1-1C]
          Length = 206

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/206 (62%), Positives = 160/206 (77%), Gaps = 1/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       VD+IA+DTETLGL P RDRLC+VQLSPGDGT DII+IA GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYCVDSIAIDTETLGLQPHRDRLCVVQLSPGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFGV    VFCTK+AS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVTLLEDKTITKIFHFGRFDLAILAHTFGVMPDAVFCTKLASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAADALSRAQIEYAASDVLYLHRLKSIFEERLKREEREDIA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RA+LDLLGW  VDIF+H
Sbjct: 180 KACFQFLPVRAKLDLLGWSEVDIFAH 205


>gi|148251746|ref|YP_001236331.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           BTAi1]
 gi|146403919|gb|ABQ32425.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           BTAi1]
          Length = 204

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 120/205 (58%), Positives = 155/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+R+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLSPGDG+ D+++I  G  +
Sbjct: 2   TVRLHRGDLPD--LSRYTSSVAIDTETMGLNPHRDRLCVVQLSPGDGSADVVQIPKGHTD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L +    KIFH+ RFD+A LF+TFGV  +PV+CTKIASRL RTYT++HGLKD 
Sbjct: 60  APNLKALLANPAITKIFHFARFDVATLFHTFGVMPQPVYCTKIASRLARTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELL +++SK QQSSDW AD+LS+ QL YAASDV+HLHALR +    L R GR  LA +
Sbjct: 120 VRELLNVDLSKQQQSSDWGADNLSEPQLAYAASDVLHLHALREKLDVMLAREGRLGLAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL G+E  DIF+HS
Sbjct: 180 CFAFLPHRATLDLGGFEAEDIFAHS 204


>gi|254718341|ref|ZP_05180152.1| hypothetical protein Bru83_02133 [Brucella sp. 83/13]
 gi|265983300|ref|ZP_06096035.1| 3'-5' exonuclease [Brucella sp. 83/13]
 gi|306839563|ref|ZP_07472369.1| 3'-5' exonuclease [Brucella sp. NF 2653]
 gi|264661892|gb|EEZ32153.1| 3'-5' exonuclease [Brucella sp. 83/13]
 gi|306405349|gb|EFM61622.1| 3'-5' exonuclease [Brucella sp. NF 2653]
          Length = 205

 Score =  254 bits (649), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 154/205 (75%), Gaps = 1/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK 
Sbjct: 2   TIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCMVQISPGDGTADVIQIEAGQKK 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D    KIFH+GRFD+AVL   FG   +PVFCTKIAS+LTRTYT++HGLK+ 
Sbjct: 61  APNLVKLLKDRSITKIFHFGRFDLAVLANAFGTMPQPVFCTKIASKLTRTYTDRHGLKEI 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A +
Sbjct: 121 CSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAEA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ELDL+GW   DIF+HS
Sbjct: 181 CFKFLPTRSELDLMGWAESDIFAHS 205


>gi|299133324|ref|ZP_07026519.1| 3'-5' exonuclease [Afipia sp. 1NLS2]
 gi|298593461|gb|EFI53661.1| 3'-5' exonuclease [Afipia sp. 1NLS2]
          Length = 204

 Score =  254 bits (649), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 152/205 (74%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY  ++A+DTETLGL P RDRLC+VQLS GDG+ D+++I AG  +
Sbjct: 2   TIRLHRGDLPD--LSRYTHSVAIDTETLGLNPHRDRLCVVQLSNGDGSADVVQIPAGHTD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    K+FH+ RFDIAVL++ FGV  +PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  APNLKKLLGDPAITKLFHFARFDIAVLYHAFGVMAQPVYCTKIASKLVRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E+LG+ ISK QQSSDW A  LS+ QL YAASDV+HLHALR +    L R  R  LA +
Sbjct: 120 VREMLGVEISKQQQSSDWGAASLSEAQLSYAASDVLHLHALRDKLDAMLAREDREPLAKA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GWE  DIF+HS
Sbjct: 180 CFEFLPTRARLDLQGWEETDIFAHS 204


>gi|163842395|ref|YP_001626799.1| hypothetical protein BSUIS_A0125 [Brucella suis ATCC 23445]
 gi|163673118|gb|ABY37229.1| Hypothetical protein BSUIS_A0125 [Brucella suis ATCC 23445]
          Length = 205

 Score =  254 bits (648), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 154/205 (75%), Gaps = 1/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H  D+P       V A+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK 
Sbjct: 2   TIRFHRNDLP-NLDNYQVAAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQKK 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+ 
Sbjct: 61  APNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKEI 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A +
Sbjct: 121 CSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAEA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ELDL+GW   DIF+HS
Sbjct: 181 CFKFLPTRSELDLMGWAESDIFAHS 205


>gi|49473901|ref|YP_031943.1| ribonuclease d [Bartonella quintana str. Toulouse]
 gi|49239404|emb|CAF25742.1| Ribonuclease d [Bartonella quintana str. Toulouse]
          Length = 206

 Score =  253 bits (647), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 161/207 (77%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       +DA+AVDTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MKEIRVHQGDLP-NLDNYQIDAVAVDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K+APNLV +L D+   KIFH+GRFD+A+L YTFGV    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  KSAPNLVKLLKDKAITKIFHFGRFDLAILAYTFGVMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH LR  F E+L+R  R ++A
Sbjct: 120 EICCELLNVNISKQQQSSDWAAEILSRAQIEYAASDVLYLHRLRDIFEERLKREERENVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  VDIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWSEVDIFAHS 206


>gi|23501034|ref|NP_697161.1| 3'-5' exonuclease family protein [Brucella suis 1330]
 gi|161618108|ref|YP_001591995.1| hypothetical protein BCAN_A0123 [Brucella canis ATCC 23365]
 gi|254705301|ref|ZP_05167129.1| hypothetical protein Bsuib36_15553 [Brucella suis bv. 3 str. 686]
 gi|260567236|ref|ZP_05837706.1| 3'-5' exonuclease [Brucella suis bv. 4 str. 40]
 gi|261756011|ref|ZP_05999720.1| 3'-5' exonuclease [Brucella suis bv. 3 str. 686]
 gi|23346898|gb|AAN29076.1| 3'-5' exonuclease family protein [Brucella suis 1330]
 gi|161334919|gb|ABX61224.1| Hypothetical protein BCAN_A0123 [Brucella canis ATCC 23365]
 gi|260156754|gb|EEW91834.1| 3'-5' exonuclease [Brucella suis bv. 4 str. 40]
 gi|261745764|gb|EEY33690.1| 3'-5' exonuclease [Brucella suis bv. 3 str. 686]
          Length = 205

 Score =  253 bits (647), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 154/205 (75%), Gaps = 1/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I A QK 
Sbjct: 2   TIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEADQKK 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+ 
Sbjct: 61  APNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKEI 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A +
Sbjct: 121 CSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAEA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ELDL+GW   DIF+HS
Sbjct: 181 CFKFLPTRSELDLMGWAESDIFAHS 205


>gi|90421943|ref|YP_530313.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB18]
 gi|90103957|gb|ABD85994.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB18]
          Length = 204

 Score =  253 bits (647), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 154/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY D++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  +
Sbjct: 2   TIRLHRGDLPD--LSRYTDSVAIDTETMGLNPHRDRLCVVQLSNGDGSADVVQIPVGHSD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L+   GV  +PV+CTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNLKKLLGDPAITKIFHFARFDLAALYNALGVMPQPVYCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E+LG+++SK QQSSDW A  LSD QL YAASDV+HLH LR +    L R GR++LA +
Sbjct: 120 VREVLGVDLSKQQQSSDWGAQSLSDAQLAYAASDVLHLHGLRTRLDAMLAREGRTELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA+LDL GW   DIF+HS
Sbjct: 180 CFDFLPTRAKLDLSGWAEQDIFAHS 204


>gi|27375830|ref|NP_767359.1| hypothetical protein blr0719 [Bradyrhizobium japonicum USDA 110]
 gi|27348968|dbj|BAC45984.1| blr0719 [Bradyrhizobium japonicum USDA 110]
          Length = 204

 Score =  253 bits (647), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 155/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+R+H GD+P    +RY  A+A+DTET+GL P RDRLC+VQLSPGDG+ D+++I  G  +
Sbjct: 2   TVRLHRGDLPD--LSRYTGAVAIDTETMGLNPHRDRLCVVQLSPGDGSADVVQIPKGHTD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L +    KIFH+ RFD+AVL+ +FGV   P++CTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNLKALLANPAITKIFHFARFDVAVLYQSFGVMTGPIYCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E+L +++SK QQSSDW +D L++ QL YAASDV+HLHALR +    L R GR+ LA +
Sbjct: 120 VREVLNVDLSKQQQSSDWGSDSLTEPQLAYAASDVLHLHALRERLDAMLVREGRTGLAKA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA LDL GW   DIF+HS
Sbjct: 180 CFDFLPTRALLDLQGWAEEDIFAHS 204


>gi|85714031|ref|ZP_01045020.1| 3'-5' exonuclease [Nitrobacter sp. Nb-311A]
 gi|85699157|gb|EAQ37025.1| 3'-5' exonuclease [Nitrobacter sp. Nb-311A]
          Length = 206

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 152/205 (74%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P +  ARY  + A+DTET+GL P RDRLC+VQ+SPGDG+ D+I+IA GQ +
Sbjct: 2   TIRLHRGDLPDQDLARYTGSAAIDTETMGLKPHRDRLCVVQMSPGDGSADVIQIARGQHD 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L   FGV  RPV+CTKIASRLTRTYT++HGLKD 
Sbjct: 62  APNLKKLLGDPAIVKIFHFARFDLAALHNAFGVMPRPVYCTKIASRLTRTYTDRHGLKDL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E L I++SK QQSSDW +  LSD QL YAASDV+HLHALR +    L R  R+ LA +
Sbjct: 122 VREALSIDLSKQQQSSDWGSLALSDAQLAYAASDVLHLHALRDKLDAMLAREDRTGLAQA 181

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW+  DIF+HS
Sbjct: 182 CFEFLPARAMLDLSGWDAEDIFAHS 206


>gi|217976351|ref|YP_002360498.1| 3'-5' exonuclease [Methylocella silvestris BL2]
 gi|217501727|gb|ACK49136.1| 3'-5' exonuclease [Methylocella silvestris BL2]
          Length = 204

 Score =  252 bits (644), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 153/204 (75%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H+GD+P   A  +  A+A+DTET+GL+P RDRLC+VQLS GDG+ D+++IA  Q  
Sbjct: 2   TIRLHKGDLPEGEA--FSGAVAIDTETMGLVPGRDRLCLVQLSRGDGSADLVQIAPAQTA 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D   EK+FH+ RFDIAVL+ TFGV   P++CTKIAS+L RTYT++HGLKD 
Sbjct: 60  APNLTRLLADPAVEKLFHFARFDIAVLYKTFGVMTGPIYCTKIASKLARTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLGI +SK QQSSDW  D LS+ QL YAASDV+HLHALR +    L+R GR  LA +
Sbjct: 120 ARELLGIELSKQQQSSDWGGDILSEAQLAYAASDVLHLHALRTKLDAMLEREGRRALAEA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  RA+LDL+GW + DIFSH
Sbjct: 180 SFAFLPTRAKLDLMGWGDSDIFSH 203


>gi|121602332|ref|YP_989471.1| 3'-5' exonuclease domain-containing protein [Bartonella
           bacilliformis KC583]
 gi|120614509|gb|ABM45110.1| 3'-5' exonuclease domain protein [Bartonella bacilliformis KC583]
          Length = 206

 Score =  252 bits (644), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 160/207 (77%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       VDA+A+DTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MIDIRVHQGDLP-NLDNYCVDAVAIDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFG+    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVKLLADKAITKIFHFGRFDLAILAHTFGIMPDAVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAAETLSRAQIEYAASDVLYLHRLKSVFEERLKREEREDVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  +DIF+HS
Sbjct: 180 KACFQFLPVRAKLDLLGWPEIDIFAHS 206


>gi|304392222|ref|ZP_07374164.1| 3'-5' exonuclease [Ahrensia sp. R2A130]
 gi|303296451|gb|EFL90809.1| 3'-5' exonuclease [Ahrensia sp. R2A130]
          Length = 211

 Score =  252 bits (644), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/205 (58%), Positives = 154/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H+ D+P    + Y D++A+DTETLGL PRRDRLC+VQLSPGDGT D+++I  GQ +
Sbjct: 9   TIRLHKNDLPD--LSNYSDSVAIDTETLGLRPRRDRLCVVQLSPGDGTADVVQIEKGQTS 66

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APN+  +LVD   +KI+HYGRFDIAVL++ FG      FCTKIASRLTRTYT++HGLK+ 
Sbjct: 67  APNIEKLLVDTNVQKIYHYGRFDIAVLYHAFGALSDNNFCTKIASRLTRTYTDRHGLKNL 126

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             EL+G+++SK QQSSDW+A++L+  Q  YAASDV+HLHALR    ++L R  R  LA  
Sbjct: 127 THELIGVDLSKVQQSSDWAAEELTKAQQAYAASDVLHLHALRDALLKRLAREDRQHLADE 186

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R  LDL GWE+ DIF+HS
Sbjct: 187 CFKFLPTRCLLDLAGWEDTDIFAHS 211


>gi|92115811|ref|YP_575540.1| 3'-5' exonuclease [Nitrobacter hamburgensis X14]
 gi|91798705|gb|ABE61080.1| 3'-5' exonuclease [Nitrobacter hamburgensis X14]
          Length = 206

 Score =  252 bits (643), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 120/205 (58%), Positives = 150/205 (73%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P +   RY  + A+DTET+GL P RDRLC+VQ+SPGDG+ D+I+IA GQ+ 
Sbjct: 2   TIRLHRGDLPDQDLKRYTHSAAIDTETMGLNPHRDRLCVVQMSPGDGSADVIQIAQGQRE 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L   FGV  +PV+CTKIASRL RTYT++HGLKD 
Sbjct: 62  APNLKQLLADPTIVKIFHFARFDLAALSNAFGVMPQPVYCTKIASRLIRTYTDRHGLKDL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELL I +SK QQSSDW A  LSD QL YAASDV+HLHALR +    L R  R+ +A +
Sbjct: 122 VRELLNIELSKQQQSSDWGAQTLSDAQLAYAASDVLHLHALRDKLDAMLARENRTGMAQA 181

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDL GW   DIF+H+
Sbjct: 182 CFEFLPTRAKLDLSGWGAEDIFAHA 206


>gi|146337290|ref|YP_001202338.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           ORS278]
 gi|146190096|emb|CAL74088.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           ORS278]
          Length = 204

 Score =  252 bits (643), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 154/205 (75%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+R+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLSPGDG+ D+++I  G  +
Sbjct: 2   TVRLHRGDLPD--LSRYTSSVAIDTETMGLNPHRDRLCVVQLSPGDGSADVVQIPKGHTD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L +    KIFH+ RFD+A LF+TFGV  +PV+CTKIASRL RTYT++HGLKD 
Sbjct: 60  APNLKTLLGNTAITKIFHFARFDVATLFHTFGVMPQPVYCTKIASRLARTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELL I++SK QQSSDW AD LS+ QL YAASDV+HLHALR +    L R GR  LA +
Sbjct: 120 VRELLNIDLSKQQQSSDWGADSLSEPQLAYAASDVLHLHALREKLDVMLAREGRLALAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL G+E  DIF+HS
Sbjct: 180 CFAFLPHRATLDLGGFEADDIFAHS 204


>gi|240849913|ref|YP_002971302.1| 3'-5' exonuclease [Bartonella grahamii as4aup]
 gi|240267036|gb|ACS50624.1| 3'-5' exonuclease [Bartonella grahamii as4aup]
          Length = 206

 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 126/207 (60%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P        DAIA+DTETLGL P RDRLC+VQLS GDGT D+I+I+ GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYKTDAIAIDTETLGLQPHRDRLCVVQLSSGDGTADVIQISKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K+APNLV +L D    KIFH+GRFD+A+L +TFGV    +FCTKIAS+LTRTYT++HGLK
Sbjct: 60  KSAPNLVKLLGDNAVIKIFHFGRFDLAILAHTFGVMPEAIFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L++ F E+L+R  R  +A
Sbjct: 120 EICNELLNVNISKQQQSSDWAAETLSQAQIEYAASDVLYLHRLKVIFEERLRREERESVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  VDIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWAEVDIFAHS 206


>gi|319403664|emb|CBI77249.1| Ribonuclease D [Bartonella rochalimae ATCC BAA-1498]
          Length = 206

 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 159/206 (77%), Gaps = 1/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       VD+IA+DTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYCVDSIAIDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFGV    VFCTK+AS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVTLLEDKTITKIFHFGRFDLAILAHTFGVMPDAVFCTKLASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAADALSRAQIEYAASDVLYLHRLKSIFEERLKREEREDIA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RA+LDLLGW  VDIF+H
Sbjct: 180 KACFQFLPVRAKLDLLGWSEVDIFAH 205


>gi|49475064|ref|YP_033105.1| ribonuclease d [Bartonella henselae str. Houston-1]
 gi|49237869|emb|CAF27065.1| Ribonuclease d [Bartonella henselae str. Houston-1]
          Length = 206

 Score =  251 bits (641), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 160/207 (77%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT IRVH+GD+P     R +DA+AVDTETLGL P RDRLC+VQLS GDGT D+I+IA GQ
Sbjct: 1   MTEIRVHQGDLPNLDNYR-IDAVAVDTETLGLQPHRDRLCVVQLSSGDGTADVIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K+APNLV +L D    KIFH+GRFD+A+L +TFGV    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  KSAPNLVRLLSDRDITKIFHFGRFDLAILAHTFGVMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L+  F E+L+R  R  +A
Sbjct: 120 EICGELLNVNISKQQQSSDWAAETLSRAQIEYAASDVLYLHRLKDIFEERLKREERESVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA LDLLGW  +DIF+HS
Sbjct: 180 KACFQFLPMRANLDLLGWSEIDIFAHS 206


>gi|114706944|ref|ZP_01439843.1| hypothetical protein FP2506_02794 [Fulvimarina pelagi HTCC2506]
 gi|114537494|gb|EAU40619.1| hypothetical protein FP2506_02794 [Fulvimarina pelagi HTCC2506]
          Length = 207

 Score =  250 bits (639), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 149/205 (72%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIRVH+GD+P     RY   +A+DTETLGL   RDRLC+VQLSPGDGT D+++IA GQ  
Sbjct: 2   TIRVHKGDLPD--LDRYTGPVAIDTETLGLNTMRDRLCVVQLSPGDGTADVVQIAKGQTE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APN+  +L D  + KIFHY RFD+A L++ FG     +FCTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNISALLADASKTKIFHYARFDVAALYHAFGAMTEGIFCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL+G+++SK QQSSDW+ + LS  QL YAASDV++LH +     ++L+R  R DLA  
Sbjct: 120 ARELVGVDLSKQQQSSDWAVETLSPAQLDYAASDVLYLHDIMGALYKRLEREDRMDLARE 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R  LDL GWEN DIFSHS
Sbjct: 180 CFRFLPMRVRLDLAGWENEDIFSHS 204


>gi|182677567|ref|YP_001831713.1| 3'-5' exonuclease [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633450|gb|ACB94224.1| 3'-5' exonuclease [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 204

 Score =  250 bits (639), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 118/204 (57%), Positives = 154/204 (75%), Gaps = 2/204 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +H+GD+P   +  +  ++AVDTETLGL+P RDRLC+VQLS GDG   +++I  GQ +A
Sbjct: 3   IHLHKGDLPENVS--FGRSVAVDTETLGLLPHRDRLCLVQLSGGDGQAHLVQIKPGQTHA 60

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P+L  +L+D    K+FHY RFDIAVL+ TFG    P++CTKIAS+LTRTYT++HGLKD  
Sbjct: 61  PHLERLLIDPNVTKLFHYARFDIAVLYKTFGTMTTPLYCTKIASKLTRTYTDRHGLKDLA 120

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +ELLG+++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L+R  R++LA +C
Sbjct: 121 RELLGVDLSKQQQSSDWGADTLSDAQLTYAASDVLHLHALRTKLDGMLEREHRTELAQAC 180

Query: 184 CNFLMDRAELDLLGWENVDIFSHS 207
            +FL  RA+LDL GW   DIFSH+
Sbjct: 181 FDFLPTRAKLDLAGWAETDIFSHA 204


>gi|296446798|ref|ZP_06888736.1| 3'-5' exonuclease [Methylosinus trichosporium OB3b]
 gi|296255673|gb|EFH02762.1| 3'-5' exonuclease [Methylosinus trichosporium OB3b]
          Length = 204

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 150/204 (73%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H+GD+P    A     +A+DTETLGL P RDRLC+VQLS G+G  D++RIA GQ  
Sbjct: 2   TIRLHQGDLPD--GADLGPVVAIDTETLGLNPHRDRLCLVQLSGGNGDADLVRIAPGQTR 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L +    K+FH+GRFDIAV+  TFGV   PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  APNLEALLANPNVLKLFHFGRFDIAVMAKTFGVMAEPVYCTKIASKLIRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELLG+ ISK QQSSDW AD LSD QL YAASDV++LHALR +    L R  R+DLA +
Sbjct: 120 VRELLGVEISKQQQSSDWGADTLSDAQLSYAASDVLYLHALREKLDVMLAREHRTDLAAA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  RA LDL GW  +DIFSH
Sbjct: 180 CFAFLPMRARLDLAGWPEIDIFSH 203


>gi|319405135|emb|CBI78741.1| Ribonuclease D [Bartonella sp. AR 15-3]
          Length = 206

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/206 (61%), Positives = 158/206 (76%), Gaps = 1/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR+H+GD+P       VD++A+DTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MAEIRIHQGDLP-NLDNYCVDSVAIDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNLV +L D+K  KIFH+GRFD+A+L +TF V    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  NRAPNLVTLLEDKKITKIFHFGRFDLAILAHTFAVMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAADALSRAQIEYAASDVLYLHRLKSIFEERLKREEREDIA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RA+LDLLGW  VDIF+H
Sbjct: 180 KACFQFLPVRAKLDLLGWAEVDIFAH 205


>gi|298290361|ref|YP_003692300.1| 3'-5' exonuclease [Starkeya novella DSM 506]
 gi|296926872|gb|ADH87681.1| 3'-5' exonuclease [Starkeya novella DSM 506]
          Length = 210

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 159/209 (76%), Gaps = 4/209 (1%)

Query: 3   TIRVHEGDIP--AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI--AA 58
           +IR+H GD+   +         +A+DTETLGL P RDRLC+VQLSPGDGT D+++I   A
Sbjct: 2   SIRLHRGDLVDLSRYTPENAPFVAIDTETLGLNPHRDRLCVVQLSPGDGTADVVQIPAGA 61

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +APNL  +L D +  K+FH+ RFD+AVL  TFG+ V PV+CTKIASRLTRTYT++HG
Sbjct: 62  GPGSAPNLEALLTDPRITKLFHFARFDVAVLGKTFGLTVAPVWCTKIASRLTRTYTDRHG 121

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           LK+ ++EL+G+++SK QQSSDW+A++LS+ QLQYAASDV++LHALR +    L R GR++
Sbjct: 122 LKELVRELIGVDLSKQQQSSDWAAEELSEAQLQYAASDVLYLHALREKLASMLARDGRTE 181

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSHS 207
           LA SC  FL  RA+LDL GW + DIF+HS
Sbjct: 182 LAQSCFEFLPTRAKLDLAGWPDEDIFAHS 210


>gi|91974656|ref|YP_567315.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB5]
 gi|91681112|gb|ABE37414.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB5]
          Length = 204

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/205 (57%), Positives = 152/205 (74%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY +++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  +
Sbjct: 2   TIRLHRGDLPD--LSRYTNSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGHSD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L+  FGV  +PV+CTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNLKKLLGDPTVVKIFHFARFDLAALYNAFGVMPQPVYCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELL +++SK QQSSDW A+ LSD QL YAASDV+HLH LR +    L R  R+DLA +
Sbjct: 120 VRELLNVDLSKQQQSSDWGAETLSDAQLAYAASDVLHLHGLREKLDAMLARENRTDLAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  R+ LDL GW   DIF+HS
Sbjct: 180 CFGFLPHRSRLDLDGWSEEDIFAHS 204


>gi|115522454|ref|YP_779365.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisA53]
 gi|115516401|gb|ABJ04385.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisA53]
          Length = 204

 Score =  247 bits (631), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 152/205 (74%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P    +RY D++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G   
Sbjct: 2   TIRLHRGDLPD--LSRYTDSVAIDTETMGLNPHRDRLCVVQLSNGDGSADVVQIPLGHTE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD++ L    GV  +P++CTKIASRL RTYT++HGLKD 
Sbjct: 60  APNLKKLLGDPAVTKIFHFARFDLSALSNALGVMPQPIYCTKIASRLCRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E+LGI++SK QQSSDW A +L+D QL YAASDV+HLHALR +    L R GR+ +A +
Sbjct: 120 VREVLGIDLSKQQQSSDWGAQNLTDAQLAYAASDVLHLHALRARLDAMLAREGRTAMAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA LDL GW N DIF+HS
Sbjct: 180 CFDFLPTRAMLDLSGWNNEDIFAHS 204


>gi|86747785|ref|YP_484281.1| 3'-5' exonuclease [Rhodopseudomonas palustris HaA2]
 gi|86570813|gb|ABD05370.1| 3'-5' exonuclease [Rhodopseudomonas palustris HaA2]
          Length = 204

 Score =  246 bits (629), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 120/205 (58%), Positives = 150/205 (73%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H GD+P     RY D++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  +
Sbjct: 2   TIRLHRGDLPD--LTRYNDSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGHSD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFH+ RFD+A L    GV  +PV+CTKIASRLTRTYT++HGLKD 
Sbjct: 60  APNLKKLLGDPNILKIFHFARFDLAALSNALGVMPQPVYCTKIASRLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELL +++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L R  R++LA +
Sbjct: 120 VRELLNVDLSKQQQSSDWGADTLSDAQLAYAASDVLHLHALRDKLDAMLARENRTELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW   DIF+HS
Sbjct: 180 CFGFLPHRARLDLGGWSEEDIFAHS 204


>gi|154244026|ref|YP_001414984.1| 3'-5' exonuclease [Xanthobacter autotrophicus Py2]
 gi|154158111|gb|ABS65327.1| 3'-5' exonuclease [Xanthobacter autotrophicus Py2]
          Length = 206

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 151/207 (72%), Gaps = 4/207 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ-- 60
           TIR+H GD+PA+  A  V  +A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G   
Sbjct: 2   TIRLHRGDLPADFVAAPV--VAIDTETMGLNPFRDRLCLVQLSNGDGSADLVQIPQGADA 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D    K+FH+GRFDIAVL +TF V  +PV+CTKIASRL RTYT++HGLK
Sbjct: 60  TTAPNLTRLLADPAITKLFHFGRFDIAVLQHTFHVMPQPVWCTKIASRLVRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D L+E + ++ISK QQSSDW A DLSD QL YAASDV+HLHA++ +  E L R  R+ LA
Sbjct: 120 DLLRETINVDISKQQQSSDWGAKDLSDAQLAYAASDVLHLHAVKAKLEEMLARENRTGLA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA LDL GW   DIF+HS
Sbjct: 180 AACFAFLPARAALDLSGWAEEDIFAHS 206


>gi|307943000|ref|ZP_07658345.1| 3'-5' exonuclease [Roseibium sp. TrichSKD4]
 gi|307773796|gb|EFO33012.1| 3'-5' exonuclease [Roseibium sp. TrichSKD4]
          Length = 206

 Score =  241 bits (614), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 118/205 (57%), Positives = 147/205 (71%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H+ D+         DA+AVDTETLGL   RDRLC+VQLSPGDG+ D+++I  G   
Sbjct: 2   TIRFHKNDLSDLTHYVSCDAVAVDTETLGLNLLRDRLCVVQLSPGDGSADVVQIEKGMTA 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D  R KIFHY RFD+A+L    G+ V PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 62  APNLTALLSDPARTKIFHYARFDVAILRQNLGIHVDPVWCTKIASKLCRTYTDRHGLKDI 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLG++ISK QQSSDW+A+ L+D QL YAASDV+HLHAL+ +    L+R  R+ LA +
Sbjct: 122 TRELLGVDISKQQQSSDWAAEQLTDAQLAYAASDVLHLHALKEKLEFMLRREERTHLAEA 181

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
              FL  RAELDL GW   DIF+HS
Sbjct: 182 SFGFLPTRAELDLKGWGETDIFAHS 206


>gi|254470791|ref|ZP_05084194.1| 3'-5' exonuclease [Pseudovibrio sp. JE062]
 gi|211959933|gb|EEA95130.1| 3'-5' exonuclease [Pseudovibrio sp. JE062]
          Length = 206

 Score =  240 bits (613), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 112/205 (54%), Positives = 148/205 (72%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR H+ D+P        DA+AVDTETLGL P RDRLC+VQLS GDG+ D+++I  GQ  
Sbjct: 2   TIRYHKNDLPDLSNYSSADAVAVDTETLGLNPHRDRLCVVQLSSGDGSADVVQIERGQLA 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +  D  + KIFH+ RFD+A+L     + V PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 62  APNLQALFEDASKPKIFHFARFDVAILKEYLDISVSPVWCTKIASKLVRTYTDRHGLKDI 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL+G+++SK QQSSDW+A+ L+D QL YAASDV+HLH L+ +    L+R  R+++A  
Sbjct: 122 CRELIGVDLSKQQQSSDWAAEKLTDAQLAYAASDVLHLHKLKERLEFMLEREERTEIAQK 181

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA+LDL GW   DIF+HS
Sbjct: 182 CFDFLPTRAQLDLAGWPETDIFAHS 206


>gi|323136907|ref|ZP_08071987.1| 3'-5' exonuclease [Methylocystis sp. ATCC 49242]
 gi|322397668|gb|EFY00190.1| 3'-5' exonuclease [Methylocystis sp. ATCC 49242]
          Length = 204

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 148/204 (72%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR+H+GD+PA  A   +  +A+DTETLGL  RRDRLC+VQLS GDG  ++++IA GQ  
Sbjct: 2   TIRLHQGDLPAGVAVAPI--VAIDTETLGLNHRRDRLCVVQLSIGDGDAELVQIAKGQTQ 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           A NLV +LVD K  K+FH+ RFD+ +L  TFGV   PV+CTKIAS+LTRTYT++HGLKD 
Sbjct: 60  AENLVKLLVDPKVLKLFHFARFDMGILAKTFGVMPAPVYCTKIASKLTRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL G+ ISK QQSSDW A  L+D Q  YAASDV++LH L+ +    L R GR++LA +
Sbjct: 120 ARELAGVEISKQQQSSDWGAATLTDAQQAYAASDVLYLHQLKEKLDAMLAREGRTELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C +FL  R  LDL GW   DIFSH
Sbjct: 180 CFDFLPTRTRLDLAGWPESDIFSH 203


>gi|319898371|ref|YP_004158464.1| Ribonuclease D [Bartonella clarridgeiae 73]
 gi|319402335|emb|CBI75874.1| Ribonuclease D [Bartonella clarridgeiae 73]
          Length = 193

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           V++IA+DTETLGL P RDRLC+VQLS GDGT DII++A GQ  APNLV +L D+   KIF
Sbjct: 6   VNSIAIDTETLGLKPHRDRLCVVQLSSGDGTADIIQVAKGQNRAPNLVALLEDKAITKIF 65

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H+GRFD+A+L +TFGV    VFCTKIAS+LTRTYT++HGLK+   ELL INISK QQSSD
Sbjct: 66  HFGRFDLAILAHTFGVIPDVVFCTKIASKLTRTYTDRHGLKEICSELLNINISKQQQSSD 125

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWE 199
           W+AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A +C  FL  RA+LDLLGW 
Sbjct: 126 WAADALSRAQIEYAASDVLYLHRLKNIFEERLKREEREDIAKACFQFLPVRAKLDLLGWS 185

Query: 200 NVDIFSH 206
            VDIF+H
Sbjct: 186 EVDIFAH 192


>gi|188581677|ref|YP_001925122.1| 3'-5' exonuclease [Methylobacterium populi BJ001]
 gi|179345175|gb|ACB80587.1| 3'-5' exonuclease [Methylobacterium populi BJ001]
          Length = 209

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 150/206 (72%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A     AIA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHRGDLPLDFAPGA--AIAIDTETLGLNPHRDRLCVVQISRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D +  KIFH+ RFD+AVLF  FGV   PV+CTK+AS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADPQIVKIFHFARFDLAVLFKAFGVMPMPVYCTKVASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A+ LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAEALSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRAKLDLAGWPEMDIFAHT 209


>gi|163851920|ref|YP_001639963.1| 3'-5' exonuclease [Methylobacterium extorquens PA1]
 gi|163663525|gb|ABY30892.1| 3'-5' exonuclease [Methylobacterium extorquens PA1]
          Length = 209

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 149/206 (72%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A     AIA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHHGDLPPDFAPGA--AIAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L+ +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLMAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAGTLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|170743378|ref|YP_001772033.1| 3'-5' exonuclease [Methylobacterium sp. 4-46]
 gi|168197652|gb|ACA19599.1| 3'-5' exonuclease [Methylobacterium sp. 4-46]
          Length = 204

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 117/203 (57%), Positives = 146/203 (71%), Gaps = 2/203 (0%)

Query: 5   RVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           R+H GD+P + A     AIAVDTETLGL P RDRLC+VQ+S GDG  D+++IA G     
Sbjct: 4   RLHRGDLPDDYAPG--PAIAVDTETLGLEPHRDRLCVVQISRGDGEADLVQIAKGGPEPV 61

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +L D    KIFH+ RFD+AVLF+  GV   P++CTK+ASRL+RTYT++HGLKD ++
Sbjct: 62  VLKRVLTDPAVTKIFHFARFDLAVLFHRLGVMPGPIYCTKVASRLSRTYTDRHGLKDLVR 121

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           ELLGI ISK QQSSDW A+ LS  Q++YAASDV+HLHALR +    L R  R+ LA +C 
Sbjct: 122 ELLGIEISKQQQSSDWGAETLSPAQIEYAASDVLHLHALRAKLDAMLAREERTALAEACF 181

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
            FL  RA LDLLGW+ VDI +HS
Sbjct: 182 AFLPTRARLDLLGWDEVDILAHS 204


>gi|254561638|ref|YP_003068733.1| 3'-5' exonuclease [Methylobacterium extorquens DM4]
 gi|254268916|emb|CAX24877.1| 3'-5' exonuclease [Methylobacterium extorquens DM4]
          Length = 209

 Score =  234 bits (596), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 148/206 (71%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A     AIA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHHGDLPPDFAPGA--AIAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAGTLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|126732863|ref|ZP_01748654.1| 3'-5' exonuclease [Sagittula stellata E-37]
 gi|126706639|gb|EBA05713.1| 3'-5' exonuclease [Sagittula stellata E-37]
          Length = 204

 Score =  234 bits (596), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 146/203 (71%), Gaps = 2/203 (0%)

Query: 5   RVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           ++H+GD+P       V  +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ  AP
Sbjct: 4   QLHQGDLPDNLDLGPV--VAIDCETMGLHPHRDRLCVVQLSAGDGNAHLVQVARGQTEAP 61

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
           NL  +L D    K+FHYGRFDIA ++  FG    PV+CTKIASRL RTYT++HGLK+  +
Sbjct: 62  NLSRLLTDPDVLKLFHYGRFDIAAMYNAFGALAAPVYCTKIASRLVRTYTDRHGLKNLTQ 121

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           ELLG++ISK QQSSDW A+ L+D Q  YAASDV+HLH LR      L+R GR+++A +C 
Sbjct: 122 ELLGVDISKQQQSSDWGAETLTDAQKDYAASDVLHLHRLRTALNAMLEREGRTEIAQACF 181

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
           +FL  RA+LDL GW + DIF+H+
Sbjct: 182 DFLPARAKLDLAGWPDTDIFAHA 204


>gi|240139043|ref|YP_002963518.1| 3'-5' exonuclease [Methylobacterium extorquens AM1]
 gi|240009015|gb|ACS40241.1| 3'-5' exonuclease [Methylobacterium extorquens AM1]
          Length = 209

 Score =  234 bits (596), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 148/206 (71%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A     AIA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHHGDLPPDFAPGA--AIAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAGTLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|300021932|ref|YP_003754543.1| 3'-5' exonuclease [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523753|gb|ADJ22222.1| 3'-5' exonuclease [Hyphomicrobium denitrificans ATCC 51888]
          Length = 205

 Score =  234 bits (596), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 114/205 (55%), Positives = 148/205 (72%), Gaps = 3/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           T I++H+GD+P      + + IA+DTET+GL P RDRLC+VQLS GDGT  +++      
Sbjct: 4   TKIKLHKGDLP--TGLTFPNGIAIDTETMGLNPHRDRLCLVQLSGGDGTAHLVKFDGKSY 61

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D K  KIFH+ RFD+AVL +  GV   P++CTKIAS+L RTYT++HGLKD
Sbjct: 62  DAPNLKALLADPKSLKIFHFARFDVAVLEHYLGVVTSPIYCTKIASKLARTYTDRHGLKD 121

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            + E+LGI ISK QQSSDW A +LSD Q  YAA+DV+HLHAL+ +  E L R GR DLA 
Sbjct: 122 LVGEILGIEISKQQQSSDWGAAELSDSQRSYAANDVLHLHALKTRLDEMLARTGRQDLAK 181

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +   FL  RA+LDLLG+E+ DIF+H
Sbjct: 182 AAFGFLPIRAKLDLLGFED-DIFAH 205


>gi|21328703|gb|AAM48709.1| 3'- 5' exonuclease family protein [uncultured marine
           proteobacterium]
          Length = 204

 Score =  234 bits (596), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 149/205 (72%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T  V++GD+P       +  +A+D ET+GL P+RDRLC+VQLS GDG   ++++A GQ  
Sbjct: 2   TNHVYKGDLPDGLELGPI--VAIDCETMGLNPKRDRLCVVQLSSGDGHAHLVQVAKGQTA 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D    K+FH+GRFDIA +   FG    PV+CTKIASR+TRTYT++HGLK+ 
Sbjct: 60  APNLCRMLEDPNVLKLFHFGRFDIAAMKEAFGALTAPVYCTKIASRMTRTYTDRHGLKNL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L+ELL ++ISK QQSSDW A DL+  Q++YAASDV++LHALR +  E L R GR +LA S
Sbjct: 120 LQELLCVDISKQQQSSDWGAADLTKAQVEYAASDVLYLHALRERLNEMLIREGRMELAQS 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RAELDL GW + DIF+HS
Sbjct: 180 CFDFLPTRAELDLAGWPDSDIFAHS 204


>gi|84500657|ref|ZP_00998906.1| exonuclease, putative [Oceanicola batsensis HTCC2597]
 gi|84391610|gb|EAQ03942.1| exonuclease, putative [Oceanicola batsensis HTCC2597]
          Length = 204

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 107/185 (57%), Positives = 141/185 (76%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQ+S GDG   I+++A GQ +APNL  ML D K  K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVVQMSGGDGDAHIVQVAIGQDSAPNLCAMLTDPKVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA ++  FG    PV+CTKIASRL RTYT++HGLK+  +ELLGI++SK QQSSDW A
Sbjct: 80  RFDIAAMYNAFGALAAPVYCTKIASRLVRTYTDRHGLKNLTQELLGIDLSKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           ++LS  QL+YAASDV++LH LR +   +L R GR+++A +C +FL  RA LDL+GW   D
Sbjct: 140 EELSAAQLEYAASDVLYLHRLREELDARLAREGRTEIAQACFDFLPVRARLDLMGWPETD 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|170751505|ref|YP_001757765.1| 3'-5' exonuclease [Methylobacterium radiotolerans JCM 2831]
 gi|170658027|gb|ACB27082.1| 3'-5' exonuclease [Methylobacterium radiotolerans JCM 2831]
          Length = 207

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/205 (55%), Positives = 144/205 (70%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+R+H GD+PA   A    A+A+DTETLGL P RDRLC+VQLS GDGT D+++I      
Sbjct: 5   TVRLHRGDLPASYDAGR--AVAIDTETLGLNPHRDRLCVVQLSTGDGTADVVQIPQAGPE 62

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
              L  +L D    KIFH+ RFD+AVL+   GV   PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 63  PVVLKRVLADPGILKIFHFARFDVAVLYRALGVMPSPVYCTKIASKLARTYTDRHGLKDV 122

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++EL+G+++SK QQSSDW A+ LS  QL YAASDV+HLHA R +    L R GR+DLA +
Sbjct: 123 VRELVGVDLSKQQQSSDWGAETLSQAQLDYAASDVLHLHAARERLDAMLAREGRTDLAAA 182

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW   DIF+H+
Sbjct: 183 CFGFLPTRARLDLDGWPETDIFAHT 207


>gi|119385336|ref|YP_916392.1| 3'-5' exonuclease [Paracoccus denitrificans PD1222]
 gi|119375103|gb|ABL70696.1| 3'-5' exonuclease [Paracoccus denitrificans PD1222]
          Length = 204

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 117/206 (56%), Positives = 152/206 (73%), Gaps = 5/206 (2%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI ++  D+P +     V  +A+DTET+GL PRRDRLC+VQLS GDG   +++IA GQ+ 
Sbjct: 2   TITLYRNDLPDDLDLGPV--VAIDTETMGLDPRRDRLCLVQLSSGDGNAHLVQIAKGQRE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D K  K+FH+GRFDIA L   FGV  +PV+CTKIAS++ RTYT++HGLK  
Sbjct: 60  APNLARMLADPKVLKLFHFGRFDIAALEAAFGVVTKPVWCTKIASKMVRTYTDRHGLKYL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L EL+G++ISK QQ+SDW A +LS+ QL+YAASDV++LHAL+ +  ++L R GR  LA +
Sbjct: 120 LSELVGVDISKQQQTSDWGAAELSEAQLEYAASDVLYLHALKAELEKRLAREGRLGLAQA 179

Query: 183 CCNFLMDRAELDLLGW--ENVDIFSH 206
           C +FL  RA LDLLGW  EN DIF H
Sbjct: 180 CFDFLPARAHLDLLGWGDEN-DIFHH 204


>gi|23009303|ref|ZP_00050402.1| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 209

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 146/206 (70%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P +   +   AIA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHRGDLPPDF--QPGSAIAIDTETLGLNPHRDRLCVVQISRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF   GV   PV+CTK+AS+L RTYT++HGLKD
Sbjct: 64  EPVRLKAILADPGVLKIFHFARFDLAVLFRALGVMPAPVYCTKVASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A+ LS  Q+ YAASDV+HLHA R +    L R GRS++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAETLSQAQIDYAASDVLHLHAARERLDLMLAREGRSEMAR 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL GW   DIF+HS
Sbjct: 184 ACFDFLPTRARLDLAGWPETDIFAHS 209


>gi|254466427|ref|ZP_05079838.1| 3'-5' exonuclease [Rhodobacterales bacterium Y4I]
 gi|206687335|gb|EDZ47817.1| 3'-5' exonuclease [Rhodobacterales bacterium Y4I]
          Length = 204

 Score =  231 bits (588), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 105/185 (56%), Positives = 139/185 (75%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ  APNL  ML D    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVIQMSGGDGNAHIVQVEKGQTEAPNLCRMLEDPNVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +++ FG    PV+CTKIASRL RTYT++HGLK+  +ELLGI+ISK QQ SDW A
Sbjct: 80  RFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLKNLTQELLGIDISKQQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           ++L++ QL YAASDV+HLH LR    ++L R GRS++A +C +FL  RA+LDL GW  +D
Sbjct: 140 EELTEAQLDYAASDVLHLHKLREALDKRLAREGRSEMAQACFDFLPMRAKLDLAGWPEID 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|197103637|ref|YP_002129014.1| ribonuclease D [Phenylobacterium zucineum HLK1]
 gi|196477057|gb|ACG76585.1| ribonuclease D [Phenylobacterium zucineum HLK1]
          Length = 205

 Score =  231 bits (588), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 115/207 (55%), Positives = 150/207 (72%), Gaps = 2/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MTT  VHEGD+PA+  A    ++A+D+ET+GL   RD LC+VQLS G G   ++++    
Sbjct: 1   MTTF-VHEGDLPADVLAS-ASSVAIDSETMGLRLGRDPLCVVQLSDGGGDAHLVKLDRTT 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L D    KIFH+GRFDIA+ +   GV   PV+CTKIAS++ RTYT++HGLK
Sbjct: 59  YDAPNLKRLLTDPAVTKIFHFGRFDIAMFWLHLGVLTAPVYCTKIASKIARTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  KELLG+++SKAQQSSDW A  LSDEQ+ YAASDV+HLHAL+ +  + L R GR  LA
Sbjct: 119 DISKELLGVDMSKAQQSSDWGAGKLSDEQVAYAASDVLHLHALKDRLQQMLVREGRDSLA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LD+ GWE+VDIF+HS
Sbjct: 179 QACFDFLPHRAVLDVAGWEDVDIFAHS 205


>gi|126738420|ref|ZP_01754125.1| exonuclease, putative [Roseobacter sp. SK209-2-6]
 gi|126720219|gb|EBA16925.1| exonuclease, putative [Roseobacter sp. SK209-2-6]
          Length = 204

 Score =  230 bits (587), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 109/202 (53%), Positives = 147/202 (72%), Gaps = 2/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +++ D+P +     V  +A+D ET+GL P RDRLC++Q+S GDG   II++A GQ  APN
Sbjct: 5   LYQNDLPDDLKLGPV--VAIDCETMGLNPHRDRLCVIQMSDGDGNAHIIQVAKGQSEAPN 62

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L D +  K+FH+GRFDIA ++  FG    PV+CTKIASRL RTYT++HGLK+  +E
Sbjct: 63  LCRLLEDPETLKLFHFGRFDIAAMYNAFGALSAPVYCTKIASRLVRTYTDRHGLKNLTQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LLGI+ISK QQ SDW A+ L+D QL YAASDV+HLH LR    ++L+R GR+++A +C +
Sbjct: 123 LLGIDISKQQQMSDWGAEILTDAQLDYAASDVLHLHKLRKALNKRLEREGRTEMAQACFD 182

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           FL  RA+LDL GW   DIF+HS
Sbjct: 183 FLPMRAKLDLAGWPETDIFAHS 204


>gi|254476761|ref|ZP_05090147.1| 3'-5' exonuclease [Ruegeria sp. R11]
 gi|214031004|gb|EEB71839.1| 3'-5' exonuclease [Ruegeria sp. R11]
          Length = 204

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/185 (56%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   I+++A GQ  APNL  ML D    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVIQMSGGDGNAHIVQVAKGQTEAPNLCRMLEDPNVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +++ FG    PV+CTKIASRL RTYT++HGLK+  +EL+G++ISK QQ SDW A
Sbjct: 80  RFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLKNLTQELIGVDISKQQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             LSD QL YAASDV+HLH LR    ++L R GR+++A +C +FL  RA+LDL GW   D
Sbjct: 140 AQLSDAQLDYAASDVLHLHRLRAALDKRLDREGRTEMAQACFDFLPMRAKLDLAGWPETD 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|163738084|ref|ZP_02145500.1| exonuclease, putative [Phaeobacter gallaeciensis BS107]
 gi|161388700|gb|EDQ13053.1| exonuclease, putative [Phaeobacter gallaeciensis BS107]
          Length = 204

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ  APNL  ML D    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVVQLSGGDGNAHMVQIAKGQSEAPNLCAMLEDPNVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +++ FG    PV+CTKIASRL RTYT++HGL++  +EL+G++ISK QQ SDW A
Sbjct: 80  RFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLRNLTQELIGVDISKQQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             LSD QL YAASDV+HLH LR    ++L R  RS++A +C +FL  RA+LDL GW + D
Sbjct: 140 AQLSDAQLDYAASDVLHLHRLRAALDKRLDREDRSEMAQACFDFLPMRAKLDLAGWSDTD 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|294675670|ref|YP_003576285.1| ribonuclease D [Rhodobacter capsulatus SB 1003]
 gi|294474490|gb|ADE83878.1| ribonuclease D-1 [Rhodobacter capsulatus SB 1003]
          Length = 204

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/205 (53%), Positives = 147/205 (71%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI +H+ D+P       V  +A+DTET+GL PRRDRLC+VQ+S GDG   +++IA GQ  
Sbjct: 2   TIHLHQNDLPEGLDLGPV--VAIDTETMGLDPRRDRLCLVQMSSGDGHAHLVQIAKGQTE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           AP L  ML D K EK+FH+ RFDIA L+  FGV   PVFCTKIAS++ RT+T++HGLK  
Sbjct: 60  APRLCAMLADPKVEKLFHFARFDIAALYNAFGVVTAPVFCTKIASKMVRTFTDRHGLKYL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L++L+G+++SK QQ+SDW A +L+  QL YAASDV++LH L+     +L R GR++LA +
Sbjct: 120 LQDLVGVDVSKQQQTSDWGAAELTAAQLDYAASDVLYLHQLKAALVTRLAREGRTELAQA 179

Query: 183 CCNFLMDRAELDLLGWENV-DIFSH 206
           C +FL  RA LDL+GWE   DIF H
Sbjct: 180 CFDFLPARARLDLMGWEEPNDIFHH 204


>gi|163742520|ref|ZP_02149906.1| exonuclease, putative [Phaeobacter gallaeciensis 2.10]
 gi|161384105|gb|EDQ08488.1| exonuclease, putative [Phaeobacter gallaeciensis 2.10]
          Length = 226

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ  APNL  ML D    K+FH+G
Sbjct: 42  VAIDCETMGLNPHRDRLCVVQLSGGDGNAHMVQIAKGQSEAPNLCAMLEDLNVLKLFHFG 101

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +++ FG    PV+CTKIASRL RTYT++HGL++  +EL+G++ISK QQ SDW A
Sbjct: 102 RFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLRNLTQELIGVDISKQQQMSDWGA 161

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             LSD QL YAASDV+HLH LR    ++L R  RS++A +C +FL  RA+LDL GW + D
Sbjct: 162 AQLSDAQLDYAASDVLHLHRLRAALDKRLDREDRSEMAQACFDFLPMRAKLDLAGWSDTD 221

Query: 203 IFSHS 207
           IF+HS
Sbjct: 222 IFAHS 226


>gi|159046129|ref|YP_001534923.1| 3'-5' exonuclease [Dinoroseobacter shibae DFL 12]
 gi|157913889|gb|ABV95322.1| 3'-5' exonuclease [Dinoroseobacter shibae DFL 12]
          Length = 203

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 141/204 (69%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T  +H  D+P       V  +A+DTET+GL+P RDRLC+VQLS GDG   +++IA GQ  
Sbjct: 2   TNHLHSHDLPDGLDLGPV--VAIDTETMGLVPARDRLCVVQLSSGDGDAHMVQIAQGQTE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D K  K+FHY RFD+A L   FGVR  P++CTKIAS+L RTYT++HGLK  
Sbjct: 60  APNLTRMLTDPKVLKLFHYARFDVAALENAFGVRTAPIYCTKIASKLVRTYTDRHGLKAL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L E+LG+++SKAQQSSDW A  LS  QL YAASDV++LH L+      L R GR++LA +
Sbjct: 120 LSEVLGVDVSKAQQSSDWGAPTLSAAQLDYAASDVLYLHRLKEALDGMLAREGRTELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  RA LDL GW  +DIF H
Sbjct: 180 CFEFLPTRARLDLGGWSEIDIFHH 203


>gi|99079868|ref|YP_612022.1| 3'-5' exonuclease [Ruegeria sp. TM1040]
 gi|99036148|gb|ABF62760.1| 3'-5' exonuclease [Ruegeria sp. TM1040]
          Length = 204

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/185 (57%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQ+S GDG   +++IA GQ +APNL  ML +    K+FHYG
Sbjct: 20  VAIDCETMGLNPHRDRLCVVQMSSGDGDAHLVQIAKGQTDAPNLTAMLTNPDVLKLFHYG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA L++ FG    PV+CTKIASRL RTYT++HGLK+  ++LLG +ISK QQ SDW A
Sbjct: 80  RFDIAALYHRFGALAAPVYCTKIASRLVRTYTDRHGLKNLTQDLLGQDISKQQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + L+  Q+ YAASDV+HLH LR    ++L R GRSDLA +C +FL  RA LDL GW + D
Sbjct: 140 ETLTRAQMDYAASDVLHLHRLRDALDQRLVREGRSDLAQACFDFLPTRARLDLAGWPDTD 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|110677766|ref|YP_680773.1| 3'- 5' exonuclease family protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453882|gb|ABG30087.1| 3'- 5' exonuclease family protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 248

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/185 (57%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQLS GDG   +I+IA GQ  APNL  +L D K  K+FH+G
Sbjct: 64  VAIDCETMGLHPHRDRLCVVQLSGGDGKAHLIQIAKGQTEAPNLCKLLEDPKVLKLFHFG 123

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FG    PV+CTKIASRL RTYT++HGL   L+ELL I+ISK QQSSDW A
Sbjct: 124 RFDIAAMLNAFGATAAPVYCTKIASRLVRTYTDRHGLAKLLQELLAIDISKQQQSSDWGA 183

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + L+D Q++YAASDV++LH LR    + L+R GR + A +C +FL  RA+LDL+GW + D
Sbjct: 184 ETLTDAQIEYAASDVLYLHQLREALNKMLEREGRMETAQACFDFLPMRAKLDLMGWPDTD 243

Query: 203 IFSHS 207
           IF+HS
Sbjct: 244 IFAHS 248


>gi|56695010|ref|YP_165357.1| exonuclease, putative [Ruegeria pomeroyi DSS-3]
 gi|56676747|gb|AAV93413.1| exonuclease, putative [Ruegeria pomeroyi DSS-3]
          Length = 204

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ  APNL  ML + +  K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVIQMSGGDGNTHIVQVEKGQTAAPNLCAMLENPEVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA L++ FG    PV+CTKIASRL RTYT++HGLK+  +ELLG++ISK QQ SDW A
Sbjct: 80  RFDIAALYHAFGALTAPVYCTKIASRLVRTYTDRHGLKNLCQELLGVDISKQQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + LS+ QL YAASDV++LH LR     +L R GR+DLA SC +FL  RA LDL+GW   D
Sbjct: 140 ETLSEAQLDYAASDVLYLHRLREALDGRLAREGRADLAQSCFDFLPTRARLDLVGWPETD 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|73667429|ref|YP_303445.1| 3'-5' exonuclease [Ehrlichia canis str. Jake]
 gi|72394570|gb|AAZ68847.1| 3'-5' exonuclease [Ehrlichia canis str. Jake]
          Length = 216

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 110/204 (53%), Positives = 145/204 (71%), Gaps = 3/204 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           + VH+ D+P      + DA+A+DTET+GL+ RRDRLC+VQL+   G V +++ + G   A
Sbjct: 15  VFVHDCDLPN--GLNFEDAVAIDTETMGLVCRRDRLCLVQLADSSGNVHLVKFS-GNYQA 71

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNLV +L D    KIFH+ RFDIAV+ Y  G+   P +CTKIAS+L RTYT+ HGLK+  
Sbjct: 72  PNLVSVLSDPNIIKIFHFARFDIAVMRYYLGMWANPCYCTKIASKLVRTYTDHHGLKELC 131

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELLG+ ++K QQSSDW  + L+ EQL YAASDV++LHAL+ +    LQR  + +LA +C
Sbjct: 132 YELLGVKLNKMQQSSDWGRESLTSEQLNYAASDVIYLHALKSKLDAMLQRENKRELAAAC 191

Query: 184 CNFLMDRAELDLLGWENVDIFSHS 207
             FL  RA+LDLLGWENVDIFSHS
Sbjct: 192 FKFLQTRAQLDLLGWENVDIFSHS 215


>gi|218530671|ref|YP_002421487.1| 3'-5' exonuclease [Methylobacterium chloromethanicum CM4]
 gi|218522974|gb|ACK83559.1| 3'-5' exonuclease [Methylobacterium chloromethanicum CM4]
          Length = 209

 Score =  228 bits (580), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 109/206 (52%), Positives = 146/206 (70%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H  D+P + A     AIA+DTETLGL P RDRLC+VQ+S GDG+ D+++I     
Sbjct: 6   SRIRLHHCDLPPDFAPGA--AIAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPSDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAATLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|220925751|ref|YP_002501053.1| 3'-5' exonuclease [Methylobacterium nodulans ORS 2060]
 gi|219950358|gb|ACL60750.1| 3'-5' exonuclease [Methylobacterium nodulans ORS 2060]
          Length = 204

 Score =  227 bits (579), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 144/205 (70%), Gaps = 6/205 (2%)

Query: 5   RVHEGDIPAECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           R+H GD+P +    YV   AIAVDTETLGL P RDRLC+VQ+S GDG  D+++I      
Sbjct: 4   RLHCGDLPDD----YVPGPAIAVDTETLGLEPHRDRLCVVQISHGDGEADVVQIPKIGPE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
              L  +L D    KIFHY RFD+AVL++  GV   PV+CTK+ASRL RTYT++HGLKD 
Sbjct: 60  PVVLKRVLTDPAVTKIFHYARFDLAVLYHRLGVMPGPVYCTKVASRLARTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELLG+ +SK QQSSDW AD L+  Q+ YAASDV+HLHALR +    L R  R+D+A +
Sbjct: 120 VRELLGVELSKQQQSSDWGADTLTPAQIDYAASDVLHLHALRAKLDAMLAREERTDMAEA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDLLGW+ VDI +HS
Sbjct: 180 CFAFLPTRARLDLLGWDEVDILAHS 204


>gi|86136835|ref|ZP_01055413.1| exonuclease, putative [Roseobacter sp. MED193]
 gi|85826159|gb|EAQ46356.1| exonuclease, putative [Roseobacter sp. MED193]
          Length = 204

 Score =  227 bits (579), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 146/202 (72%), Gaps = 2/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +++ D+P +     V  +A+D ET+GL P RDRLC++QLS GDG   I+++A GQ  APN
Sbjct: 5   LYQNDLPDDLKLGPV--VAIDCETMGLNPHRDRLCVIQLSDGDGNAHIVQVAKGQTEAPN 62

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  ML D +  K+FH+GRFDIA +++ FG    PV+CTKIASRL RTYT++HGLK+  +E
Sbjct: 63  LCAMLEDPETLKLFHFGRFDIAAMYHAFGALTAPVYCTKIASRLVRTYTDRHGLKNLTQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           L+G++ISK QQ SDW A  L++ QL YAASDV++LH LR    ++L+R GR ++A +C +
Sbjct: 123 LIGVDISKQQQMSDWGAKVLTEAQLDYAASDVLYLHRLREALNKRLEREGRMEMAQACFD 182

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           FL  RA+LDL GW   DIF+HS
Sbjct: 183 FLPMRAKLDLAGWPETDIFAHS 204


>gi|89052719|ref|YP_508170.1| 3'-5' exonuclease [Jannaschia sp. CCS1]
 gi|88862268|gb|ABD53145.1| 3'-5' exonuclease [Jannaschia sp. CCS1]
          Length = 203

 Score =  227 bits (578), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 103/184 (55%), Positives = 139/184 (75%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++QLS GDG   ++++A GQ  APNL  +L D    K+FH+G
Sbjct: 20  VAIDCETMGLHPHRDRLCVIQLSDGDGNAHLVQVAKGQTAAPNLCALLEDPNTLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +++ FG    PV+CTKIAS+L RTYT++HGLK+ L+ELLGI+ISK QQSSDW A
Sbjct: 80  RFDIAAMYHAFGALTAPVYCTKIASKLVRTYTDRHGLKNLLQELLGIDISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           D L++ Q+ YAASDV++LH ++ +    L R GR++LA +C +FL  RA+LDL GW  +D
Sbjct: 140 DSLTEAQVDYAASDVLYLHGVKDKLDVMLAREGRTELAQACFDFLPMRAKLDLAGWPEMD 199

Query: 203 IFSH 206
           IFSH
Sbjct: 200 IFSH 203


>gi|332187924|ref|ZP_08389657.1| 3'-5' exonuclease family protein [Sphingomonas sp. S17]
 gi|332012085|gb|EGI54157.1| 3'-5' exonuclease family protein [Sphingomonas sp. S17]
          Length = 206

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 150/206 (72%), Gaps = 2/206 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA-GQK 61
           T+ +HE DIPA+  A    AIAVDTET+GL+  RDRLC+VQLS G     ++R +     
Sbjct: 2   TVHLHEEDIPADLFAPGA-AIAVDTETMGLITPRDRLCVVQLSDGGPDEHLVRFSPDSDY 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  R K++H+GRFDIA + +  GV   PV+CTKIASRL RTYT++HGLK+
Sbjct: 61  AAPNLRALLADPARLKLYHFGRFDIAAIRHYLGVVAAPVYCTKIASRLIRTYTDRHGLKE 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLGI +SKAQQSSDW A +LSD Q +YAASDV +LH ++++  ++L+R GR +LA 
Sbjct: 121 LVRELLGIELSKAQQSSDWGAPELSDAQREYAASDVRYLHRMKVELDKRLEREGRMELAQ 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RAELDL GW  +DIF+H+
Sbjct: 181 ACFDFLPARAELDLAGWPEIDIFAHA 206


>gi|315497170|ref|YP_004085974.1| 3'-5' exonuclease [Asticcacaulis excentricus CB 48]
 gi|315415182|gb|ADU11823.1| 3'-5' exonuclease [Asticcacaulis excentricus CB 48]
          Length = 206

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 142/205 (69%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI  HEGD+P       V  +A+D+ET+GL   RD LC+VQLS GDG   ++R+     +
Sbjct: 2   TIHYHEGDLPNGLNLGAV--VAIDSETMGLRFGRDDLCVVQLSAGDGDAHVVRLNRPAYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  +L DEK  K+FH+GRFDI +     GV   PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  CPNLKALLTDEKVLKLFHFGRFDIGMFLLHLGVVTAPVYCTKIASKLARTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++ELL ++ISKAQQSSDW A  L+ EQL YAASDV+HLH LR +    L R GR++LA  
Sbjct: 120 VRELLSVDISKAQQSSDWGAQTLTPEQLAYAASDVLHLHTLREKLDTMLAREGRTELAQG 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  R +LDL GWE+ DIF+HS
Sbjct: 180 CFDFLPHRVKLDLAGWEDTDIFAHS 204


>gi|89067364|ref|ZP_01154877.1| exonuclease, putative [Oceanicola granulosus HTCC2516]
 gi|89046933|gb|EAR52987.1| exonuclease, putative [Oceanicola granulosus HTCC2516]
          Length = 203

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 138/184 (75%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQ+S GDG   ++++A GQ +APNLV ML +    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVVQMSGGDGHAHLVQVAKGQTSAPNLVAMLENPDVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA L   FG R  PV+CTKIAS+L RT+T++HGLK  L++L+G+++SK QQ SDW A
Sbjct: 80  RFDIAALMNAFGARTAPVYCTKIASKLVRTFTDRHGLKVLLQDLVGVDVSKHQQQSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + LSD QL YAASDV+HLH LR +  E L R GR+ +A +C +FL  RA+LDL GW + D
Sbjct: 140 ETLSDAQLDYAASDVLHLHRLREKLDEMLAREGRTMIAQACFDFLPTRAQLDLAGWPDQD 199

Query: 203 IFSH 206
           IFSH
Sbjct: 200 IFSH 203


>gi|126463573|ref|YP_001044687.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17029]
 gi|126105237|gb|ABN77915.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17029]
          Length = 204

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 147/205 (71%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI +H  D+P   A   V  +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ +
Sbjct: 2   TIHLHRNDLPDGLALGPV--VAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQTS 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK  
Sbjct: 60  APNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKYL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA  
Sbjct: 120 LLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQR 179

Query: 183 CCNFLMDRAELDLLGW-ENVDIFSH 206
           C +FL  RAELDL+GW E  DIF H
Sbjct: 180 CFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|254510165|ref|ZP_05122232.1| 3'-5' exonuclease [Rhodobacteraceae bacterium KLH11]
 gi|221533876|gb|EEE36864.1| 3'-5' exonuclease [Rhodobacteraceae bacterium KLH11]
          Length = 204

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/185 (55%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ +APNL  ML D    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVIQMSGGDGDCHIVQVEKGQASAPNLCAMLEDPNILKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +++ FG    PV+CTKIASRL RTYT++HGLK+  +ELLG++ISK QQ SDW A
Sbjct: 80  RFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLKNLCQELLGVDISKQQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + L+D QL YAASDV++LH LR     +L R GR+++A +C +FL  RA+LDL GW   D
Sbjct: 140 ETLTDAQLDYAASDVLYLHRLREALDGRLAREGRTEVAQACFDFLPTRAKLDLAGWPETD 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|163733026|ref|ZP_02140470.1| 3'- 5' exonuclease family protein, putative [Roseobacter litoralis
           Och 149]
 gi|161393561|gb|EDQ17886.1| 3'- 5' exonuclease family protein, putative [Roseobacter litoralis
           Och 149]
          Length = 204

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 141/205 (68%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T +V++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +I+IA GQ  
Sbjct: 2   THKVYKNDLPD--GLDLGPMVAIDCETMGLHPHRDRLCVVQLSGGDGKAHLIQIAKGQTE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    K+FH+GRFDIA +   FG    PV+CTKIASRL RTYT++HGL   
Sbjct: 60  APNLCKLLEDPNVLKLFHFGRFDIAAMLNAFGATAAPVYCTKIASRLVRTYTDRHGLAKL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L+ELL I+ISK QQSSDW AD L+D Q+ YAASDV++LH LR      L R GR + A +
Sbjct: 120 LQELLNIDISKQQQSSDWGADTLTDAQIDYAASDVLYLHQLREALNTMLTREGRMETAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA+LDL+GW + DIF+HS
Sbjct: 180 CFDFLPMRAKLDLMGWPDTDIFAHS 204


>gi|312114054|ref|YP_004011650.1| 3'-5' exonuclease [Rhodomicrobium vannielii ATCC 17100]
 gi|311219183|gb|ADP70551.1| 3'-5' exonuclease [Rhodomicrobium vannielii ATCC 17100]
          Length = 204

 Score =  224 bits (572), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 145/205 (70%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI VH  D+P +    +  ++A+DTETLGL P RDRLC+VQLS GDG   +++   G  +
Sbjct: 2   TITVHLNDLPPDI--DFGASVAIDTETLGLKPHRDRLCVVQLSAGDGNAHLVQFEKGHYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +LV+    KIFH+GRFDIAV+    GV+  PV+CTKIA++L RT+T +HGLKD 
Sbjct: 60  APNLTALLVNPAVLKIFHFGRFDIAVMQQYLGVKTGPVYCTKIAAKLVRTFTERHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLG+ +SK QQ+SDW    L+ EQL YAASDV+HLHAL+ +    L R GR++LA +
Sbjct: 120 CRELLGVELSKQQQTSDWGQAKLTPEQLSYAASDVLHLHALKEKLDALLAREGRTELAAA 179

Query: 183 CCNFLMDRAELDLLGW-ENVDIFSH 206
           C  FL  RAELDL GW ++ D+F+H
Sbjct: 180 CFGFLPYRAELDLKGWHDDADVFNH 204


>gi|260431736|ref|ZP_05785707.1| 3'-5' exonuclease [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415564|gb|EEX08823.1| 3'-5' exonuclease [Silicibacter lacuscaerulensis ITI-1157]
          Length = 204

 Score =  224 bits (572), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 103/185 (55%), Positives = 137/185 (74%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ  APNL  ML + +  K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVIQMSGGDGHSHIVQVEKGQTEAPNLCAMLENPEVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA L++ FG    PV+CTKIASRL RTYT++HGLK+  +ELLGI+ISK QQ SDW A
Sbjct: 80  RFDIAALYHAFGALAAPVYCTKIASRLVRTYTDRHGLKNLCQELLGIDISKQQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + L++ QL YAASDV++LH LR     +L+R GR+++A +C +FL  RA LDL GW   D
Sbjct: 140 ETLTEAQLDYAASDVLYLHQLRAALDARLEREGRTEMAQACFDFLPMRARLDLAGWPETD 199

Query: 203 IFSHS 207
           IF+HS
Sbjct: 200 IFAHS 204


>gi|221640647|ref|YP_002526909.1| 3'-5' exonuclease [Rhodobacter sphaeroides KD131]
 gi|221161428|gb|ACM02408.1| 3'-5' exonuclease [Rhodobacter sphaeroides KD131]
          Length = 204

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 112/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI +H  D+P       V  +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ +
Sbjct: 2   TIHLHRSDLPDGLVLGPV--VAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQTS 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK  
Sbjct: 60  APNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKYL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA  
Sbjct: 120 LLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQR 179

Query: 183 CCNFLMDRAELDLLGW-ENVDIFSH 206
           C +FL  RAELDL+GW E  DIF H
Sbjct: 180 CFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|77464733|ref|YP_354237.1| ribonuclease D [Rhodobacter sphaeroides 2.4.1]
 gi|77389151|gb|ABA80336.1| Ribonuclease D [Rhodobacter sphaeroides 2.4.1]
          Length = 204

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 112/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI +H  D+P       V  +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ +
Sbjct: 2   TIHLHRNDLPDGLVLGPV--VAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQTS 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK  
Sbjct: 60  APNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKYL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA  
Sbjct: 120 LLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQR 179

Query: 183 CCNFLMDRAELDLLGW-ENVDIFSH 206
           C +FL  RAELDL+GW E  DIF H
Sbjct: 180 CFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|259417301|ref|ZP_05741220.1| 3'-5' exonuclease [Silicibacter sp. TrichCH4B]
 gi|259346207|gb|EEW58021.1| 3'-5' exonuclease [Silicibacter sp. TrichCH4B]
          Length = 204

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/202 (53%), Positives = 141/202 (69%), Gaps = 2/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +++ D+P       V  +A+D ET+GL P RDRLC+VQ+S GDG   +++I+  Q  APN
Sbjct: 5   LYQNDLPDSVDLGPV--VAIDCETMGLNPHRDRLCVVQMSGGDGDAHLVQISKDQTEAPN 62

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  ML +    K+FHYGRFDIA L++ FG    PV+CTKIASRL RTYT++HGLK+  ++
Sbjct: 63  LTSMLTNPDVLKLFHYGRFDIAALYHRFGALTAPVYCTKIASRLVRTYTDRHGLKNLTQD 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LLG +ISK QQ SDW AD L+  Q+ YAASDV+HLH LR     +L R GRSDLA +C +
Sbjct: 123 LLGQDISKQQQMSDWGADTLTRAQMDYAASDVLHLHRLRGALDLRLAREGRSDLAQACFD 182

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           FL  RA LDL GW + DIF+HS
Sbjct: 183 FLPTRARLDLAGWPDTDIFAHS 204


>gi|332559626|ref|ZP_08413948.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
 gi|332277338|gb|EGJ22653.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
          Length = 204

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/205 (54%), Positives = 146/205 (71%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI +H  D+P       V  +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ +
Sbjct: 2   TIHLHRNDLPDGLVLGPV--VAIDTETMGLDPRRDRLCVVQLSAGDGDAHLLQIERGQTS 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK  
Sbjct: 60  APNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKYL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA  
Sbjct: 120 LLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQR 179

Query: 183 CCNFLMDRAELDLLGW-ENVDIFSH 206
           C +FL  RAELDL+GW E  DIF H
Sbjct: 180 CFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|83855386|ref|ZP_00948916.1| exonuclease, putative [Sulfitobacter sp. NAS-14.1]
 gi|83941910|ref|ZP_00954372.1| exonuclease, putative [Sulfitobacter sp. EE-36]
 gi|83843229|gb|EAP82396.1| exonuclease, putative [Sulfitobacter sp. NAS-14.1]
 gi|83847730|gb|EAP85605.1| exonuclease, putative [Sulfitobacter sp. EE-36]
          Length = 204

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/205 (53%), Positives = 139/205 (67%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T  V++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ  
Sbjct: 2   TNTVYQNDLPD--GLNLGPMVAIDCETMGLHPHRDRLCVVQLSGGDGNAHLVQIAKGQTE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    K+FHYGRFDIA L  TFG +  PV+CTKIASRL RTYT++HGL   
Sbjct: 60  APNLCALLEDPHVLKLFHYGRFDIAALLNTFGAKAAPVYCTKIASRLVRTYTDRHGLAKL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL ++ISK QQSSDW A+ L+  Q+ YAASDV+HLH LR    + L R GR +LA +
Sbjct: 120 CQELLSVDISKQQQSSDWGAETLTKAQIDYAASDVLHLHKLRDVLNQMLIREGRIELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDL GW   DIF+H+
Sbjct: 180 CFEFLPTRAQLDLDGWPETDIFAHA 204


>gi|114568663|ref|YP_755343.1| 3'-5' exonuclease [Maricaulis maris MCS10]
 gi|114339125|gb|ABI64405.1| 3'-5' exonuclease [Maricaulis maris MCS10]
          Length = 204

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 144/205 (70%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+  H+GD+PA+     +  +AVDTETLGL   RD LC+VQLS GDG   ++++     +
Sbjct: 2   TVHYHKGDLPADIDLGPI--VAVDTETLGLSLTRDMLCVVQLSAGDGDAHVVQMNRADYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  +L D   EKI H+ RFD+A++    GV + PVFCTKIAS+L RTYT++HGLKD 
Sbjct: 60  CPNLKRVLADPAVEKILHFARFDVAMVDKYLGVTMAPVFCTKIASKLVRTYTDRHGLKDV 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL+G  ++K QQSSDW AD+LS  QL YAASDV+HLH LR +    L+R GR+DLA +
Sbjct: 120 TRELVGAEMNKQQQSSDWGADELSPAQLDYAASDVLHLHKLREKLGMMLEREGRTDLAKA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA+LDL GW  +DIF+HS
Sbjct: 180 CFDFLPTRAKLDLAGWPEIDIFAHS 204


>gi|146278808|ref|YP_001168967.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17025]
 gi|145557049|gb|ABP71662.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17025]
          Length = 204

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/205 (54%), Positives = 145/205 (70%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI +H  D+P       V  +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ  
Sbjct: 2   TIHLHRNDLPDGLDLGRV--VAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQTR 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK  
Sbjct: 60  APNLERLLTDPQVLKLFHFGRFDIAALQRAFGVRTEPVWCTKIASKMVRTFTDRHGLKYL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA  
Sbjct: 120 LLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKEELEARLLREGRMELAQR 179

Query: 183 CCNFLMDRAELDLLGW-ENVDIFSH 206
           C +FL  RAELDL+GW E  DIF H
Sbjct: 180 CFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|114764076|ref|ZP_01443315.1| exonuclease, putative [Pelagibaca bermudensis HTCC2601]
 gi|114543434|gb|EAU46449.1| exonuclease, putative [Roseovarius sp. HTCC2601]
          Length = 204

 Score =  223 bits (567), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 111/202 (54%), Positives = 140/202 (69%), Gaps = 2/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +++GD+P       V  +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ  APN
Sbjct: 5   LYKGDLPDGLDLGPV--VAIDCETMGLEPHRDRLCVVQLSGGDGNAHLVQVAKGQTEAPN 62

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L DE   K+FHYGRFDIA ++  FG    PV+CTKIASR+ RTYT++HGLK   +E
Sbjct: 63  LCRLLRDECVLKLFHYGRFDIAAMYNAFGALAAPVYCTKIASRMVRTYTDRHGLKTLTQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LL ++ISK QQSSDW A+ L++ Q  YAASDV+HLH LR      L R GRS LA SC +
Sbjct: 123 LLSVDISKQQQSSDWGAETLTEAQRDYAASDVLHLHKLREALDGMLAREGRSALAQSCFD 182

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           FL  RA LDL GW   DIF+HS
Sbjct: 183 FLPTRALLDLEGWPGTDIFAHS 204


>gi|296115075|ref|ZP_06833717.1| 3'-5' exonuclease [Gluconacetobacter hansenii ATCC 23769]
 gi|295978412|gb|EFG85148.1| 3'-5' exonuclease [Gluconacetobacter hansenii ATCC 23769]
          Length = 215

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 144/206 (69%), Gaps = 4/206 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI  H GD+P +    +  A+AVDTET+GL P RDRLC+VQLS GDG   ++++ AG   
Sbjct: 9   TIHFHRGDLPHDVV--FSGAVAVDTETMGLNPHRDRLCLVQLSDGDGHAHLVQVPAGATA 66

Query: 63  A--PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           A  PN++ +L D    K+ H+ RFD+A+L YTFG+ V P  CTKIAS+L RTYT +HGL 
Sbjct: 67  ADFPNMLAVLTDPSVTKLMHFARFDVAILQYTFGITVAPCICTKIASKLVRTYTERHGLA 126

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              +ELLG+ +SK QQSSDW A DL+ EQ+ YAASDV++LHAL  +    L R GR +LA
Sbjct: 127 HLCRELLGVELSKQQQSSDWGAPDLTPEQMTYAASDVLYLHALWARLEALLVREGRRELA 186

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +F+  RA LD+LG+E+ D+F+H
Sbjct: 187 QACYDFMPTRARLDILGYEDPDLFAH 212


>gi|329847152|ref|ZP_08262180.1| 3'-5' exonuclease family protein [Asticcacaulis biprosthecum C19]
 gi|328842215|gb|EGF91784.1| 3'-5' exonuclease family protein [Asticcacaulis biprosthecum C19]
          Length = 206

 Score =  222 bits (566), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 143/205 (69%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+  HEGD+PA        +IA+D+ET+GL   RD LC+VQLS GDG   ++R+     +
Sbjct: 2   TVFYHEGDLPA--GLDLGKSIALDSETMGLRFGRDDLCVVQLSAGDGHAHVVRLNRPAYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  +LVD    K+FHYGRFDI +     GV   PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  CPNLKALLVDPSVLKLFHYGRFDIGMFALHLGVDTSPVYCTKIASKLARTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL+G+++SKAQQSSDW A  L+ EQL YAASDV+HLHAL+ +    L R GRS LA +
Sbjct: 120 SRELVGVDMSKAQQSSDWGAATLTPEQLAYAASDVLHLHALKDKLDAMLAREGRSALAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  R +LDL GWE+ DIF+HS
Sbjct: 180 CFDFLPQRVKLDLAGWEDCDIFAHS 204


>gi|163794941|ref|ZP_02188910.1| hypothetical protein BAL199_08698 [alpha proteobacterium BAL199]
 gi|159179760|gb|EDP64287.1| hypothetical protein BAL199_08698 [alpha proteobacterium BAL199]
          Length = 203

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 144/204 (70%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+ +H GD+P       V  +A+D+ET+GL P RDRLC+VQ S GDGT  +++ A G+ +
Sbjct: 2   TVTLHHGDLPDGLDLGSV--VAIDSETMGLRPIRDRLCVVQFSSGDGTAHLVQFAPGEYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D    K+FH+ RFD+AVL    GV   P++CTKIAS+L RTYT++HGLKD 
Sbjct: 60  APNLTRMLTDPDVLKLFHFARFDVAVLQAFLGVATAPIYCTKIASKLVRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL+G+++SK QQSSDW A +L+ EQL YAASDV+HLHAL+ +    L R GR+ +A  
Sbjct: 120 CRELIGVDLSKQQQSSDWGAAELTAEQLAYAASDVLHLHALKDRLDIMLAREGRTGIAAD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  RA LDL+G+ + DIF+H
Sbjct: 180 CFRFLGTRAALDLIGYADEDIFAH 203


>gi|167648909|ref|YP_001686572.1| 3'-5' exonuclease [Caulobacter sp. K31]
 gi|167351339|gb|ABZ74074.1| 3'-5' exonuclease [Caulobacter sp. K31]
          Length = 205

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 140/202 (69%), Gaps = 1/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +HEGD+P    A    AIA+D+ET+GL   RD LC+VQLS GDG   ++R+     +APN
Sbjct: 5   LHEGDLPDGVFAGAA-AIAIDSETMGLRLGRDPLCVVQLSSGDGDAHVVRLDRATYDAPN 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L D    K+FH+GRFDIA+     GV   PV+CTKIAS+L RTYT++HGLKD  +E
Sbjct: 64  LKRLLTDPSVVKLFHFGRFDIAMFLLHLGVMTAPVYCTKIASKLARTYTDRHGLKDVTRE 123

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           L+G+ +SK QQSSDW A  LS EQL YAASDV+HLHALR +    L R GR  LA +  +
Sbjct: 124 LVGVELSKVQQSSDWGAATLSPEQLAYAASDVLHLHALRERLNAMLVREGRMQLAQAAFD 183

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           +L  RA LDL GWE+VDIF+H+
Sbjct: 184 YLPHRAALDLAGWEDVDIFAHT 205


>gi|288956945|ref|YP_003447286.1| ribonuclease D [Azospirillum sp. B510]
 gi|288909253|dbj|BAI70742.1| ribonuclease D [Azospirillum sp. B510]
          Length = 208

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 144/206 (69%), Gaps = 3/206 (1%)

Query: 4   IRVHEGDIPAE---CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           I +H+GD+P      A    + +A+DTET+GL P RDRLC+VQLS GDG V +++   G+
Sbjct: 3   IDLHDGDLPDGLDLAAGARDNCVAIDTETMGLNPHRDRLCLVQLSAGDGAVHLVQFRPGR 62

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D    K+FH+ RFD+AV+    GV  RPV+CTK+AS+L RT+T++HGLK
Sbjct: 63  YEAPNLKRLLTDPGVTKLFHFARFDVAVMKAYLGVDCRPVYCTKVASKLVRTFTDRHGLK 122

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  K+LLG+ ISK QQSSDW A +L+ +Q++YAASDV+HLH L+ +    L R GR+ LA
Sbjct: 123 DLCKDLLGVEISKQQQSSDWGAPELTTDQMKYAASDVLHLHDLKAKLDVMLAREGRTHLA 182

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  R ELDL GWE  DI +H
Sbjct: 183 QACFDFLPARGELDLGGWETPDILAH 208


>gi|16127833|ref|NP_422397.1| ribonuclease D [Caulobacter crescentus CB15]
 gi|221236653|ref|YP_002519090.1| ribonuclease D [Caulobacter crescentus NA1000]
 gi|13425349|gb|AAK25565.1| ribonuclease D, putative [Caulobacter crescentus CB15]
 gi|220965826|gb|ACL97182.1| ribonuclease D [Caulobacter crescentus NA1000]
          Length = 205

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 109/202 (53%), Positives = 141/202 (69%), Gaps = 1/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           VHEGD+P    A   + IA+D+ET+GL  RRD LC+VQLS GDG   ++R++    + PN
Sbjct: 5   VHEGDLPDGVFAD-AEIIAIDSETMGLRLRRDPLCVVQLSAGDGDAHVVRLSRPDYDCPN 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L + K  K+FH+GRFDIA+     GV   PV+CTKIAS+L RTYT++HGLKD  +E
Sbjct: 64  LKALLTNPKVLKLFHFGRFDIAMFELHLGVVTAPVYCTKIASKLARTYTDRHGLKDVTRE 123

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LLG+ +SK QQSSDW A  LS +Q+ YAASDV+HLH LRL+    L+R GR  LA    +
Sbjct: 124 LLGVELSKVQQSSDWGAPSLSVDQVAYAASDVLHLHGLRLKLNAMLEREGRMALAQHAFD 183

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           +L  RA LDL GWE +DIF+HS
Sbjct: 184 YLPHRASLDLAGWEEMDIFAHS 205


>gi|260428903|ref|ZP_05782880.1| 3'-5' exonuclease [Citreicella sp. SE45]
 gi|260419526|gb|EEX12779.1| 3'-5' exonuclease [Citreicella sp. SE45]
          Length = 204

 Score =  221 bits (562), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 143/202 (70%), Gaps = 2/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +++GD+P       V  +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ  APN
Sbjct: 5   LYKGDLPDGLDLGPV--VAIDCETMGLDPHRDRLCVVQLSGGDGNAHLVQVARGQTEAPN 62

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L DE   K+FH+GRFDIA +++ FG    PV+CTKIASR+ RTYT++HGLK   +E
Sbjct: 63  LCRLLRDETVLKLFHFGRFDIAAMYHAFGALAAPVYCTKIASRMVRTYTDRHGLKALTQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LL ++ISK QQSSDW A DL+  QL YAASDV++LH LR +    L+R GR+ LA +C +
Sbjct: 123 LLSVDISKQQQSSDWGAADLTAAQLDYAASDVLYLHQLRDRLNGMLEREGRTALAQACFD 182

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           FL  RA LDL GW   DIF+H+
Sbjct: 183 FLPTRALLDLEGWPETDIFAHA 204


>gi|88608093|ref|YP_506413.1| 3'-5' exonuclease family protein [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600262|gb|ABD45730.1| 3'-5' exonuclease family protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 206

 Score =  220 bits (561), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 109/206 (52%), Positives = 143/206 (69%), Gaps = 2/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    ++EGD+PA+ A    DAIA+DTE++GL+ RRDRLC+VQLS GDGT  ++R     
Sbjct: 1   MNKYYIYEGDVPADFAPS--DAIAIDTESMGLVNRRDRLCLVQLSTGDGTAHLVRFNGTD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +AP L  +LVD    KIFH+ RFDIA+L +  GV     +CTKIASRL RTYT+ H LK
Sbjct: 59  YSAPRLKSLLVDPAVIKIFHFARFDIAILRHYLGVLTENCYCTKIASRLVRTYTDHHSLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   +LLG+ ++K +QSSDW +  L+ EQ+ YAASDV++LHA++      L+R  R +LA
Sbjct: 119 ELCLDLLGVRLNKGKQSSDWGSTSLTREQMSYAASDVLYLHAIKEALDVMLKREKRIELA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RAELDLLGWEN DIFSH
Sbjct: 179 RACFQFLPYRAELDLLGWENQDIFSH 204


>gi|255262197|ref|ZP_05341539.1| 3'-5' exonuclease [Thalassiobium sp. R2A62]
 gi|255104532|gb|EET47206.1| 3'-5' exonuclease [Thalassiobium sp. R2A62]
          Length = 203

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 135/184 (73%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GD    II+++ GQ  APNL  ML +    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVIQMSGGDSNAHIIQVSKGQTEAPNLTAMLTNPDVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FG    PV+CTKIAS++ RTYT++HGLK+ L+EL+G++ISK QQSSDW +
Sbjct: 80  RFDIAAMQNAFGAVTAPVYCTKIASKMVRTYTDRHGLKNLLQELIGVDISKQQQSSDWGS 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             L++ QL YAASDV++LH LR +   +L R GR ++A +C +FL  RA+LDL GW  +D
Sbjct: 140 QTLTNAQLDYAASDVLYLHKLRTELNARLVREGRMEMAQACFDFLPMRAQLDLEGWPEID 199

Query: 203 IFSH 206
           IFSH
Sbjct: 200 IFSH 203


>gi|254419186|ref|ZP_05032910.1| 3'-5' exonuclease, putative [Brevundimonas sp. BAL3]
 gi|196185363|gb|EDX80339.1| 3'-5' exonuclease, putative [Brevundimonas sp. BAL3]
          Length = 204

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 143/205 (69%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+ +HEGD+P +        +A+D+ET+GL  RRD LC+VQLS GDG   ++R+     +
Sbjct: 2   TVYLHEGDLPDDL--DLGPDVAIDSETMGLRFRRDPLCVVQLSAGDGNAHVVRLNRPGYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  +L D    KIFH+GRFDI +     GV  RPV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  CPNLKRLLTDPAVTKIFHFGRFDIGMFLLHLGVETRPVYCTKIASKLARTYTDRHGLKDV 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E +G+++SKAQQSSDW A +L+  QL YAASDV++LHA R +    L R GR++LA  
Sbjct: 120 VRETVGVDLSKAQQSSDWGAAELTQAQLDYAASDVLYLHAARAKLDLMLAREGRAELAAQ 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  R+ LDL GW+ +DIF+HS
Sbjct: 180 CFDFLPTRSALDLAGWDEIDIFAHS 204


>gi|329888476|ref|ZP_08267074.1| 3'-5' exonuclease family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328847032|gb|EGF96594.1| 3'-5' exonuclease family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 204

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/205 (52%), Positives = 142/205 (69%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+  HEGD+P          +A+D+ET+GL  RRD LC+VQLS GDG   ++R+     +
Sbjct: 2   TVYFHEGDLPD--GLDLGPQVAIDSETMGLRFRRDPLCVVQLSSGDGNAHVVRLNRPAYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  +L D K  KIFH+GRFDI +     GV  RPV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  CPNLKRLLTDPKVLKIFHFGRFDIGMFDLHLGVETRPVYCTKIASKLARTYTDRHGLKDV 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            KEL G+++SKAQQSSDW A +LS  QL YAASDV++LHA+  +  E L R GR +LA +
Sbjct: 120 AKELAGVDMSKAQQSSDWGAAELSQAQLDYAASDVLYLHAIMNRLNEMLVREGRMELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  R+ LDL GW+ +DIF+H+
Sbjct: 180 CFDFLPVRSRLDLAGWDEIDIFAHA 204


>gi|254463169|ref|ZP_05076585.1| 3'-5' exonuclease [Rhodobacterales bacterium HTCC2083]
 gi|206679758|gb|EDZ44245.1| 3'-5' exonuclease [Rhodobacteraceae bacterium HTCC2083]
          Length = 203

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 143/204 (70%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T  +++ DIPA+     V  +A+D ET+GL P RDRLC++Q+S GDG   ++++A GQ  
Sbjct: 2   TNTLYQNDIPADLDLGPV--VAIDCETMGLHPHRDRLCVIQMSGGDGNAHLVQVAKGQTE 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D    K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGLK+ 
Sbjct: 60  APNLCKMLTDPNVLKLFHFGRFDIAAMQNAFGAVTAPVYCTKIASKLIRTYTDRHGLKNL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L+ELL I+ISK QQSSDW +  L++ QL+YAASDV++LH LR +  ++L R  R  +A +
Sbjct: 120 LQELLNIDISKQQQSSDWGSAKLTNAQLEYAASDVLYLHRLRTELNKRLIREDRMVIAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C +FL  RA LDL GW   DIFSH
Sbjct: 180 CFDFLPMRANLDLKGWPEQDIFSH 203


>gi|84684593|ref|ZP_01012494.1| exonuclease, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84667572|gb|EAQ14041.1| exonuclease, putative [Rhodobacterales bacterium HTCC2654]
          Length = 203

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/184 (55%), Positives = 135/184 (73%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQ+S GDG   ++++  GQ  APNL  ML D    KIFH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVVQMSGGDGHAHMVQVERGQTEAPNLTAMLTDPNVLKIFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA L   FGV   PV+CTKIAS+L RTYT++HGLK  L+E+L I+ISK QQ +DW A
Sbjct: 80  RFDIAALLNAFGVVTAPVYCTKIASKLIRTYTDRHGLKTLLEEILRIDISKYQQQTDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
            +L++ QL YAASDV++LH LR +   +L R GR++LA +C +FL  RA+LDL GW + D
Sbjct: 140 RELTEAQLDYAASDVLYLHRLREKLDGRLAREGRAELAQACFDFLPARAQLDLAGWPDTD 199

Query: 203 IFSH 206
           IF+H
Sbjct: 200 IFTH 203


>gi|296282123|ref|ZP_06860121.1| 3'-5' exonuclease [Citromicrobium bathyomarinum JL354]
          Length = 205

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 143/204 (70%), Gaps = 3/204 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK-N 62
           +  HE D+P    A    A+AVDTET+GL+ RRDRLC+VQ+S G G   ++R       +
Sbjct: 3   VYFHEEDLPEGVLAE--GAVAVDTETMGLITRRDRLCLVQISDGKGDEHLVRFGVDSSFD 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D  R K++H+GRFD+A + Y  GV   PVFCTKIAS+LTRTYT++HGLK  
Sbjct: 61  APNLKAVLADPARTKLYHFGRFDLAAIEYWLGVTAAPVFCTKIASKLTRTYTDRHGLKML 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           + ELLG +ISK QQSSDW A  ++D Q +YAASDV +LH LR  F E+L R GR+++A +
Sbjct: 121 VSELLGEDISKQQQSSDWGAPKINDAQREYAASDVRYLHRLRDIFEERLAREGRTEIAQA 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C +FL  RA LD++GW + DIFSH
Sbjct: 181 CFDFLPTRARLDIIGWPDTDIFSH 204


>gi|310817096|ref|YP_003965060.1| 3'-5' exonuclease [Ketogulonicigenium vulgare Y25]
 gi|308755831|gb|ADO43760.1| 3'-5' exonuclease [Ketogulonicigenium vulgare Y25]
          Length = 227

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/184 (55%), Positives = 134/184 (72%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IA+D ET+GL P RDRLC+VQ+S GDG   +I+I+ GQ++APNL  ML D    K+FHYG
Sbjct: 44  IAIDCETMGLNPHRDRLCLVQISGGDGNAHMIQISPGQRSAPNLARMLEDANILKLFHYG 103

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +++ FG   +PV+CTKIAS++ RTYT +HGLK  L++L+G++ISK QQ SDW A
Sbjct: 104 RFDIAAMYHAFGALAQPVYCTKIASKMVRTYTERHGLKFLLQDLIGVDISKHQQQSDWGA 163

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             L+  QL YAASDV++LH LR      L R GR+ LA +C +FL  RA LDL GW+  D
Sbjct: 164 ASLTPAQLDYAASDVLYLHRLRAHLDALLAREGRTGLAQACFDFLPTRARLDLEGWQEND 223

Query: 203 IFSH 206
           IF+H
Sbjct: 224 IFAH 227


>gi|304320833|ref|YP_003854476.1| hypothetical protein PB2503_06342 [Parvularcula bermudensis
           HTCC2503]
 gi|303299735|gb|ADM09334.1| hypothetical protein PB2503_06342 [Parvularcula bermudensis
           HTCC2503]
          Length = 204

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/204 (51%), Positives = 141/204 (69%), Gaps = 2/204 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +H  D+PA+   R+  A+AVD+ETLGL P RDRLC+VQLS GDG   ++   AG  +A
Sbjct: 3   IHLHRNDLPADI--RFDGAVAVDSETLGLNPLRDRLCVVQLSAGDGDAHLVTFDAGAYDA 60

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P+L  +L D +  KIFH+ RFD+AV  +  GV   P++CTKIAS+L RTYT++HGLKD +
Sbjct: 61  PHLKAVLSDPQLLKIFHFARFDVAVFKHWLGVDTTPIYCTKIASKLARTYTDRHGLKDVV 120

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +E+ G+ +SK QQSSDW+A +L++ Q  YAASDV+HLHA+R      + R GR  L T+ 
Sbjct: 121 REMTGVELSKQQQSSDWAAAELTEAQRAYAASDVLHLHAVREGLDRMIDREGRRALLTAA 180

Query: 184 CNFLMDRAELDLLGWENVDIFSHS 207
             FL  RA LDL GW   DIF+HS
Sbjct: 181 FAFLPTRAALDLAGWSETDIFAHS 204


>gi|119713543|gb|ABL97595.1| putative exonuclease [uncultured marine bacterium EB0_39F01]
          Length = 204

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 99/185 (53%), Positives = 134/185 (72%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTET+GL P RDRLC++Q S GDG   I++I      APN+  +L+D+ + K+FH+ 
Sbjct: 20  VAIDTETMGLNPMRDRLCVIQFSSGDGNAHIVQIEPDAPQAPNICKILLDQNKVKLFHFA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA+L + F + + PV+CTKIAS+L RTYTN+HGLK+ L+E+L I ISK QQSSDW A
Sbjct: 80  RFDIAILKHHFKINISPVYCTKIASKLVRTYTNKHGLKNLLREMLSIEISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
            +L+  Q++YAASDV++LH L  +    L+R  R ++A +C NFL  RA LDL GW   D
Sbjct: 140 SELTKAQIEYAASDVLYLHKLMDKLNLNLKRENRYEIAEACFNFLPMRATLDLAGWSEDD 199

Query: 203 IFSHS 207
           IFSHS
Sbjct: 200 IFSHS 204


>gi|239787681|emb|CAX84189.1| 3\'-5\' exonuclease family protein [uncultured bacterium]
          Length = 202

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 112/201 (55%), Positives = 139/201 (69%), Gaps = 3/201 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +H GD+P       V  IA+DTET+GL P RDRLC+VQLS GDG   ++    G+  AP 
Sbjct: 5   LHHGDLPEGLDLGPV--IAIDTETMGLNPMRDRLCLVQLSSGDGDAHLVHFQ-GRYEAPR 61

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L D  R K+FHY RFDIA+L    GV   PV+CTKIASRLTRT T++HGLKD  ++
Sbjct: 62  LKALLADHNRLKLFHYARFDIAMLARWLGVTCTPVYCTKIASRLTRTNTDKHGLKDLCRD 121

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LLGI++SK QQ+SDW + DL+ EQ  YAASDV+HLHAL+ +    L+R GR  LA SC +
Sbjct: 122 LLGIDLSKQQQTSDWGSGDLTAEQQAYAASDVLHLHALKAKLDALLKREGRGALADSCYS 181

Query: 186 FLMDRAELDLLGWENVDIFSH 206
           FL  RA LDLLGW   DIF+H
Sbjct: 182 FLPTRAALDLLGWGEEDIFAH 202


>gi|295691424|ref|YP_003595117.1| 3'-5' exonuclease [Caulobacter segnis ATCC 21756]
 gi|295433327|gb|ADG12499.1| 3'-5' exonuclease [Caulobacter segnis ATCC 21756]
          Length = 205

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 140/202 (69%), Gaps = 1/202 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           VHEGD+P    A     IA+D+ET+GL   RD LC+VQLS GDG   ++R++    + PN
Sbjct: 5   VHEGDLPDGVFAG-ASIIAIDSETMGLRLGRDPLCVVQLSSGDGDAHVVRLSRPDYDCPN 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L D    K+FH+GRFDIA+     GV   PV+CTKIAS+L RTYT++HGLKD  +E
Sbjct: 64  LKALLTDPAILKLFHFGRFDIAMFQLHLGVVTAPVYCTKIASKLARTYTDRHGLKDVTRE 123

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LLG+ +SKAQQSSDW +  LS +Q+ YAASDV+HLH LR +    L+R GR  LA +  +
Sbjct: 124 LLGVELSKAQQSSDWGSASLSADQVAYAASDVLHLHGLRQKLNAMLEREGRMALAQAAFD 183

Query: 186 FLMDRAELDLLGWENVDIFSHS 207
           +L  RA LDL GWE+VDIF+HS
Sbjct: 184 YLPHRASLDLAGWEDVDIFAHS 205


>gi|68171372|ref|ZP_00544766.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657845|ref|YP_507797.1| 3'-5' exonuclease family protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67772422|gb|AAY79412.1| ribonuclease D [Ehrlichia chaffeensis]
 gi|67999197|gb|EAM85853.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599302|gb|ABD44771.1| 3'-5' exonuclease family protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 204

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 3/204 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           + VH+ D+P     ++ + +AVDTET+GL+ RRD+LC+VQL   +G   +++   G   A
Sbjct: 3   VFVHDCDLPN--GLKFENTVAVDTETMGLVCRRDKLCVVQLCDSNGETHLVKFL-GSYQA 59

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNLV +L D    KIFH+ RFDIAV+ Y  GV   P +CTKIAS+L RTYT+ HGLK+  
Sbjct: 60  PNLVSVLSDSSITKIFHFARFDIAVIRYYLGVWATPCYCTKIASKLVRTYTDHHGLKELC 119

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELL + ++K QQSSDW  + L+ EQL YAASDV++LHAL+ +    LQR  + +LA SC
Sbjct: 120 YELLNVKLNKMQQSSDWGKETLTSEQLNYAASDVIYLHALKNKLDAMLQRENKQELAASC 179

Query: 184 CNFLMDRAELDLLGWENVDIFSHS 207
             FL  RA+LDLLGW+ VDIFSH+
Sbjct: 180 FGFLPTRAQLDLLGWDGVDIFSHA 203


>gi|254796888|ref|YP_003081725.1| ribonuclease D [Neorickettsia risticii str. Illinois]
 gi|254590124|gb|ACT69486.1| ribonuclease D [Neorickettsia risticii str. Illinois]
          Length = 216

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 141/201 (70%), Gaps = 2/201 (0%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           ++EGD+PA+      DAIAVDTE++GL+ RRDRLC+VQLS GDGT  ++R      +AP 
Sbjct: 16  IYEGDVPADFPLS--DAIAVDTESMGLVNRRDRLCLVQLSTGDGTAHLVRFNGTDYSAPR 73

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  ++VD    KIFH+ RFDIA+L +  GV     +CTKIASRL RTYT+ H LK+   +
Sbjct: 74  LKSLIVDPAVIKIFHFARFDIAILRHYLGVLTENCYCTKIASRLVRTYTDHHSLKELCSD 133

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           LLG+ ++K +QSSDW +  L+ EQ+ YAASDV++LHA++      L+R  R +LA +C  
Sbjct: 134 LLGVRLNKGKQSSDWGSASLTREQMSYAASDVLYLHAIKEALDVMLKREKRIELAQACFQ 193

Query: 186 FLMDRAELDLLGWENVDIFSH 206
           FL  RAELDLLGWEN DIFSH
Sbjct: 194 FLPYRAELDLLGWENQDIFSH 214


>gi|114769797|ref|ZP_01447407.1| exonuclease, putative [alpha proteobacterium HTCC2255]
 gi|114549502|gb|EAU52384.1| exonuclease, putative [alpha proteobacterium HTCC2255]
 gi|161170293|gb|ABX59263.1| 5-exonuclease family protein [uncultured marine bacterium
           EB000_55B11]
 gi|297183821|gb|ADI19944.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 204

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 99/185 (53%), Positives = 134/185 (72%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTET+GL P RDRLC++Q S GDG   I++I      APN+  +L+D+ + K+FH+ 
Sbjct: 20  VAIDTETMGLNPMRDRLCVIQFSSGDGHAHIVQIEPDAPQAPNICKILLDQNKVKLFHFA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA+L + F + + PV+CTKIAS+L RTYTN+HGLK+ L+E+L I ISK QQSSDW A
Sbjct: 80  RFDIAILKHHFKINISPVYCTKIASKLVRTYTNKHGLKNLLREMLSIEISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
            +L+  Q++YAASDV++LH L  +    L+R  R ++A +C NFL  RA LDL GW   D
Sbjct: 140 SELTKAQIEYAASDVLYLHKLMDKLNLNLKRENRYEIAEACFNFLPMRATLDLAGWSEDD 199

Query: 203 IFSHS 207
           IFSHS
Sbjct: 200 IFSHS 204


>gi|254450150|ref|ZP_05063587.1| 3'-5' exonuclease [Octadecabacter antarcticus 238]
 gi|198264556|gb|EDY88826.1| 3'-5' exonuclease [Octadecabacter antarcticus 238]
          Length = 203

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/204 (52%), Positives = 141/204 (69%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T  +++ D+P       V  +A+D ET+GL P RDRLC+VQLS GDG   +I++A GQ  
Sbjct: 2   TNHLYQNDLPDGLDLGAV--VAIDCETMGLNPHRDRLCLVQLSGGDGNCHLIQVAGGQTT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D +  K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGLK+ 
Sbjct: 60  APNLCKVLADPQVLKLFHFGRFDIAAMLNAFGTVTAPVYCTKIASKLIRTYTDRHGLKNL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L+E L ++ISK QQ SDW AD LS  QL YAASDV++LH LR +   +L R  R+D+A +
Sbjct: 120 LQEFLRVDISKFQQQSDWGADQLSKAQLDYAASDVLYLHKLRDELNIRLARELRTDMAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C +FL  RA+LDL GW   DIFSH
Sbjct: 180 CFDFLPMRAQLDLAGWPEQDIFSH 203


>gi|302381884|ref|YP_003817707.1| 3'-5' exonuclease [Brevundimonas subvibrioides ATCC 15264]
 gi|302192512|gb|ADL00084.1| 3'-5' exonuclease [Brevundimonas subvibrioides ATCC 15264]
          Length = 204

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 144/205 (70%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+ +HEGD+P +        +AVD+ET+GL  RRD LC+VQLS GDG   ++R++    +
Sbjct: 2   TVYLHEGDLPDDLD--LGPEVAVDSETMGLRFRRDPLCVVQLSSGDGDAHVVRLSRPDYD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  ++ D    KIFH+GRFDIA++    GV   PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  CPNLKRLMADRDVLKIFHFGRFDIAMVELHLGVETGPVYCTKIASKLARTYTDRHGLKDV 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +E+ GI++SKAQQSSDW A +LS  QL YAASDV+HLH +  +  E L R GR +LA +
Sbjct: 120 AREMAGIDLSKAQQSSDWGAAELSQAQLDYAASDVLHLHVIMRRLNEMLVREGRMELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA LDL GW+ +DIF+H+
Sbjct: 180 CFDFLPVRARLDLRGWDEMDIFAHT 204


>gi|126734481|ref|ZP_01750228.1| exonuclease, putative [Roseobacter sp. CCS2]
 gi|126717347|gb|EBA14211.1| exonuclease, putative [Roseobacter sp. CCS2]
          Length = 203

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 101/184 (54%), Positives = 135/184 (73%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   ++++  GQ  APNL  ML +    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCLIQMSGGDGDCHLVQVTPGQTAAPNLCAMLENPDVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA L   FG    PV+CTKIAS+L RTYT++HGLK  L++++GI+ISK QQ SDW A
Sbjct: 80  RFDIAALLNAFGALTAPVYCTKIASKLVRTYTDRHGLKTLLQDMVGIDISKHQQQSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
            +L+D QL YAASDV++LH L+ +F   L R  R+D+A SC +FL  RA+LDL GW ++D
Sbjct: 140 PNLTDAQLDYAASDVLYLHQLKEKFDVLLAREHRADVAQSCFDFLPTRAKLDLAGWPDID 199

Query: 203 IFSH 206
           IFSH
Sbjct: 200 IFSH 203


>gi|57239514|ref|YP_180650.1| putative ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|58579496|ref|YP_197708.1| putative ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|58617549|ref|YP_196748.1| putative ribonuclease D [Ehrlichia ruminantium str. Gardel]
 gi|57161593|emb|CAH58521.1| putative exonuclease [Ehrlichia ruminantium str. Welgevonden]
 gi|58417161|emb|CAI28274.1| Probable ribonuclease D [Ehrlichia ruminantium str. Gardel]
 gi|58418122|emb|CAI27326.1| Probable ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
          Length = 205

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 104/204 (50%), Positives = 141/204 (69%), Gaps = 2/204 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I VH+ D+P      + + +AVDTET+GL+ RRDRLC+VQ+S  +G V +++  + +  A
Sbjct: 3   IFVHDYDLPD--GVEFGNTVAVDTETMGLVCRRDRLCLVQMSGSNGNVHLVKFPSTEYQA 60

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
            NL  +L D    KIFH+ RFDI  + Y  G+   P +CTKIAS+L RTYT+ HGLK+  
Sbjct: 61  SNLKKILSDLSITKIFHFARFDITAIRYYLGIWAIPCYCTKIASKLARTYTDHHGLKELC 120

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELLGI ++K QQSSDW  + L+ EQL YAASDV+HLHAL+ +    L+R  + +LA SC
Sbjct: 121 NELLGIKLNKVQQSSDWGKEVLTSEQLNYAASDVIHLHALKSKLDAMLERENKQELAKSC 180

Query: 184 CNFLMDRAELDLLGWENVDIFSHS 207
            +FL  R +LDLLGW+NVDIFSH+
Sbjct: 181 FDFLPTRVQLDLLGWDNVDIFSHA 204


>gi|163745220|ref|ZP_02152580.1| 3'- 5' exonuclease family protein, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161382038|gb|EDQ06447.1| 3'- 5' exonuclease family protein, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 204

 Score =  217 bits (552), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 133/185 (71%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ  APNL  +L +    K+FHYG
Sbjct: 20  VAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQIAKGQTEAPNLCALLENPHVLKLFHYG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FG    PV+CTKIASRL RTYT++HGL    +ELL ++ISK QQSSDW A
Sbjct: 80  RFDIAAMLNAFGATAAPVYCTKIASRLIRTYTDRHGLAKLCQELLSVDISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
            +L+  Q+ YAASDV++LH LR +  ++L R GR D+A +C +FL  RA LDL GW + D
Sbjct: 140 KELTQAQIDYAASDVLYLHRLRDELNKRLIREGRMDMAQACFDFLPMRARLDLEGWPDTD 199

Query: 203 IFSHS 207
           IF+H+
Sbjct: 200 IFAHA 204


>gi|154250652|ref|YP_001411476.1| 3'-5' exonuclease [Parvibaculum lavamentivorans DS-1]
 gi|154154602|gb|ABS61819.1| 3'-5' exonuclease [Parvibaculum lavamentivorans DS-1]
          Length = 203

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 140/204 (68%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            + +H GD+P   +  + +++AVDTET+GL P RD+LC+VQLS GDG   I+++  G  N
Sbjct: 2   AVTLHRGDLPEGLS--FGESVAVDTETMGLHPERDQLCVVQLSAGDGNAHIVQLDRGTYN 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           AP L  ++ D    KIFH+ RFD+A+L    GV   PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 60  APRLRALMADPAILKIFHFARFDVAMLQRYLGVVTAPVYCTKIASKLVRTYTDRHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL+ I++SK QQSSDW A  L+D QL YAASDV+HLH ++      L R GR++LA +
Sbjct: 120 ARELVNIDMSKQQQSSDWGAASLTDAQLSYAASDVLHLHEIKSVLDGMLAREGRTELARA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  RA LDL GW   DIF+H
Sbjct: 180 CFAFLPVRAALDLAGWPEEDIFAH 203


>gi|148555811|ref|YP_001263393.1| 3'-5' exonuclease [Sphingomonas wittichii RW1]
 gi|148501001|gb|ABQ69255.1| 3'-5' exonuclease [Sphingomonas wittichii RW1]
          Length = 205

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 142/205 (69%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           T+ +H+ D+PA+        +AVDTET+GL+  RDRLC+VQ+S G G   ++R A G   
Sbjct: 2   TVHLHQEDLPADALG--PGPVAVDTETMGLITPRDRLCLVQISDGRGDEHLVRFAPGSDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  R K++H+ RFD+A + +  GV   PV+CTK ASRL RTYT++HGLK+
Sbjct: 60  AAPNLRAVLADPARLKLYHFARFDLAAIRHYIGVMAAPVYCTKTASRLIRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG  +SK QQSSDW A DLS+ Q  YAASDV +LHA+R    E+L R GR+ LA 
Sbjct: 120 LVRELLGQEVSKQQQSSDWGAPDLSEAQKDYAASDVRYLHAMRTILDERLAREGRTALAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  RAELDL GW  +DIF+H
Sbjct: 180 ACFDFLPARAELDLAGWPEIDIFAH 204


>gi|294013112|ref|YP_003546572.1| ribonuclease D [Sphingobium japonicum UT26S]
 gi|292676442|dbj|BAI97960.1| ribonuclease D [Sphingobium japonicum UT26S]
          Length = 205

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 140/205 (68%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           T+  HE D+P    A     IAVDTET+GL+  RDRLC+VQ+S G G   ++R   G   
Sbjct: 2   TVHFHEEDLPLGVLA--PGPIAVDTETMGLITPRDRLCVVQISDGQGDEHLVRFNPGSDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL   L D  R K++H+GRFDIA + +  GV   PV+CTKIASRL RTYT++HGLK+
Sbjct: 60  AAPNLRAALADPARLKLYHFGRFDIAAIRHYLGVVAAPVYCTKIASRLVRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG  +SK QQSSDW    LSD Q +YAASDV +LHAL+ +  ++L R GR +LA 
Sbjct: 120 LVRELLGQELSKVQQSSDWGGPVLSDAQKEYAASDVRYLHALKAELDKRLAREGRMELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  RAELDL GW  +DIF+H
Sbjct: 180 ACFDFLPHRAELDLAGWPEIDIFAH 204


>gi|330993409|ref|ZP_08317344.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
 gi|329759439|gb|EGG75948.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
          Length = 215

 Score =  216 bits (551), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 143/205 (69%), Gaps = 4/205 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I  H GD+PA+    +   +AVDTET+GL P RDRLC+VQLS GDG   ++++      A
Sbjct: 10  IHFHRGDLPADVT--FTGMVAVDTETMGLNPHRDRLCLVQLSAGDGQAHLVQVPPHATAA 67

Query: 64  --PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
             PNLV +L D +  KI H+ RFD+A+L +TF V V P  CTK+AS+L RTYT++HGL +
Sbjct: 68  GFPNLVRVLTDARVPKIMHFARFDVAILQHTFNVTVAPCICTKVASKLVRTYTDRHGLAN 127

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+ +SK QQSSDW A DL+ EQL YAASDV++LHAL  +    L R GR D+A 
Sbjct: 128 LCRELLGVELSKQQQSSDWGATDLTREQLCYAASDVLYLHALWERLEALLHREGRRDVAQ 187

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +F+  RA LD+LG+++ DIF+H
Sbjct: 188 ACFDFMPARARLDILGYQDPDIFAH 212


>gi|326388611|ref|ZP_08210204.1| 3'-5' exonuclease [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206862|gb|EGD57686.1| 3'-5' exonuclease [Novosphingobium nitrogenifigens DSM 19370]
          Length = 205

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 143/205 (69%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
            + +HE D+PA+  A  +  +AVDTET+GL+  RDRLC+VQ+S G G   ++R A G   
Sbjct: 2   AVYLHEEDLPADVLAPGI--VAVDTETMGLVTTRDRLCVVQISDGKGDEHLVRFAPGSTY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D +R K+FH+ RFD+A + Y  GV   PVFCTKIAS+L RTYT++HGLK+
Sbjct: 60  DAPNLKAVLADPERLKLFHFARFDLAAIHYYLGVMATPVFCTKIASKLVRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL G  ISK QQSSDW   +LSD QL+YAASDV +LH       ++L R GR+++A 
Sbjct: 120 LVRELAGKEISKQQQSSDWGGANLSDAQLEYAASDVRYLHTCHAVLVDRLAREGRAEIAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  RA LD+ GW + DIFSH
Sbjct: 180 ACFDFLPTRALLDIAGWADRDIFSH 204


>gi|307293724|ref|ZP_07573568.1| 3'-5' exonuclease [Sphingobium chlorophenolicum L-1]
 gi|306879875|gb|EFN11092.1| 3'-5' exonuclease [Sphingobium chlorophenolicum L-1]
          Length = 205

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/205 (52%), Positives = 141/205 (68%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           T+  HE D+P    A     IAVDTET+GL+  RDRLC+VQ+S G G   ++R   G   
Sbjct: 2   TVHFHEEDLPQGVLA--PGPIAVDTETMGLITPRDRLCVVQISDGQGDEHLVRFNPGSDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  R K++H+GRFDIA + +  G+   PV+CTKIASRL RTYT++HGLK+
Sbjct: 60  AAPNLRAVLADPARLKLYHFGRFDIAAIRHYMGIVAAPVYCTKIASRLVRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG  +SK QQSSDW    LSD Q +YAASDV +LHAL+ +  ++L R GR +LA 
Sbjct: 120 LVRELLGQELSKVQQSSDWGGPVLSDPQKEYAASDVRYLHALKAELDKRLVREGRMELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  RAELDL GW  +DIF+H
Sbjct: 180 ACFDFLPHRAELDLAGWPEIDIFAH 204


>gi|149201444|ref|ZP_01878419.1| exonuclease, putative [Roseovarius sp. TM1035]
 gi|149145777|gb|EDM33803.1| exonuclease, putative [Roseovarius sp. TM1035]
          Length = 203

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 104/184 (56%), Positives = 133/184 (72%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQLS GDG   +++++ GQ  APNL  +L +    K+FH+G
Sbjct: 20  VAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQVSKGQTTAPNLARLLENPDVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FG    PV+CTKIAS+L RTYT++HGLK  L+ELL I+ISK QQSSDW A
Sbjct: 80  RFDIAAMQNAFGALAAPVYCTKIASKLIRTYTDRHGLKYLLQELLNIDISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           D LS  QL YAASDV++LH LR +   +L R GR +LA +C +FL  RA LDL GW  +D
Sbjct: 140 DSLSAAQLDYAASDVLYLHRLRDELNARLIREGRMELAQACFDFLPQRALLDLAGWPEID 199

Query: 203 IFSH 206
           IF+H
Sbjct: 200 IFAH 203


>gi|126724660|ref|ZP_01740503.1| exonuclease, putative [Rhodobacterales bacterium HTCC2150]
 gi|126705824|gb|EBA04914.1| exonuclease, putative [Rhodobacterales bacterium HTCC2150]
          Length = 203

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 132/184 (71%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   ++++  GQ  APNL  ML D    K+FH+G
Sbjct: 20  VAIDCETMGLNPIRDRLCLIQMSNGDGNAHMVQVEKGQTEAPNLCRMLADPNVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FGV   PV+CTKIAS++ RTYT++HGL++ L+ELL ++ISK QQ SDW A
Sbjct: 80  RFDIAAMHNAFGVLTEPVYCTKIASKMVRTYTDRHGLRNLLQELLKVDISKFQQMSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + L+  QL YAASDV+HLH LR +  E L R GR +LA SC +FL  RA LDL GW   D
Sbjct: 140 ETLTKAQLDYAASDVLHLHRLRDRLNELLVREGRMELAQSCFDFLPSRALLDLKGWPETD 199

Query: 203 IFSH 206
           IF+H
Sbjct: 200 IFAH 203


>gi|87201263|ref|YP_498520.1| 3'-5' exonuclease [Novosphingobium aromaticivorans DSM 12444]
 gi|87136944|gb|ABD27686.1| 3'-5' exonuclease [Novosphingobium aromaticivorans DSM 12444]
          Length = 205

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 108/205 (52%), Positives = 141/205 (68%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
            + +HE D+P    A    A+AVDTET+GL+  RDRLC+VQ+S G G   ++R + G   
Sbjct: 2   AVFLHEEDLPEGALA--PGAVAVDTETMGLITPRDRLCVVQISDGRGDEHLVRFSPGSAF 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D +R K++H+ RFD+A + +  GV   PVFCTKIAS+L RTYT++HGLKD
Sbjct: 60  AAPNLKAVLADPERLKLYHFARFDLAAIEHYLGVVAAPVFCTKIASKLVRTYTDRHGLKD 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG  ISK QQSSDW A  L+D Q +YAASDV HLHA+     E+L+R GR+ +A 
Sbjct: 120 LVRELLGKEISKQQQSSDWGAPTLTDAQQEYAASDVRHLHAMHTILVERLEREGRTAMAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  RA LDL GW   DIFSH
Sbjct: 180 ACFDFLPMRARLDLAGWAERDIFSH 204


>gi|94495607|ref|ZP_01302187.1| ribonuclease D 3'-5' exonuclease [Sphingomonas sp. SKA58]
 gi|94424995|gb|EAT10016.1| ribonuclease D 3'-5' exonuclease [Sphingomonas sp. SKA58]
          Length = 205

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 140/205 (68%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           T+  HE D+P    A     IAVDTET+GL+  RDRLC+VQ+S G G   ++R   G   
Sbjct: 2   TVHFHEEDLPVGVLA--PGPIAVDTETMGLITPRDRLCVVQISDGKGDEHLVRFNPGSDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D +R K++H+GRFDIA L +  G+   PV+CTKIASRL RTYT++HGLK+
Sbjct: 60  AAPNLKAVLADPERLKLYHFGRFDIAALRHYLGIVAAPVYCTKIASRLVRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG +ISK QQSSDW    LSD Q  YAASDV  LH L+ +  ++L+R GR +LA 
Sbjct: 120 LVRELLGQDISKQQQSSDWGGPVLSDAQKDYAASDVRFLHQLKAELDKRLEREGRMELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  RAELDL GW   DIF+H
Sbjct: 180 ACFDFLPHRAELDLAGWPETDIFAH 204


>gi|149912958|ref|ZP_01901492.1| exonuclease, putative [Roseobacter sp. AzwK-3b]
 gi|149813364|gb|EDM73190.1| exonuclease, putative [Roseobacter sp. AzwK-3b]
          Length = 203

 Score =  215 bits (547), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQ+S GDG   +++I  GQ  APNL  +L +    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCVVQMSGGDGNAYLVQIDKGQTEAPNLAALLENPDILKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +F  FG    PV+CTKIAS+L RTYT++HGLK+ ++ELL  +ISK QQSSDW A
Sbjct: 80  RFDIAAMFNAFGALAAPVYCTKIASKLVRTYTDRHGLKNLMQELLDKDISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             L++ QL YAASDV++LH LR +    L R GR ++A +C +FL  RA+LDL GW  +D
Sbjct: 140 PKLTEAQLDYAASDVLYLHQLRDELNRMLAREGRVEMAQACFDFLPIRAKLDLAGWPEID 199

Query: 203 IFSH 206
           IF+H
Sbjct: 200 IFAH 203


>gi|84514850|ref|ZP_01002213.1| exonuclease, putative [Loktanella vestfoldensis SKA53]
 gi|84511009|gb|EAQ07463.1| exonuclease, putative [Loktanella vestfoldensis SKA53]
          Length = 203

 Score =  214 bits (546), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 101/184 (54%), Positives = 131/184 (71%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++Q+S GDG   +++++ GQ  APNL  ML D    K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCLIQMSGGDGDCHLVQVSKGQAGAPNLCAMLTDPAVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA L   FGV   PV+CTKIAS+L RTYT++HGLK  L+++LGI+ISK QQ SDW A
Sbjct: 80  RFDIAALLNAFGVVTAPVYCTKIASKLVRTYTDRHGLKVLLQDMLGIDISKHQQQSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             L+  QL YAASDV++LH L+  F   LQR  R+ +A +C +FL  RA LDL GW   D
Sbjct: 140 PKLTPAQLDYAASDVLYLHQLKAAFDVLLQREDRTAVAKACFDFLPTRAALDLHGWPETD 199

Query: 203 IFSH 206
           IF+H
Sbjct: 200 IFTH 203


>gi|85705765|ref|ZP_01036862.1| exonuclease, putative [Roseovarius sp. 217]
 gi|85669755|gb|EAQ24619.1| exonuclease, putative [Roseovarius sp. 217]
          Length = 203

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 103/184 (55%), Positives = 132/184 (71%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ +APNL  +L D    K+FH+G
Sbjct: 20  VAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQVAKGQTSAPNLERLLTDPNVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FG    PV+CTKIAS+L RTYT++HGLK  L+ELL I+ISK QQSSDW A
Sbjct: 80  RFDIAAMHNAFGALAAPVYCTKIASKLIRTYTDRHGLKYLLQELLNIDISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + L+  QL YAASDV++LH LR +   +L R  R  LA +C +FL  RA LDL GW  +D
Sbjct: 140 ESLTSAQLDYAASDVLYLHRLRDELNTRLVREDRMGLAQACFDFLPQRAVLDLAGWPEID 199

Query: 203 IFSH 206
           IF+H
Sbjct: 200 IFAH 203


>gi|83950822|ref|ZP_00959555.1| exonuclease, putative [Roseovarius nubinhibens ISM]
 gi|83838721|gb|EAP78017.1| exonuclease, putative [Roseovarius nubinhibens ISM]
          Length = 203

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 146/204 (71%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T  V++GD+P +     +  +A+D ET+GL+P RDRLC+VQLS GDG   ++++A GQ+ 
Sbjct: 2   TNTVYKGDLPDDLDLGPI--VAIDCETMGLLPHRDRLCVVQLSGGDGHAHLVQVAKGQRT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L +    K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGL++ 
Sbjct: 60  APNLVRLLENPDVLKLFHFGRFDIAAMLNAFGAVAAPVYCTKIASKLVRTYTDRHGLRNL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           L++LLG++ISK QQSSDW   +LS  Q+ YAASDV++LH LR     +L R  R ++A +
Sbjct: 120 LQDLLGVDISKHQQSSDWGRAELSTAQIDYAASDVLYLHRLREALNVRLLREERMEMAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C +FL  RA+LDL GW + D+F+H
Sbjct: 180 CFDFLPMRAQLDLAGWPDDDLFAH 203


>gi|260577298|ref|ZP_05845271.1| 3'-5' exonuclease [Rhodobacter sp. SW2]
 gi|259020479|gb|EEW23802.1| 3'-5' exonuclease [Rhodobacter sp. SW2]
          Length = 204

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 108/204 (52%), Positives = 144/204 (70%), Gaps = 3/204 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           + +++GD+PA      V  +A+DTET+GL PRRDRLC+VQLS GDG   +++IA GQ +A
Sbjct: 3   VHLYKGDLPAGLNLGPV--VAIDTETMGLDPRRDRLCLVQLSSGDGNAHLVQIARGQTSA 60

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L D    K+FH+GRFDIA +   FGV   PV+CTKIA++L RT+T++HGLK  L
Sbjct: 61  PNLEKLLTDPSVLKLFHFGRFDIAAMKAAFGVVTAPVWCTKIAAKLVRTFTDRHGLKYLL 120

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +EL+G+++SK QQ+SDW ++ LSD Q  YAASDV++LH L  +    L R  R  LA  C
Sbjct: 121 QELVGVDVSKQQQTSDWGSETLSDAQKDYAASDVLYLHRLMAELERCLIRENRLALAQRC 180

Query: 184 CNFLMDRAELDLLGW-ENVDIFSH 206
            +FL  RAELDL+GW E  DIF H
Sbjct: 181 FDFLPTRAELDLMGWDEPNDIFHH 204


>gi|241760851|ref|ZP_04758940.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753179|ref|YP_003226072.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283856222|ref|YP_162013.2| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374470|gb|EER63931.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552542|gb|ACV75488.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283775217|gb|AAV88902.2| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 209

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 141/205 (68%), Gaps = 3/205 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA-GQK 61
           T+  HE D+P +  +    A+AVDTET+GL+  RDRLC+VQ+S G G   ++R A     
Sbjct: 6   TVYFHEEDLPKDALSE--GAVAVDTETMGLITHRDRLCVVQISDGKGDQHLVRFAPDSDY 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D  R KI+H+GRFDIA + Y  GV   PV+CTKIAS+L RTYT++HGLK+
Sbjct: 64  SAPNLKAVLSDPNRLKIYHFGRFDIAAILYYLGVMAAPVYCTKIASKLVRTYTDRHGLKE 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG +ISK QQ SDW  + LSD Q +YAASDV  LH L+ +   +L+R  R +LA 
Sbjct: 124 LVRELLGQDISKQQQCSDWGGEKLSDAQREYAASDVRFLHGLKEKLDIRLKREKREELAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  RA+LD+ GW   DIF+H
Sbjct: 184 ACFDFLPTRAKLDIAGWSETDIFAH 208


>gi|85709987|ref|ZP_01041052.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. NAP1]
 gi|85688697|gb|EAQ28701.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. NAP1]
          Length = 215

 Score =  214 bits (544), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 2/206 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           T+  HE D+PA         +AVDTET+GL+  RDRLC+VQ+S G G   ++R + G   
Sbjct: 6   TVHFHEEDLPA-GVLEGTGPLAVDTETMGLITHRDRLCVVQISDGSGDEHLVRFSPGSDY 64

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L DE R K++H+ RFD+A + Y  GV   PVFCTKIAS+L RTYT++HGLK+
Sbjct: 65  EAPNLSAILADESRVKLYHFARFDLAAIQYYLGVVAAPVFCTKIASKLVRTYTDRHGLKN 124

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELLG +ISK QQSSDW   +L+D Q +YAASDV +LH LR +   +L+R GR ++A 
Sbjct: 125 LTDELLGESISKQQQSSDWGGPELNDAQREYAASDVRYLHRLRDELIVRLEREGRMEIAQ 184

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LD+ GW+  DIFSH+
Sbjct: 185 ACFDFLPTRAALDIAGWDGRDIFSHN 210


>gi|254292595|ref|YP_003058618.1| 3'-5' exonuclease [Hirschia baltica ATCC 49814]
 gi|254041126|gb|ACT57921.1| 3'-5' exonuclease [Hirschia baltica ATCC 49814]
          Length = 204

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/205 (50%), Positives = 141/205 (68%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            I+ HEGD+P     +    +AVDTE +GL   RD+LC+VQLS G G   ++R+     +
Sbjct: 2   AIKYHEGDLPN--GLKLGAILAVDTEAMGLEFHRDQLCVVQLSDGTGDEHVVRLDRKTFD 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  ++ D K  KIFH+ RFD+A++    G+   P+FCTKIAS+L RTYT++HGLKD 
Sbjct: 60  CPNLKALMSDTKVLKIFHFARFDVAMMKKWLGIECAPIFCTKIASKLARTYTDRHGLKDV 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +EL+G ++SKAQQSSDW AD LS+ QL YAASDV++LH +R +    L+R GR +LA +
Sbjct: 120 SRELVGADMSKAQQSSDWGADSLSEAQLAYAASDVLYLHEIREKLILMLEREGRMELAQA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C +FL  RA+LDL GW   DIF+HS
Sbjct: 180 CFDFLPKRADLDLAGWPETDIFAHS 204


>gi|254438617|ref|ZP_05052111.1| 3'-5' exonuclease, putative [Octadecabacter antarcticus 307]
 gi|198254063|gb|EDY78377.1| 3'-5' exonuclease, putative [Octadecabacter antarcticus 307]
          Length = 203

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/184 (54%), Positives = 133/184 (72%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC++QLS GDG   +I+I+ GQ  APNL  +L D +  K+FH+G
Sbjct: 20  VAIDCETMGLNPHRDRLCLIQLSSGDGNCHLIQISVGQTTAPNLCKVLADPQVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FG    PV+CTKIAS+L RTYT++HGLK+ L+E L ++ISK QQ SDW A
Sbjct: 80  RFDIAAMLNAFGTVTAPVYCTKIASKLIRTYTDRHGLKNLLQEFLRVDISKFQQQSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           + LS  Q+ YAASDV++LH LR +   +L R  R+D+A +C +FL  RA+LDL GW   D
Sbjct: 140 ETLSKAQIDYAASDVLYLHQLRDELNIRLVRERRTDMAQACFDFLPMRAKLDLAGWPEQD 199

Query: 203 IFSH 206
           IFSH
Sbjct: 200 IFSH 203


>gi|209542515|ref|YP_002274744.1| 3'-5' exonuclease [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530192|gb|ACI50129.1| 3'-5' exonuclease [Gluconacetobacter diazotrophicus PAl 5]
          Length = 210

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 142/204 (69%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           +I +H GD+  +    +  +IAVDTE +GL P RDRLC+VQ+S GDG+  +++I  G  +
Sbjct: 8   SILLHRGDLADDVV--FHGSIAVDTEAMGLNPHRDRLCLVQISAGDGSAHLVQILPGTPS 65

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  ++ D    K+ H+ RFD+A+L ++ GV V PV CTKIAS+L RT+T +HGL   
Sbjct: 66  -PNLARLMADPSITKLMHFARFDVAILQHSLGVTVAPVICTKIASKLVRTFTERHGLAQL 124

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLG+++SK QQ+SDW A +L+ EQ  YAASDV+HLHAL  +    L R GR DLA +
Sbjct: 125 CRELLGVDLSKQQQTSDWGAPELTPEQKAYAASDVLHLHALWTKLEALLHREGRRDLAQA 184

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C +FL  RA LDLLG+E+ DIF+H
Sbjct: 185 CYDFLPTRARLDLLGYEDPDIFAH 208


>gi|56417079|ref|YP_154153.1| ribonuclease D [Anaplasma marginale str. St. Maries]
 gi|222475445|ref|YP_002563862.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
 gi|254995250|ref|ZP_05277440.1| ribonuclease D (rnd) [Anaplasma marginale str. Mississippi]
 gi|255003431|ref|ZP_05278395.1| ribonuclease D (rnd) [Anaplasma marginale str. Puerto Rico]
 gi|255004550|ref|ZP_05279351.1| ribonuclease D (rnd) [Anaplasma marginale str. Virginia]
 gi|56388311|gb|AAV86898.1| ribonuclease D [Anaplasma marginale str. St. Maries]
 gi|222419583|gb|ACM49606.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
          Length = 204

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 142/204 (69%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            + VH  D+P        + +AVDTET+GL+ RRDR+C+VQLS GDG   +++ + G  +
Sbjct: 2   AVFVHNNDLPD--GLDLGNVVAVDTETMGLVCRRDRVCLVQLSSGDGDAHLVKFS-GDYS 58

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ++ + +  KIFH+ RFD+A + + FG+   P +CTKIASRL RTYTN HGLKD 
Sbjct: 59  APNLRRIVSNPEIMKIFHFARFDVAAIRHCFGMWAVPCYCTKIASRLVRTYTNHHGLKDL 118

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELLG+ I+KAQQSSDW  + L+ EQL YAA+DV++LH ++ +    L+R  + DLA S
Sbjct: 119 CYELLGVKINKAQQSSDWGREVLTSEQLSYAAADVIYLHDIKKKLDMMLEREDKQDLAES 178

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  F+  RAELDLLGW+ VDIFSH
Sbjct: 179 CFKFIPARAELDLLGWDGVDIFSH 202


>gi|209966458|ref|YP_002299373.1| ribonuclease D, putative [Rhodospirillum centenum SW]
 gi|209959924|gb|ACJ00561.1| ribonuclease D, putative [Rhodospirillum centenum SW]
          Length = 204

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 142/204 (69%), Gaps = 3/204 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK-N 62
           I +H+GD+P       V  +A+DTET+GL P RDRLC+VQLS GDG   +++   G   +
Sbjct: 3   IDLHDGDLPDGLDLGPV--VAIDTETMGLNPARDRLCLVQLSAGDGRCHLVQFRQGAGYD 60

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D    K+FH+ RFDIAV+    GV   PV+CTK+AS+LTRT+T++HGLKD 
Sbjct: 61  APNLKRMLTDPGTLKLFHFARFDIAVMQAYLGVLTGPVYCTKVASKLTRTFTDRHGLKDL 120

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            ++LLG+ +SK QQSSDW AD+L+ EQL+YAASDV+HLH ++ +    L R GR+ LA  
Sbjct: 121 CRDLLGVELSKQQQSSDWGADELTAEQLKYAASDVLHLHEIKARLDGMLAREGRTALAED 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  RA LDL GW + D+F+H
Sbjct: 181 CFRFLPTRALLDLGGWADPDLFAH 204


>gi|269958513|ref|YP_003328300.1| 3'-5' exonuclease [Anaplasma centrale str. Israel]
 gi|269848342|gb|ACZ48986.1| 3'-5' exonuclease [Anaplasma centrale str. Israel]
          Length = 204

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            + VH  D+P        + +AVDTET+GL+ RRDR+C+VQLS GDG   +++ + G  +
Sbjct: 2   AVFVHNNDLPD--GLDLGNVVAVDTETMGLVCRRDRVCLVQLSSGDGDAHLVKFS-GDYS 58

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ++ +    KIFH+ RFD+A + + FG+   P +CTKIASRL RTYTN HGLKD 
Sbjct: 59  APNLRRIVSNPDIMKIFHFARFDVAAIRHCFGMWATPCYCTKIASRLVRTYTNHHGLKDL 118

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELLG+ I+KAQQSSDW  + L+ EQL YAA+DV++LH ++ +    L+R  + DLA S
Sbjct: 119 CYELLGVKINKAQQSSDWGREVLTSEQLSYAAADVIYLHDIKKKLDMMLEREDKQDLAES 178

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  F+  RAELDLLGW+ VDIFSH
Sbjct: 179 CFKFIPARAELDLLGWDGVDIFSH 202


>gi|162147898|ref|YP_001602359.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786475|emb|CAP56057.1| putative ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
          Length = 210

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 142/204 (69%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           +I +H GD+  +    +  +IAVDTE +GL P RDRLC+VQ+S GDG+  +++I  G  +
Sbjct: 8   SILLHRGDLADDVV--FHGSIAVDTEAMGLNPHRDRLCLVQISAGDGSAHLVQILPGTPS 65

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
            PNL  ++ D    K+ H+ RFD+A+L ++ GV V PV CTKIAS+L RT+T +HGL   
Sbjct: 66  -PNLARLMADPSITKLMHFARFDVAILQHSLGVTVAPVICTKIASKLVRTFTERHGLAQL 124

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLG+++SK QQ+SDW A +L+ EQ  YAASDV+HLHAL  +    L R GR DLA +
Sbjct: 125 CRELLGVDLSKQQQTSDWGAPELTPEQKAYAASDVLHLHALWTKLEVLLHREGRRDLAQA 184

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C +FL  RA LDLLG+E+ DIF+H
Sbjct: 185 CYDFLPTRARLDLLGYEDPDIFAH 208


>gi|103487824|ref|YP_617385.1| 3'-5' exonuclease [Sphingopyxis alaskensis RB2256]
 gi|98977901|gb|ABF54052.1| 3'-5' exonuclease [Sphingopyxis alaskensis RB2256]
          Length = 205

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 140/206 (67%), Gaps = 3/206 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           ++  HE D+P +       A+AVDTET+GL P RDRLC+VQ+S G G   ++R   G   
Sbjct: 2   SVYFHEEDLPEDVLG--PGAVAVDTETMGLNPLRDRLCLVQISDGSGDEHLVRFRPGSSY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +AP L  +L D +R K+FH+ RFDIA L    GV   PV+CTKIAS+L RTYT++HGLK+
Sbjct: 60  DAPVLKAILADPERLKLFHFARFDIAALQQALGVVTTPVYCTKIASKLVRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG  +SK QQSSDW A +LS+ Q  YAASDV  LHA++     +L R GR++LA 
Sbjct: 120 LVRELLGQEVSKQQQSSDWGAAELSEAQRDYAASDVRFLHAMKEILDARLAREGRTELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL GW  VDIF+HS
Sbjct: 180 ACFDFLPTRAALDLAGWPEVDIFAHS 205


>gi|88607131|ref|YP_505646.1| 3''-5'' exonuclease family protein [Anaplasma phagocytophilum HZ]
 gi|88598194|gb|ABD43664.1| 3''-5'' exonuclease family protein [Anaplasma phagocytophilum HZ]
          Length = 204

 Score =  211 bits (537), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 142/204 (69%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            + VH  D+P +      D +AVDTET+GL+ RRDR+C+VQLS G+G   +++   G  +
Sbjct: 2   AVFVHRNDLPHD--VDLGDMVAVDTETMGLVCRRDRVCLVQLSAGNGDAHLVKFD-GDYS 58

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ++ D    KIFH+ RFD+A + + FG+   P +CTKIASRL RTYTN HGLKD 
Sbjct: 59  APNLRKVISDPGVLKIFHFARFDVAAIRHGFGMWATPCYCTKIASRLVRTYTNHHGLKDL 118

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             ELLG+ I+KAQQSSDW  + L+ EQL YAA+DV++LHA++ +    L+R  + +LA +
Sbjct: 119 CYELLGVKINKAQQSSDWGREVLTAEQLSYAAADVIYLHAIKKKLDMMLEREEKQELAEA 178

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  F+  RAELDLLGW+ VDIFSH
Sbjct: 179 CFKFVPVRAELDLLGWDGVDIFSH 202


>gi|254487503|ref|ZP_05100708.1| ribonuclease D [Roseobacter sp. GAI101]
 gi|214044372|gb|EEB85010.1| ribonuclease D [Roseobacter sp. GAI101]
          Length = 204

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 130/184 (70%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+D ET+GL P RDRLC+VQLS GDG   +++I  GQ  APNL  +L D +  K+FH+G
Sbjct: 20  VAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQIGKGQTEAPNLCALLEDPEVLKLFHFG 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFDIA +   FG +  PV+CTKIASRL RT+T++HGL    +ELLG +ISK QQSSDW A
Sbjct: 80  RFDIAAMQNAFGAKTAPVYCTKIASRLVRTFTDRHGLAKLCQELLGTDISKQQQSSDWGA 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
             L+  Q+ YAASDV++LH LR +    L R  R D+A +C +FL  RA+LDL GW + D
Sbjct: 140 AQLTQAQIDYAASDVLYLHQLRDKLNAMLIREDRMDIAQACFDFLPMRAQLDLAGWPDTD 199

Query: 203 IFSH 206
           IF+H
Sbjct: 200 IFAH 203


>gi|83944937|ref|ZP_00957303.1| Ribonuclease D [Oceanicaulis alexandrii HTCC2633]
 gi|83851719|gb|EAP89574.1| Ribonuclease D [Oceanicaulis alexandrii HTCC2633]
          Length = 204

 Score =  211 bits (536), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 105/207 (50%), Positives = 140/207 (67%), Gaps = 6/207 (2%)

Query: 3   TIRVHEGDIP--AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           TI  H GD+P   +   R    +A+DTET GL   RD LC+VQLS GDG   I++     
Sbjct: 2   TIHFHRGDLPDGLDLGKR----VAIDTETQGLSLVRDGLCLVQLSAGDGEAHIVQPDRAT 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            + PNL  +L D   EK+ H+ RFD+A++    GV + PVFCTKIAS+L RTYT++HGLK
Sbjct: 58  YDCPNLKALLADTGVEKLLHFARFDLAIIERDLGVTMTPVFCTKIASKLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +E+ G+ +SK QQSSDW+A DLS+ QL YAASDV++LHA+    T  L+R GR ++A
Sbjct: 118 DVCREIAGVELSKQQQSSDWAAQDLSEAQLNYAASDVLYLHAIADGLTAMLEREGRMEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LDL+GW+  DIF+HS
Sbjct: 178 RACFDFLPSRARLDLMGWDETDIFAHS 204


>gi|296537397|ref|ZP_06899246.1| 3''-5'' exonuclease [Roseomonas cervicalis ATCC 49957]
 gi|296262276|gb|EFH09052.1| 3''-5'' exonuclease [Roseomonas cervicalis ATCC 49957]
          Length = 217

 Score =  210 bits (535), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 110/208 (52%), Positives = 143/208 (68%), Gaps = 7/208 (3%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRIAAGQ 60
           I++H+ D+P      +   +A+DTET+GL PRRDRLC+VQLS GDG    V II  + G 
Sbjct: 12  IKLHKHDLPD--GIDFGPVVAIDTETMGLDPRRDRLCLVQLSAGDGNAHCVQIIPESLGG 69

Query: 61  KNA--PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           + A  PNL  +L      K+FH+ RFD+A+L    G+   PV CTKIA++L RT+T++HG
Sbjct: 70  RGADCPNLKALLTRPDVVKLFHFARFDVAILRAALGIECAPVRCTKIAAKLVRTFTDRHG 129

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           LKD  +ELLG+ ISK QQSSDW A +L+ EQL YAASDV+HLHAL  +    L+R GR +
Sbjct: 130 LKDLCRELLGVEISKQQQSSDWGAPELTPEQLAYAASDVLHLHALWAKLEGLLRREGRLE 189

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA SC  FL  R +LDLLG+E+ DIFSH
Sbjct: 190 LAESCFRFLPARGQLDLLGYEDPDIFSH 217


>gi|85375259|ref|YP_459321.1| ribonuclease D 3'-5' exonuclease [Erythrobacter litoralis HTCC2594]
 gi|84788342|gb|ABC64524.1| ribonuclease D 3'-5' exonuclease [Erythrobacter litoralis HTCC2594]
          Length = 206

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 142/206 (68%), Gaps = 4/206 (1%)

Query: 4   IRVHEGDIPAECAARYVDA-IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA-GQK 61
           +  HE D+PA   A   DA +AVDTET+GL+ RRDRLCIVQ+S G     ++R A     
Sbjct: 3   VHFHEEDLPAGVLAG--DAPLAVDTETMGLVTRRDRLCIVQISDGGEDEHLVRFAPDSDY 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  R K++H+ RFD+A + +  GV   PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 61  AAPNLKALLADTNRVKLYHFARFDLAAIEHYLGVTAAPVFCTKIASKLTRTYTDRHGLKN 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG N+SK QQSSDW   D+++ Q  YAASDV +LH +R     +L+R GR+++A 
Sbjct: 121 LVEELLGENLSKQQQSSDWGGADINEAQRDYAASDVRYLHRMREILITRLEREGRTEMAQ 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL GWE  DIF HS
Sbjct: 181 ACFDFLPTRARLDLAGWEEHDIFHHS 206


>gi|83591355|ref|YP_425107.1| 3'-5' exonuclease [Rhodospirillum rubrum ATCC 11170]
 gi|83574269|gb|ABC20820.1| 3'-5' exonuclease [Rhodospirillum rubrum ATCC 11170]
          Length = 206

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/204 (52%), Positives = 134/204 (65%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI  H GD+P+     +   IAVDTET+GL P RDRLC+VQLS GD    ++ +      
Sbjct: 6   TIHYHRGDLPS--GLTFPQGIAVDTETMGLNPHRDRLCVVQLSGGDNIAHVVHLNR-DLQ 62

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           AP L  +L D    KI H+GRFDIA + +  GV   PV+CTKIAS+L RT T+ HGLK  
Sbjct: 63  APVLASLLGDPSVLKIMHFGRFDIASIHHGLGVLCEPVYCTKIASKLCRTNTDSHGLKAL 122

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            K+LLG+++SK QQ+SDW A+ LS EQL YAASDV++LHAL+ +    L R GR+ LA  
Sbjct: 123 CKDLLGVDLSKHQQTSDWGAESLSPEQLTYAASDVLYLHALKARLDGLLAREGRTTLAEG 182

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  RA LDL GWE  DIFSH
Sbjct: 183 CFRFLPTRALLDLAGWEEPDIFSH 206


>gi|326403860|ref|YP_004283942.1| 3'-5' exonuclease [Acidiphilium multivorum AIU301]
 gi|325050722|dbj|BAJ81060.1| 3'-5' exonuclease [Acidiphilium multivorum AIU301]
          Length = 218

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 144/210 (68%), Gaps = 7/210 (3%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI---AA 58
            TI +H  D+P       V  +AVDTET+GL PRRDRLC+VQLS GD +  +++I   A 
Sbjct: 10  ATIHIHRHDLPDGLDLGPV--VAVDTETMGLDPRRDRLCLVQLSAGDNSAHLVQIVPPAL 67

Query: 59  GQKNA--PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
           G + A  PNL  +L      K+FH+ RFD+A+L++  GV   PV CTKIAS+L RTYT++
Sbjct: 68  GGRGADCPNLKRLLEHPGVTKLFHFARFDLAMLYHALGVTTAPVICTKIASKLVRTYTDR 127

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           HGLKD  ++L+GI ISK QQ+SDW + +LS EQ  YAASDV+HLHA+  +    L R GR
Sbjct: 128 HGLKDLCRDLVGIEISKQQQTSDWGSAELSPEQCAYAASDVLHLHAIWARLEALLVREGR 187

Query: 177 SDLATSCCNFLMDRAELDLLGWENVDIFSH 206
            +LA +C  FL  RA+LDLLG+E+ DIFSH
Sbjct: 188 RELADACYRFLPARAKLDLLGFEDPDIFSH 217


>gi|258541780|ref|YP_003187213.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256632858|dbj|BAH98833.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256635915|dbj|BAI01884.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-03]
 gi|256638970|dbj|BAI04932.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-07]
 gi|256642024|dbj|BAI07979.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-22]
 gi|256645079|dbj|BAI11027.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-26]
 gi|256648134|dbj|BAI14075.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-32]
 gi|256651187|dbj|BAI17121.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654178|dbj|BAI20105.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-12]
          Length = 217

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 142/208 (68%), Gaps = 7/208 (3%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRIAAGQ 60
           I +H  D+P      +  ++AVDTET+GL P RDRLC+VQLS GDGT   V II  + G 
Sbjct: 10  ITLHRNDLPDNVT--FTGSVAVDTETMGLNPHRDRLCLVQLSAGDGTAHLVQIIPTSLGG 67

Query: 61  K--NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           K  + PNL  +L D    KI H+ RFD+A+L +  G+ V PV CTKIA+RL RT+T++HG
Sbjct: 68  KGYDCPNLKRVLADPSITKIMHFARFDVAILQHALGITVSPVVCTKIAARLVRTFTDRHG 127

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           L    +++LG+ +SK QQ+SDW A +L  EQL YAASDV++LHAL  + +  L R GR +
Sbjct: 128 LAALCRDMLGVELSKQQQTSDWGAKELKPEQLAYAASDVLYLHALWDKMSALLDREGRRE 187

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA +C +FL  RA LDLLG+E+ DIFSH
Sbjct: 188 LAQACYDFLPARARLDLLGYEDPDIFSH 215


>gi|83313031|ref|YP_423295.1| ribonuclease D [Magnetospirillum magneticum AMB-1]
 gi|82947872|dbj|BAE52736.1| Ribonuclease D [Magnetospirillum magneticum AMB-1]
          Length = 203

 Score =  207 bits (526), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 106/204 (51%), Positives = 137/204 (67%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+  H+ D+P        + +A+D+ET+GL  +RDRLC+VQLS GDG   ++     + N
Sbjct: 2   TVFYHKNDLPD--GLDLGNLVAIDSETMGLNLQRDRLCVVQLSAGDGHAHVVHYPKPEWN 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           +PNLV ML D K  K+FH+ RFD+A++    GVR  PVFCTKIAS+LTRT T  H LK  
Sbjct: 60  SPNLVRMLADSKVTKLFHFARFDVAMIRRYLGVRCTPVFCTKIASKLTRTNTEGHSLKVL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            KE L I++SK QQSSDW A +L+ +QL YAASDV++LH L+ +    L R GR  LA +
Sbjct: 120 CKEFLNIDLSKLQQSSDWGAPELTADQLAYAASDVLYLHQLKDRLDALLDREGRRALAEA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL DRAELDL GW+  DIFSH
Sbjct: 180 CFAFLPDRAELDLAGWDAEDIFSH 203


>gi|148260666|ref|YP_001234793.1| 3'-5' exonuclease [Acidiphilium cryptum JF-5]
 gi|146402347|gb|ABQ30874.1| 3'-5' exonuclease [Acidiphilium cryptum JF-5]
          Length = 218

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 143/210 (68%), Gaps = 7/210 (3%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI---AA 58
            TI +H  D+P       V  +AVDTET+GL PRRDRLC+VQLS GD +  +++I   A 
Sbjct: 10  ATIHIHRHDLPDGLDLGPV--VAVDTETMGLDPRRDRLCLVQLSAGDNSAHLVQIVPPAL 67

Query: 59  GQKNA--PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
           G + A  PNL  +L      K+FH+ RFD+A+L +  GV   PV CTKIAS+L RTYT++
Sbjct: 68  GGRGADCPNLKRLLEHPGVTKLFHFARFDLAMLHHALGVTTAPVICTKIASKLVRTYTDR 127

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           HGLKD  ++L+GI ISK QQ+SDW + +LS EQ  YAASDV+HLHA+  +    L R GR
Sbjct: 128 HGLKDLCRDLVGIEISKQQQTSDWGSAELSPEQCAYAASDVLHLHAIWARLEALLVREGR 187

Query: 177 SDLATSCCNFLMDRAELDLLGWENVDIFSH 206
            +LA +C  FL  RA+LDLLG+E+ DIFSH
Sbjct: 188 RELADACYRFLPARAKLDLLGFEDPDIFSH 217


>gi|114797270|ref|YP_758935.1| putative exonuclease [Hyphomonas neptunium ATCC 15444]
 gi|114737444|gb|ABI75569.1| putative exonuclease [Hyphomonas neptunium ATCC 15444]
          Length = 204

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 142/207 (68%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  I +H+GD+P   +   V  IAVDTE +GL   RD L +VQ+S GDGT  ++++    
Sbjct: 1   MNQITLHKGDLPEGLSLGPV--IAVDTEAMGLNAMRDNLTLVQVSSGDGTAHLVQLTR-D 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            + PNL  +L D K  KIFH+ RFD+ ++    G+   P++CTKIASRL RTYT++HGLK
Sbjct: 58  YDCPNLKALLTDPKVLKIFHFARFDVVMMKRWMGITCAPIWCTKIASRLARTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +E+ G+++SKAQQSSDW  D L+D Q+QYAASDV++LH ++      L+R GR +LA
Sbjct: 118 DVAREVAGVDMSKAQQSSDWGQDKLTDAQIQYAASDVLYLHQIKAGLEAMLEREGRLELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW + DIF+HS
Sbjct: 178 QACFDFLPIRADLDLAGWPDEDIFAHS 204


>gi|329114438|ref|ZP_08243200.1| Ribonuclease D [Acetobacter pomorum DM001]
 gi|326696514|gb|EGE48193.1| Ribonuclease D [Acetobacter pomorum DM001]
          Length = 256

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/208 (50%), Positives = 142/208 (68%), Gaps = 7/208 (3%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRIAAGQ 60
           I +H  D+P      +  ++AVDTET+GL P RDRLC+VQLS GDGT   V II  + G 
Sbjct: 49  ITLHRNDLPDNVT--FTGSVAVDTETMGLNPHRDRLCLVQLSAGDGTAHLVQIIPTSLGG 106

Query: 61  K--NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           K  + PNL  ++ D    KI H+ RFD+A+L +  G+ V PV CTKIA+RL RT+T++HG
Sbjct: 107 KGYDCPNLKRVMADPSITKIMHFARFDVAILQHALGITVSPVVCTKIAARLVRTFTDRHG 166

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           L    +++LG+ +SK QQ+SDW A +L  EQL YAASDV++LHAL  + +  L R GR +
Sbjct: 167 LAALCRDMLGVELSKQQQTSDWGALELKPEQLAYAASDVLYLHALWDKMSALLDREGRRE 226

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA +C +FL  RA LDLLG+E+ DIFSH
Sbjct: 227 LAQACYDFLPARARLDLLGYEDPDIFSH 254


>gi|46201483|ref|ZP_00054962.2| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 203

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 137/204 (67%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+  H+ D+P        + +A+D+ET+GL  +RDRLC+VQLS GDG   ++     + N
Sbjct: 2   TVFYHKNDLPD--GLDLGNLVAIDSETMGLNLQRDRLCVVQLSAGDGHAHVVHYPKPEWN 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           +PNLV ML D K  K+FH+ RFD+A++    GVR  P+FCTKIAS+LTRT T  H LK  
Sbjct: 60  SPNLVRMLADPKVTKLFHFARFDVAMIRKYLGVRCNPLFCTKIASKLTRTNTEGHSLKVL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            KE L I++SK QQSSDW A +L+ +QL YAASDV++LH L+ +    L R GR  LA +
Sbjct: 120 CKEFLNIDLSKLQQSSDWGAPELNADQLAYAASDVLYLHQLKDRLDMLLDREGRRALAEA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL DRAELDL GW+  DIFSH
Sbjct: 180 CFAFLPDRAELDLAGWDAEDIFSH 203


>gi|149185091|ref|ZP_01863408.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. SD-21]
 gi|148831202|gb|EDL49636.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. SD-21]
          Length = 207

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 143/206 (69%), Gaps = 3/206 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA-GQK 61
            +  HE D+P +  A     +AVDTET+GL+  RDRLC+VQ+S G+G   ++R       
Sbjct: 2   AVHFHEEDLPEDVLAD--GPVAVDTETMGLVTIRDRLCVVQISDGNGDEHLVRFGPDSDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D +R K+FH+ RFD+A + Y  GV   P +CTKIAS++ RT+T++HGLK+
Sbjct: 60  DAPNLKAVLGDPERLKLFHFARFDLAAIEYYLGVTAAPCYCTKIASKMVRTFTDRHGLKN 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG ++SKAQQSSDW    L+D Q  YAASDV  LH ++ +   +L+R GR++LA 
Sbjct: 120 LVEELLGESMSKAQQSSDWGGPVLNDAQRDYAASDVRFLHRMKEELDRRLEREGRTELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LD+LGW++ DIFSH+
Sbjct: 180 ACFDFLPARAHLDILGWDDHDIFSHA 205


>gi|91205563|ref|YP_537918.1| ribonuclease D [Rickettsia bellii RML369-C]
 gi|157827279|ref|YP_001496343.1| ribonuclease D [Rickettsia bellii OSU 85-389]
 gi|91069107|gb|ABE04829.1| Ribonuclease D [Rickettsia bellii RML369-C]
 gi|157802583|gb|ABV79306.1| Ribonuclease D [Rickettsia bellii OSU 85-389]
          Length = 203

 Score =  200 bits (509), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 135/204 (66%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI +++ D+P +        +A+DTET+GL   RD+LC++Q S G+G   ++       N
Sbjct: 2   TITLYQNDLPDDFELE--GDLAIDTETMGLNLYRDKLCLLQFSNGNGDAHLVHFLNQNYN 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D++R KIFH+ RFD+A +    G+ +  +FCTKI+S+L RTYT  HGLKD 
Sbjct: 60  APNLKNLLSDKERCKIFHFARFDLAAIKKYLGIDLENIFCTKISSKLVRTYTESHGLKDI 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELLG+NISK QQSS W AD+LS +Q +YAA DV++LH LR    E L +  R +LA  
Sbjct: 120 CRELLGVNISKQQQSSYWGADNLSSDQQEYAAKDVLYLHKLREHLIEMLVKENRFELAQD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  RA LDL+GW+ VDIF+H
Sbjct: 180 IFKFLPTRANLDLVGWDEVDIFTH 203


>gi|294084811|ref|YP_003551571.1| 3'- 5' exonuclease family protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664386|gb|ADE39487.1| 3'- 5' exonuclease family protein, putative [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 203

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/204 (47%), Positives = 141/204 (69%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            + +++ D+PA+     +  +A+DTET+GL  +RDRLC+VQLS GDG   +++IA   K 
Sbjct: 2   AVNIYKDDLPADIDLGSI--VAIDTETMGLKTQRDRLCLVQLSSGDGNAHLVQIAQPAKP 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           +P L  +L D    K+FH+ RFD+A L +  G     ++CTKIAS+L RTYT++HGLK+ 
Sbjct: 60  SPVLAALLADPAVTKLFHFARFDLAALIHYIGAVEGDIYCTKIASKLARTYTDRHGLKEL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL I+ISK QQSSDW A+ L+ +Q  YAA DV++LHA+R + +  L+R  R  LA +
Sbjct: 120 CRELLQIDISKQQQSSDWGAETLTIDQQNYAAGDVLYLHAIREKLSYMLERENRMALANA 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL +RA+LDL+G+ +VDIF H
Sbjct: 180 CFGFLPERAQLDLIGFGDVDIFHH 203


>gi|42520711|ref|NP_966626.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410451|gb|AAS14560.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 206

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 134/203 (66%), Gaps = 1/203 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +++ D+PA      + +IAVDTE +GL+  RDRLC+VQLS  DG   ++++      A
Sbjct: 3   IFLYKDDLPASSIPDDIRSIAVDTEAMGLLHSRDRLCLVQLSFNDGNAHLVQLK-NDYTA 61

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+  
Sbjct: 62  PNLRKILEDKNITKIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKELC 121

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELL   ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA  C
Sbjct: 122 LELLDTKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQKC 181

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  R ELDL+GWENVDIF+H
Sbjct: 182 FEFLPTRIELDLMGWENVDIFNH 204


>gi|225630598|ref|YP_002727389.1| 3'-5' exonuclease [Wolbachia sp. wRi]
 gi|225592579|gb|ACN95598.1| 3'-5' exonuclease [Wolbachia sp. wRi]
          Length = 206

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/203 (47%), Positives = 134/203 (66%), Gaps = 1/203 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +++ D+PA      V +IAVDTE +GL+  RDRLC+VQLS  DG   ++++      A
Sbjct: 3   IFLYKDDLPASSIPDDVRSIAVDTEAMGLLHGRDRLCLVQLSFNDGNAHLVQLK-NDYTA 61

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+  
Sbjct: 62  PNLRKILEDKNITKIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKELC 121

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELL   ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA  C
Sbjct: 122 LELLDTKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQKC 181

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  R ELDL+GWENVDIF+H
Sbjct: 182 FEFLPTRIELDLMGWENVDIFNH 204


>gi|58698542|ref|ZP_00373443.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58534924|gb|EAL59022.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila ananassae]
          Length = 234

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/203 (47%), Positives = 134/203 (66%), Gaps = 1/203 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +++ D+PA      V +IAVDTE +GL+  RDRLC+VQLS  DG   ++++      A
Sbjct: 31  IFLYKDDLPASSIPDDVRSIAVDTEAMGLLHGRDRLCLVQLSFNDGNAHLVQLK-NDYTA 89

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+  
Sbjct: 90  PNLRKILEDKNITKIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKELC 149

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELL   ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA  C
Sbjct: 150 LELLDTKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQKC 209

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  R ELDL+GWENVDIF+H
Sbjct: 210 FEFLPTRIELDLMGWENVDIFNH 232


>gi|117923642|ref|YP_864259.1| 3'-5' exonuclease [Magnetococcus sp. MC-1]
 gi|117607398|gb|ABK42853.1| 3'-5' exonuclease [Magnetococcus sp. MC-1]
          Length = 213

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 132/207 (63%), Gaps = 4/207 (1%)

Query: 3   TIRVHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           TI     D+      RY+ +  +AVDTET+GL   RDRLC+VQ+    G V +++I   Q
Sbjct: 7   TIHTFIDDLDEAQFQRYMKSPFLAVDTETMGLDINRDRLCVVQMCDVTGEVSVVQIRNYQ 66

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             AP L  ++   + EKIFH+ RFD+A +     + ++PVFCTKIAS+L RTYT  HGLK
Sbjct: 67  --APRLKALMEAPEVEKIFHFARFDLATMKRWLDIEIKPVFCTKIASKLVRTYTGSHGLK 124

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +ELLG+ + K QQSSDW A+ L+ EQLQYAASDV+HL  +R +  E L R GR  LA
Sbjct: 125 DVSQELLGVVMDKQQQSSDWGAEQLTPEQLQYAASDVIHLVEIRARLVEMLAREGRLQLA 184

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
                FL  R  LDLLGW N DIFSH+
Sbjct: 185 DEIMRFLPTRVALDLLGWNNHDIFSHA 211


>gi|58584866|ref|YP_198439.1| ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58419182|gb|AAW71197.1| Ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 206

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 134/203 (66%), Gaps = 1/203 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I V++ D+PA      V +IAVDTE +GL+  RDRLC++QLS  DG   +I+       A
Sbjct: 3   IFVYKDDLPASSIPDNVRSIAVDTEAMGLLHVRDRLCLIQLSFNDGNAHLIQFK-NDYAA 61

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+  
Sbjct: 62  PNLRKILGDKNITKIFHFARFDVSIICYYLETWALPCYCTKIASRLVRTYTDNHSLKELC 121

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELL   ++K QQSSDW +++L+D+Q  YAASDV++LH ++ +    L+R  R +LA  C
Sbjct: 122 LELLDTKLNKQQQSSDWGSENLTDKQKSYAASDVLYLHKIKEKLDLMLERENRKELAQKC 181

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  R ELDL+GWE++DIF+H
Sbjct: 182 FEFLPIRVELDLMGWEDMDIFNH 204


>gi|126660170|ref|ZP_01731288.1| 3'-5' exonuclease [Cyanothece sp. CCY0110]
 gi|126618535|gb|EAZ89286.1| 3'-5' exonuclease [Cyanothece sp. CCY0110]
          Length = 214

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 136/208 (65%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +V + D+ +E   RY+  DAIA+DTET+GL+P+RDRLC+VQL    G V  IRI   
Sbjct: 9   NNFQVCDRDLTSETLDRYLQTDAIAIDTETMGLIPQRDRLCLVQLCDSSGYVTAIRIEKE 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           QK APNL  +L ++   KIFHY RFD+A   Y FG+   P+FCTK+AS+L RTYT  HGL
Sbjct: 69  QKEAPNLKKLLENQSIVKIFHYARFDVAQFKYNFGIDTAPIFCTKVASKLARTYTGSHGL 128

Query: 120 KDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K  ++E+ G+ + K+ QSSDW ++ +LS+ QL YAA+DV +L  LR Q    LQR  R +
Sbjct: 129 KALVQEIEGVELDKSSQSSDWGNSQNLSEAQLSYAANDVRYLIPLREQLITMLQREERWE 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           +A  C N +    ELDL+ ++  DIF H
Sbjct: 189 IAQKCMNVISVFVELDLMYYK--DIFEH 214


>gi|190571105|ref|YP_001975463.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|213019628|ref|ZP_03335434.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
 gi|190357377|emb|CAQ54811.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|212995050|gb|EEB55692.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
          Length = 206

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 132/203 (65%), Gaps = 1/203 (0%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +++ D+PA      + +IAVDTE +GL+  RDRLC+VQLS  DG   +++       A
Sbjct: 3   IFIYKDDLPASAIPNDIKSIAVDTEAMGLLHSRDRLCLVQLSFNDGNAHLVQFK-NDYTA 61

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+  
Sbjct: 62  PNLRKILEDKNITKIFHFARFDVSIIHYYLQTWALPCYCTKIASRLVRTYTDNHSLKELC 121

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELL I ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA  C
Sbjct: 122 LELLDIKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHKIKEKLDLMLERENRKELAEKC 181

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  R ELD +GW +VDIF+H
Sbjct: 182 FEFLPTRIELDSMGWGSVDIFNH 204


>gi|157825707|ref|YP_001493427.1| ribonuclease D [Rickettsia akari str. Hartford]
 gi|157799665|gb|ABV74919.1| Ribonuclease D [Rickettsia akari str. Hartford]
          Length = 203

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/204 (46%), Positives = 130/204 (63%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI++++ D+P          IA+DTET+GL   RD+LC++Q S G+G   ++        
Sbjct: 2   TIKIYQNDLPDNFELE--GDIAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFVNQDYT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNLKALLLDKTRCKIFHFARFDLASIKQYLSIDLENIFCTKISSKLVRTYTDNHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W  D+LS EQ +YAA DV++LH L+    + L R  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWGTDNLSSEQKEYAAKDVLYLHQLKDMLQKMLLRENRLELAHD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  RA LDL+GW  +DIF H
Sbjct: 180 IFRFLPTRANLDLIGWNEIDIFMH 203


>gi|157803820|ref|YP_001492369.1| ribonuclease D [Rickettsia canadensis str. McKiel]
 gi|157785083|gb|ABV73584.1| ribonuclease D [Rickettsia canadensis str. McKiel]
          Length = 203

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/204 (46%), Positives = 131/204 (64%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI++++ D+P     R    +A+DTET+GL   RD+LC++Q S G+G   ++        
Sbjct: 2   TIKIYQNDLPNN--FRLGGDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFENQNYT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNLKALLSDKSRCKIFHFARFDLAAIKKYLEIELENIFCTKISSKLVRTYTDSHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWRADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRFELAQD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              F+  RA LDLLGW  +DIF H
Sbjct: 180 IFRFVPTRANLDLLGWNEIDIFMH 203


>gi|86608835|ref|YP_477597.1| 3'-5' exonuclease family protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557377|gb|ABD02334.1| 3'-5' exonuclease family protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 210

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/185 (52%), Positives = 129/185 (69%), Gaps = 3/185 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTET+GL+P+RDRLC+VQ++   G V ++R++ G K AP L  +L+    EKIFHY 
Sbjct: 27  LAVDTETMGLIPQRDRLCVVQIANSAGEVVLLRLSRGVKQAPFLAQLLMAPSIEKIFHYA 86

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           RFD+A+L Y  G+R  PVFCTKIAS+L RTYT++HGLKD + EL G+ ++K  QSSDW A
Sbjct: 87  RFDLAMLRYHLGIRAWPVFCTKIASKLARTYTSKHGLKDVVSELCGVELNKTAQSSDWGA 146

Query: 143 -DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
              LS EQL+YAA+DV +L  +R +  E L+R  R +LA  C   L    ELDLLG+ NV
Sbjct: 147 VHALSAEQLEYAANDVRYLIPVRHKLAEMLRREERWELAQQCFQHLPTLVELDLLGFSNV 206

Query: 202 DIFSH 206
             F H
Sbjct: 207 --FEH 209


>gi|157964505|ref|YP_001499329.1| ribonuclease D [Rickettsia massiliae MTU5]
 gi|157844281|gb|ABV84782.1| Ribonuclease D [Rickettsia massiliae MTU5]
          Length = 203

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G   ++        
Sbjct: 2   TIKIYQNDLPNNFELE--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFTNQDYT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNLKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
             +FL  RA LDL+GW  +DIF +
Sbjct: 180 IFHFLPTRANLDLIGWNEIDIFMY 203


>gi|119513593|ref|ZP_01632605.1| 3'-5' exonuclease [Nodularia spumigena CCY9414]
 gi|119461746|gb|EAW42771.1| 3'-5' exonuclease [Nodularia spumigena CCY9414]
          Length = 189

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 131/187 (70%), Gaps = 3/187 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           DAIAVDTET+GL+P+RDRLC+VQL   +G V  IRIA GQ  APNL  ++      KIFH
Sbjct: 5   DAIAVDTETMGLLPQRDRLCLVQLCNPEGKVTAIRIAKGQTEAPNLKILMEAVNVVKIFH 64

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + RFDIA L +  G++V+PVFCTKIAS+L RTYTN+HGLK+ ++EL  I + K+ QSSDW
Sbjct: 65  FARFDIATLRHNLGIQVQPVFCTKIASKLARTYTNRHGLKEVVQELEHIELDKSSQSSDW 124

Query: 141 -SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWE 199
            +A +LS+ QL YAA+DV +L ++R +  E LQR  R ++A  C   L     LDLL ++
Sbjct: 125 GNAANLSEAQLNYAANDVRYLISVRQKLMEMLQREERWEIAQECFQVLPTLVTLDLLQFK 184

Query: 200 NVDIFSH 206
             D+F H
Sbjct: 185 --DLFEH 189


>gi|67459045|ref|YP_246669.1| ribonuclease D [Rickettsia felis URRWXCal2]
 gi|67004578|gb|AAY61504.1| Ribonuclease D [Rickettsia felis URRWXCal2]
          Length = 203

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 130/204 (63%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            I++++ D+P          IA+DTET+GL   RD+LC++Q S G+G   ++       +
Sbjct: 2   NIKIYQDDLPNNFELE--GDIAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFVNQDYS 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNLKALLLDKTRCKIFHFARFDLAAIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W  D+LS EQ +YAA DV++LH L+    + L R  R +LA  
Sbjct: 120 CRELLSINISKQQQSSYWGTDNLSSEQKEYAAKDVLYLHQLKDILQKMLLRENRLELAQD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  RA LDL+GW  +DIF H
Sbjct: 180 IFRFLPTRANLDLIGWNEIDIFMH 203


>gi|157828459|ref|YP_001494701.1| ribonuclease D [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933177|ref|YP_001649966.1| ribonuclease D [Rickettsia rickettsii str. Iowa]
 gi|157800940|gb|ABV76193.1| ribonuclease D [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908264|gb|ABY72560.1| ribonuclease D [Rickettsia rickettsii str. Iowa]
          Length = 203

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 131/204 (64%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G   ++        
Sbjct: 2   TIKIYQNDLPNNFTLE--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFTNQDYT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APN+  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNVKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  RA LDL+GW  +DIF H
Sbjct: 180 IFRFLPIRANLDLIGWNEIDIFMH 203


>gi|15892510|ref|NP_360224.1| ribonuclease D [Rickettsia conorii str. Malish 7]
 gi|34580497|ref|ZP_00141977.1| ribonuclease D [Rickettsia sibirica 246]
 gi|229586700|ref|YP_002845201.1| Ribonuclease D [Rickettsia africae ESF-5]
 gi|238650888|ref|YP_002916744.1| ribonuclease D [Rickettsia peacockii str. Rustic]
 gi|15619670|gb|AAL03125.1| ribonuclease D [Rickettsia conorii str. Malish 7]
 gi|28261882|gb|EAA25386.1| ribonuclease D [Rickettsia sibirica 246]
 gi|228021750|gb|ACP53458.1| Ribonuclease D [Rickettsia africae ESF-5]
 gi|238624986|gb|ACR47692.1| ribonuclease D [Rickettsia peacockii str. Rustic]
          Length = 203

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI++++ D+P     +    +A+DTET+GL   RD+LC++Q S G+G   ++        
Sbjct: 2   TIKIYQNDLPNN--FKLEGDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFTNQDYT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APN+  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNVKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  RA LDL+GW  +DIF H
Sbjct: 180 IFRFLPIRANLDLIGWNEIDIFMH 203


>gi|239947292|ref|ZP_04699045.1| ribonuclease D [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921568|gb|EER21592.1| ribonuclease D [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 203

 Score =  190 bits (483), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 129/204 (63%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G    +        
Sbjct: 2   TIKIYQNDLPNNFELE--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHFVHFTNQDYI 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGL D 
Sbjct: 60  APNLKALLLDKTRCKIFHFARFDLAFIKKYLSIDLENIFCTKISSKLVRTYTDSHGLNDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  RA LDLLGW  +DIF H
Sbjct: 180 IFRFLPTRANLDLLGWNEIDIFMH 203


>gi|186684292|ref|YP_001867488.1| 3'-5' exonuclease [Nostoc punctiforme PCC 73102]
 gi|186466744|gb|ACC82545.1| 3'-5' exonuclease [Nostoc punctiforme PCC 73102]
          Length = 209

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            +V + D+      +Y++  AIAVDTET+GL+P+RDRLC+VQL   +G V +IRIA GQ 
Sbjct: 6   FQVSDRDLSDAALGQYLESTAIAVDTETMGLLPQRDRLCLVQLCNLEGKVTVIRIAKGQT 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +       K+FH+ RFDIA L    G++V PVFCTKIAS+L RTYTN+HGLKD
Sbjct: 66  EAPNLKKLFEAANVVKVFHFARFDIATLRANLGIQVSPVFCTKIASKLARTYTNRHGLKD 125

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++EL  + + K+ QSSDW +A  LS+ QL YAA+DV +L +++ + TE L+R  R  +A
Sbjct: 126 VVQELEKVELDKSSQSSDWGNAVSLSEAQLSYAANDVRYLLSVQQKLTEMLKREERWKIA 185

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C  FL     LDLL ++  D+F H
Sbjct: 186 QECFEFLPTIVSLDLLQFK--DLFEH 209


>gi|86605802|ref|YP_474565.1| 3'-5' exonuclease family protein [Synechococcus sp. JA-3-3Ab]
 gi|86554344|gb|ABC99302.1| 3'-5' exonuclease family protein [Synechococcus sp. JA-3-3Ab]
          Length = 210

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/186 (51%), Positives = 129/186 (69%), Gaps = 3/186 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTET+GL+P+RDRLC+VQ++   G V ++R++ G K AP+L  +L D   EKIFHY 
Sbjct: 27  LAVDTETMGLIPQRDRLCVVQIANAAGEVVLLRLSRGVKQAPHLARLLTDPNIEKIFHYA 86

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW-S 141
           RFD+A+L Y  G++  PVFCTKIAS+L RTYT++H LKD + EL G+ ++K  QSSDW +
Sbjct: 87  RFDLAMLRYHLGIQAWPVFCTKIASKLARTYTSKHSLKDVVGELCGVELNKTAQSSDWGN 146

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
              LS EQL+YAA+DV +L  +R +  + LQR  R +LA  C   L    ELDLLG+ NV
Sbjct: 147 VQALSPEQLEYAANDVRYLIPVRHKLAQMLQREERWELAQRCFQHLPTLVELDLLGYGNV 206

Query: 202 DIFSHS 207
             F H 
Sbjct: 207 --FEHQ 210


>gi|51473610|ref|YP_067367.1| ribonuclease D [Rickettsia typhi str. Wilmington]
 gi|51459922|gb|AAU03885.1| ribonuclease D [Rickettsia typhi str. Wilmington]
          Length = 203

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 131/204 (64%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            I++++ D+P     +    IAVDTET+GL   RD+LC++Q S G+G   ++        
Sbjct: 2   NIKIYQNDLPNN--FKLEGDIAVDTETMGLNIHRDKLCLLQFSNGNGAAHLVHFINQDYT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNLKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W  D+LS EQ +YAA DV++LH L+    + L R  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWGTDNLSLEQKEYAAKDVLYLHQLKDILQKMLFRENRLELAHE 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  R  LDL+GW+ +DIF+H
Sbjct: 180 IFRFLPTRVNLDLIGWDQIDIFTH 203


>gi|58040278|ref|YP_192242.1| ribonuclease D [Gluconobacter oxydans 621H]
 gi|58002692|gb|AAW61586.1| Ribonuclease D [Gluconobacter oxydans 621H]
          Length = 214

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 139/210 (66%), Gaps = 7/210 (3%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI---AA 58
             I +++GD+P +     +  +A+DTET+GL P RDRLC+VQLS GDG   +++I   + 
Sbjct: 5   NAIHLYDGDLPDDFDLGPL--VAIDTETMGLNPHRDRLCLVQLSAGDGEAHLVQIKPVSM 62

Query: 59  GQK--NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
           G +  + PNL  +L D+   K+ H+ RFD+AVL   F + +  V CTKIA+RL  T+T++
Sbjct: 63  GGRGYDCPNLKALLTDDSVTKLMHFARFDVAVLQNAFNITIPSVICTKIAARLVYTFTDR 122

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           HGL    ++LLG+ ISK QQSSDW A  L+ +QL+YAASDV++LHAL  +    L R  R
Sbjct: 123 HGLAYLCRDLLGVEISKHQQSSDWGAQTLTPDQLRYAASDVLYLHALWDKLEAMLIRENR 182

Query: 177 SDLATSCCNFLMDRAELDLLGWENVDIFSH 206
            DLA +C +FL  R  LDL+G+E  DIFSH
Sbjct: 183 RDLAQACYDFLPARCRLDLMGYEEPDIFSH 212


>gi|282899306|ref|ZP_06307275.1| 3'-5' exonuclease [Cylindrospermopsis raciborskii CS-505]
 gi|281195763|gb|EFA70691.1| 3'-5' exonuclease [Cylindrospermopsis raciborskii CS-505]
          Length = 209

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 139/206 (67%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            +V +GD+     + Y+  DA+AVDTET+GL+P+RDRLC+VQL   +G V  +RIA GQ 
Sbjct: 6   FQVVDGDLDYPTLSEYLRSDALAVDTETMGLLPQRDRLCLVQLCNPEGKVTAVRIAKGQT 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L      K+FH+ RFD+A L +   + V+PVFCTKIAS+L RTYTN+HGLK+
Sbjct: 66  HAPNLQQLLESTDVVKVFHFARFDLATLRHNLKIHVQPVFCTKIASKLARTYTNRHGLKE 125

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++EL  + + K+ QSSDW +   LSD QL YAA+DV +L +L+ + ++ LQR  R  LA
Sbjct: 126 LVQELEQVELDKSSQSSDWGNPVSLSDAQLSYAANDVRYLLSLKQKLSQMLQREERWQLA 185

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C +FL     LDLL ++  ++F H
Sbjct: 186 QECFSFLPTLVSLDLLQFK--ELFEH 209


>gi|220907657|ref|YP_002482968.1| 3'-5' exonuclease [Cyanothece sp. PCC 7425]
 gi|219864268|gb|ACL44607.1| 3'-5' exonuclease [Cyanothece sp. PCC 7425]
          Length = 217

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 141/208 (67%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           T  +V++ D+PA+  + ++  D IAVDTET+GL P+RDRLC+VQL+   G + +IRI  G
Sbjct: 12  TDFQVYDRDLPADTLSYFLTADRIAVDTETMGLKPQRDRLCLVQLAHPQGLITVIRIGQG 71

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q++AP+L  +L      K+FH+ RFDI  L Y   + V+P+FCTKIAS+L RTY+ +HGL
Sbjct: 72  QRSAPHLKQLLEHPGTTKVFHFARFDITTLRYHLDIWVQPLFCTKIASKLARTYSPRHGL 131

Query: 120 KDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           KD ++EL G+ + K  QSSDW + ++L++EQL+YA++DV +L A + +  E LQR  R  
Sbjct: 132 KDLIRELEGVELDKTVQSSDWGNPNNLTEEQLRYASNDVRYLLAAQAKLVEMLQRENRWQ 191

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C + L   A LDLL +E   IF H
Sbjct: 192 LAQECFHCLPTLASLDLLEFEA--IFEH 217


>gi|254422868|ref|ZP_05036586.1| 3'-5' exonuclease, putative [Synechococcus sp. PCC 7335]
 gi|196190357|gb|EDX85321.1| 3'-5' exonuclease, putative [Synechococcus sp. PCC 7335]
          Length = 207

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 104/209 (49%), Positives = 136/209 (65%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M    V + D+  +   RY+  DAIAVDTET+GL P RDRLC++QL    G V  IR   
Sbjct: 1   MENFEVCDYDLTPQLLERYIQADAIAVDTETMGLNPLRDRLCLIQLCDPGGYVCAIRTER 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ +APNL  +L ++   KIFH+ RFD+A L +  G+   PVFCTKIAS++ RTY+  HG
Sbjct: 61  GQSSAPNLKQLLEEKNITKIFHFARFDLATLQHHLGIVTAPVFCTKIASKIARTYSPSHG 120

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  +KEL+GI + K+QQSSDW +A  LSDEQL YAA+DV +L+ L+ + TE L+R GR 
Sbjct: 121 LKSLVKELIGIELDKSQQSSDWGNAAALSDEQLSYAANDVRYLYVLQNKLTEMLKREGRW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C + L    ELDL  + +V  F H
Sbjct: 181 TLAKQCLDCLPVFVELDLRQFGSV--FEH 207


>gi|282897776|ref|ZP_06305775.1| 3'-5' exonuclease [Raphidiopsis brookii D9]
 gi|281197455|gb|EFA72352.1| 3'-5' exonuclease [Raphidiopsis brookii D9]
          Length = 209

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 138/206 (66%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            +V +GD+     + Y+  DA+AVDTET+GL+P+RDRLC+VQL   +G V  +RIA GQ 
Sbjct: 6   FQVLDGDLDHPTLSEYLRSDALAVDTETMGLVPQRDRLCLVQLCNPEGKVTAVRIAKGQT 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L      K+FH+ RFD+A L +   + V+PVFCTKIAS+L RTYTN+HGLK+
Sbjct: 66  HAPNLQQLLESTHVVKVFHFARFDLATLRHNLKIYVQPVFCTKIASKLARTYTNRHGLKE 125

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++EL  + + K+ QSSDW +   LSD QL YAA+DV +L +L+ + ++ LQR  R  L 
Sbjct: 126 LVQELEQLELDKSSQSSDWGNPVSLSDAQLSYAANDVRYLLSLKQKLSQMLQREERWQLV 185

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C +FL     LDLL ++  D+F H
Sbjct: 186 QECFSFLPTLVSLDLLQFK--DLFEH 209


>gi|15604287|ref|NP_220803.1| hypothetical protein RP422 [Rickettsia prowazekii str. Madrid E]
 gi|3860979|emb|CAA14879.1| unknown [Rickettsia prowazekii]
 gi|292572036|gb|ADE29951.1| Ribonuclease D [Rickettsia prowazekii Rp22]
          Length = 203

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 130/204 (63%), Gaps = 2/204 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            I++++ D+P+    +    IAVDTET+GL   RD+LC++Q S G+G   ++        
Sbjct: 2   NIKIYQNDLPSN--FKLEGDIAVDTETMGLNIHRDKLCLLQFSNGNGEAHLVHFINQDYT 59

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD 
Sbjct: 60  APNLKMLLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKDL 119

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +ELL INISK QQSS W  D LS EQ +YAA DV++LH L+    + L R  R +LA  
Sbjct: 120 CRELLNINISKQQQSSYWGTDHLSLEQKEYAAKDVLYLHQLKDILQKMLLRENRLELAHD 179

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
              FL  R  LDL+GW+ +DIF H
Sbjct: 180 IFRFLPTRVHLDLIGWDQIDIFMH 203


>gi|298491354|ref|YP_003721531.1| 3'-5' exonuclease ['Nostoc azollae' 0708]
 gi|298233272|gb|ADI64408.1| 3'-5' exonuclease ['Nostoc azollae' 0708]
          Length = 209

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            +V + D+ A   + Y+  +AIAVDTET+GL+P+RDRLC+VQL    G V  I IA GQ 
Sbjct: 6   FQVSDRDLDAASLSEYLQSEAIAVDTETMGLLPQRDRLCLVQLCNSQGKVTAICIAKGQT 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L      K+FH+ RFD+A L +   ++V+PVFCTKIAS+L RTYTN HGLKD
Sbjct: 66  EAPNLKQLLEATHILKVFHFARFDVATLRHNLEIQVQPVFCTKIASKLARTYTNLHGLKD 125

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++EL  + + K+ QSSDW +A +LS+ QL YAA+DV +L  ++ + T+ L+R GR +LA
Sbjct: 126 VVQELEQVELDKSAQSSDWGNAVNLSETQLSYAANDVRYLLNVQQKLTQMLEREGRWELA 185

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C   L     LDLL ++  D+F H
Sbjct: 186 QQCFQVLPTLVSLDLLQFK--DLFEH 209


>gi|67921652|ref|ZP_00515170.1| 3'-5' exonuclease [Crocosphaera watsonii WH 8501]
 gi|67856764|gb|EAM52005.1| 3'-5' exonuclease [Crocosphaera watsonii WH 8501]
          Length = 214

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 97/208 (46%), Positives = 133/208 (63%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +V + D+ +E   RY+  DA+A+DTET+GL+P+RDRLC+VQL    G V  IRI  G
Sbjct: 9   NNFQVCDRDLSSETLERYLKADALAIDTETMGLVPQRDRLCLVQLCDPSGYVTAIRIERG 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q  APNL  +L ++   KIFHY RFD+    Y F V   P+FCTK+AS+L RTYT  HGL
Sbjct: 69  QTEAPNLKQLLENKNIVKIFHYARFDVGQFKYNFSVETDPIFCTKVASKLARTYTGSHGL 128

Query: 120 KDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K  ++EL G+ + K+ QSSDW ++ +LS+ QL YAA+DV +L  LR Q    L+R  R +
Sbjct: 129 KSLVQELEGVELDKSSQSSDWGNSQNLSEAQLSYAANDVRYLIQLREQLITMLKREERWE 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           +A  C   +    ELDL+ ++  DIF H
Sbjct: 189 IAQKCMKVIPLFVELDLMYYK--DIFDH 214


>gi|307151178|ref|YP_003886562.1| 3'-5' exonuclease [Cyanothece sp. PCC 7822]
 gi|306981406|gb|ADN13287.1| 3'-5' exonuclease [Cyanothece sp. PCC 7822]
          Length = 209

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/209 (48%), Positives = 133/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V EGD+  +  A+Y+  +AIAVDTET+GL+P RDRLC+VQL    G V  IRIA 
Sbjct: 3   LDNFQVLEGDLSDDILAQYLQAEAIAVDTETMGLIPHRDRLCLVQLCDPTGYVTAIRIAK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQK AP L  ++ +    K+FH+ RFD+A L +  G+   P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQKEAPKLKQLMENNHSIKVFHFARFDVAQLRHHLGIETTPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  + EL GI + K  QSSDW +A +LS+EQL YAA+DV +L  L+ +    LQR  R 
Sbjct: 123 LKSLVLELEGIELDKTAQSSDWGNAANLSEEQLSYAANDVRYLLGLKQKLITMLQREDRW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDLL + NV  F H
Sbjct: 183 QLAQDCFQCLPVIVSLDLLLYPNV--FEH 209


>gi|218440719|ref|YP_002379048.1| 3'-5' exonuclease [Cyanothece sp. PCC 7424]
 gi|218173447|gb|ACK72180.1| 3'-5' exonuclease [Cyanothece sp. PCC 7424]
          Length = 209

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 133/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  E  +RY+  DAIAVDTET+GL P RDRLC++QL   +G V  IR+  
Sbjct: 3   LDNFKVLQEDLSDEILSRYLKADAIAVDTETMGLNPHRDRLCLIQLCDPEGYVTAIRVTK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ AP L  ++      K+FH+ RFD+A L + FG+   P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQQEAPKLKQLMEASNITKVFHFARFDVAQLRHHFGIETTPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  + EL G+ + K  QSSDW +AD LS+EQL YAA+DV +L  ++ +    L R  R 
Sbjct: 123 LKSLVLELEGVELDKTAQSSDWGNADKLSEEQLSYAANDVRYLLGVKEKLISMLNRENRM 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA +C N L     LDL  ++N  IF H
Sbjct: 183 ELARNCFNCLPVLVSLDLQFYQN--IFEH 209


>gi|172035932|ref|YP_001802433.1| ribonuclease D [Cyanothece sp. ATCC 51142]
 gi|171697386|gb|ACB50367.1| ribonuclease D [Cyanothece sp. ATCC 51142]
          Length = 214

 Score =  184 bits (466), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 132/206 (64%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            +V + D+  E   RY+ A  IA+DTET+GL+P+RDRLC+VQL    G V  IRI  GQ+
Sbjct: 11  FQVCDRDLSPETLDRYLQAKAIAIDTETMGLIPQRDRLCLVQLCDPSGYVTAIRIEKGQQ 70

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            A NL  +L ++   KIFHY RFD+A   Y F +   P+FCTK+AS+L RTYT  HGLK 
Sbjct: 71  TAENLKQLLENQNIIKIFHYARFDVAQFKYNFAIETEPIFCTKVASKLARTYTGSHGLKA 130

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++E+ G+ + K+ QSSDW ++ +LS+ QL YAA+DV +L  L+ Q    LQR  R +LA
Sbjct: 131 LVQEIEGVELDKSSQSSDWGNSQNLSEAQLSYAANDVRYLIPLKEQLITMLQREERWELA 190

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C   +    ELDL+ ++  DIF H
Sbjct: 191 QKCMKVIPLFVELDLMYYK--DIFEH 214


>gi|166365344|ref|YP_001657617.1| ribonuclease D [Microcystis aeruginosa NIES-843]
 gi|166087717|dbj|BAG02425.1| probable ribonuclease D [Microcystis aeruginosa NIES-843]
          Length = 209

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 139/209 (66%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  +  +RY  V++IAVDTET+GL+P RDRLC++QL    G V  IR+  
Sbjct: 3   LDNFQVCDRDLSDDLLSRYLGVNSIAVDTETMGLIPGRDRLCLIQLCDPSGFVTAIRVFR 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  ++ DE+ EK+FH+ RFD+A L  TFG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQTEAPNLKKVMEDERIEKVFHFARFDVAQLSQTFGIATKPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW +A +L+ +QL YAA+DV +L ++R +    LQR  R 
Sbjct: 123 LKSLVQELEGIELDKTAQSSDWGNAANLTPQQLSYAANDVRYLLSVRDKLIVMLQREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C + +     LDL  ++  DIF H
Sbjct: 183 ELAQKCFSCIPIFTALDLQQYK--DIFEH 209


>gi|300867874|ref|ZP_07112515.1| 3'-5' exonuclease [Oscillatoria sp. PCC 6506]
 gi|300334110|emb|CBN57691.1| 3'-5' exonuclease [Oscillatoria sp. PCC 6506]
          Length = 210

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/209 (47%), Positives = 135/209 (64%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           MT   V + D+P    + Y+  +AIA DTET+GL+P RDRLC+VQL   +G V ++RIA 
Sbjct: 1   MTDFNVCDRDLPDTLLSHYLTAEAIAADTETMGLLPWRDRLCLVQLCDAEGIVTVVRIAK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  ++      KIFH+ RFD+A L Y   + V PVFC+KIAS+L RTYT +HG
Sbjct: 61  GQREAPNLKKLMEASNIVKIFHFARFDMATLKYHLDIHVAPVFCSKIASKLARTYTGKHG 120

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD ++EL  + + K  QSSDW +A +LS++QL+YAA+DV +L + R +    LQR  R 
Sbjct: 121 LKDLVQELEQVELDKTAQSSDWGNAANLSEKQLRYAANDVRYLISAREKLITMLQREDRW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDLL ++  DIF H
Sbjct: 181 QLAQECFQCLPVIVSLDLLQFK--DIFDH 207


>gi|330813574|ref|YP_004357813.1| ribonuclease D related protein [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486669|gb|AEA81074.1| ribonuclease D related protein [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 205

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 131/205 (63%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPR-RDRLCIVQLSPGDGTVDIIRIAAGQK 61
            I +++ D+P         ++A+D E+LGL  + RD+LC++QL  GD  V I++      
Sbjct: 2   NITLYQNDLPENHKLTNAQSVAIDAESLGLNYKGRDKLCLLQLCSGDDEVYIVQFDRNNY 61

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            +PNL  +L D    KI H+ RF++ +L Y    ++  ++CTKIAS+L RTYT++HGL D
Sbjct: 62  KSPNLCKILNDNNILKIAHFARFEMGILKYYLNAKIENIYCTKIASKLGRTYTDKHGLYD 121

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             KELL I ++K+QQSSDW   DLS+EQ QYAA DV++LH L+ +    L+R  R  LA 
Sbjct: 122 ITKELLNITLNKSQQSSDWGLKDLSEEQKQYAALDVLYLHKLKEKLDLMLRREKRDQLAK 181

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C +FL  R+ELDL GW+  DIFSH
Sbjct: 182 YCFDFLSTRSELDLNGWDE-DIFSH 205


>gi|113475312|ref|YP_721373.1| 3'-5' exonuclease [Trichodesmium erythraeum IMS101]
 gi|110166360|gb|ABG50900.1| 3'-5' exonuclease [Trichodesmium erythraeum IMS101]
          Length = 207

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 142/209 (67%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M+  +V + D+  +  + Y+  D++AVDTET+GL+PRRDRLC+VQL    G V  IRI  
Sbjct: 1   MSDFQVCDRDLTKDILSNYLQADSMAVDTETMGLLPRRDRLCLVQLCDPLGQVTAIRIHK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  ++      K+FH+ RFD+A+L +  G++V P+FCTKI+S+L RTYT +HG
Sbjct: 61  GQQEAPNLKQLMEANSIVKVFHFARFDVAMLQHYLGIKVSPIFCTKISSKLARTYTGKHG 120

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + EL  + + K+ QSSDW +A++L+++QL YAA+DV +L ++R + ++ L+R  R 
Sbjct: 121 LKDLVMELEKVELDKSSQSSDWGNAENLTEKQLNYAANDVRYLLSVREKLSKILKREERW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C   L     LDLL ++  DIF H
Sbjct: 181 ELAQQCFECLPVFVGLDLLQYK--DIFEH 207


>gi|159030499|emb|CAO91403.1| rnd [Microcystis aeruginosa PCC 7806]
          Length = 209

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 139/209 (66%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  +  +RY  V++IAVDTET+GL+P RDRLC++QL    G V  IRI  
Sbjct: 3   LDNFQVCDRDLSDDLLSRYLGVNSIAVDTETMGLIPGRDRLCLIQLCDPSGFVTAIRIFR 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  ++ DE+ EK+FH+ RFD+A L  TFG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQTEAPNLKKVMEDERIEKVFHFARFDVAQLSQTFGIATQPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW +A +L+ +QL YAA+DV +L ++R +    +QR  R 
Sbjct: 123 LKSLVQELEGIELDKTAQSSDWGNAVNLTPKQLSYAANDVRYLLSVRDKLIVMMQREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C + +     LDL  ++  DIF H
Sbjct: 183 ELAQKCFSCIPIFTALDLQQYK--DIFEH 209


>gi|114327365|ref|YP_744522.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
 gi|114315539|gb|ABI61599.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
          Length = 259

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 134/209 (64%), Gaps = 7/209 (3%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA---G 59
           TI +H  D+P       +  IA+DTET+GL   RDRLC++Q+S GDG   +++I     G
Sbjct: 53  TIHLHRHDLPPSLDIGPI--IAIDTETMGLNHHRDRLCLIQISAGDGHAHLVQIVPERLG 110

Query: 60  QKNA--PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
            K A  PNL  +L +    K+ HY RFD+ +L    G+ +  V CTKIA++L RT+T++H
Sbjct: 111 GKGADCPNLKRLLSNPGCVKLMHYARFDVGILQNALGIAMSNVKCTKIAAKLVRTFTDRH 170

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           GLKD  ++LLG+ ISK QQSSDW A +L+ EQ+ YAASDV++LHAL  +    L R  R 
Sbjct: 171 GLKDLCRDLLGVEISKQQQSSDWGAPELTPEQMAYAASDVLYLHALWNRLEGLLIREDRL 230

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA +C  FL  RA LD LG++  DIFSH
Sbjct: 231 ALAEACFAFLPARARLDYLGYDEPDIFSH 259


>gi|218245974|ref|YP_002371345.1| 3'-5' exonuclease [Cyanothece sp. PCC 8801]
 gi|218166452|gb|ACK65189.1| 3'-5' exonuclease [Cyanothece sp. PCC 8801]
          Length = 210

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 132/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  E  +RY+   AIAVDTET+GL+P+RDRLC+VQL    G V  IRI  
Sbjct: 4   LENFQVCDRDLSDETLSRYLAATAIAVDTETMGLIPQRDRLCLVQLCDPSGFVTAIRIER 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQK AP L  ++  +   K+FHY RFD+A L Y FG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 64  GQKEAPKLKQLMEAKTILKVFHYARFDVAQLRYHFGIETQPIFCTKIASKLARTYTSSHG 123

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW ++ +LS  QL YAA+DV +L   + +    LQR  R 
Sbjct: 124 LKSLVQELEGIELDKTSQSSDWGNSANLSVAQLSYAANDVRYLIPAKEKLITMLQREERW 183

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C N +     LDL  ++  DIF H
Sbjct: 184 QLAEQCFNCIPVFVSLDLEQYK--DIFEH 210


>gi|189184295|ref|YP_001938080.1| ribonuclease D [Orientia tsutsugamushi str. Ikeda]
 gi|189181066|dbj|BAG40846.1| ribonuclease D [Orientia tsutsugamushi str. Ikeda]
          Length = 210

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 124/191 (64%), Gaps = 7/191 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQL--SPGDGTVD-----IIRIAAGQKNAPNLVGMLVDEKR 75
           +A+DTET+GL   RDRLC++Q      D T+D     +++    Q N  NL  +L+D+ R
Sbjct: 20  LAIDTETMGLNLIRDRLCLLQFCQESKDDTIDDKEVFLVKFEDQQYNCRNLKKLLMDDGR 79

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KIFH+ RFD+A + Y  GV +  +FCT +AS+L RTYT+ HGLKD  +ELLGI ISK  
Sbjct: 80  TKIFHFARFDLAAIQYYLGVTLNNIFCTNVASKLVRTYTDSHGLKDLCRELLGIQISKQC 139

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           QSSDW    L+ +Q +YAA DVV+LH ++    E L R  R D+A     FL  RAELD+
Sbjct: 140 QSSDWGGQSLTSDQEEYAAKDVVYLHRIKNILEEMLIREQRLDIAQKIFKFLPARAELDV 199

Query: 196 LGWENVDIFSH 206
           +GW+++DI SH
Sbjct: 200 IGWQDIDILSH 210


>gi|17231283|ref|NP_487831.1| ribonuclease D [Nostoc sp. PCC 7120]
 gi|17132925|dbj|BAB75490.1| ribonuclease D [Nostoc sp. PCC 7120]
          Length = 209

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            +V + D+     A+Y+  +AIAVDTET+GL+P+RDRLC++QL   +G V  IRIA GQ 
Sbjct: 6   FQVGDRDLSDATVAQYLQSEAIAVDTETMGLLPQRDRLCLIQLCNPEGKVTAIRIAQGQT 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L      K+FH+ RFD+A L +   + V+P+FCTKIAS+L RTYTN+HGLKD
Sbjct: 66  AAPNLKKLLEATNVLKVFHFARFDVATLLHHLDIHVQPIFCTKIASKLARTYTNRHGLKD 125

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + EL  + + K+ Q SDW +A +L++ QL YAA+DV +L + + +    L+R  R +LA
Sbjct: 126 LVHELEQVELDKSAQGSDWGNAANLTEAQLSYAANDVRYLLSAQQKLVAMLKREERWELA 185

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C   L     LDLL ++  D+F H
Sbjct: 186 QQCFQVLPTIVSLDLLQFK--DLFEH 209


>gi|257059023|ref|YP_003136911.1| 3'-5' exonuclease [Cyanothece sp. PCC 8802]
 gi|256589189|gb|ACV00076.1| 3'-5' exonuclease [Cyanothece sp. PCC 8802]
          Length = 210

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 132/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  +  +RY+   AIAVDTET+GL+P+RDRLC+VQL    G V  IRI  
Sbjct: 4   LENFQVCDRDLSDQTLSRYLAATAIAVDTETMGLIPQRDRLCLVQLCDPSGFVTAIRIER 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQK AP L  ++  +   K+FHY RFD+A L Y FG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 64  GQKEAPKLKQLMEAKTILKVFHYARFDVAQLRYHFGIETQPIFCTKIASKLARTYTSSHG 123

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW ++ +LS  QL YAA+DV +L   + +    LQR  R 
Sbjct: 124 LKSLVQELEGIELDKTSQSSDWGNSANLSVAQLSYAANDVRYLIPAKEKLITMLQREERW 183

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C N +     LDL  ++  DIF H
Sbjct: 184 QLAEQCFNCIPVFVSLDLEQYK--DIFEH 210


>gi|170078658|ref|YP_001735296.1| putative ribonuclease D [Synechococcus sp. PCC 7002]
 gi|157811866|gb|ABV80286.1| ribonuclease D [Synechococcus sp. PCC 7002]
 gi|169886327|gb|ACB00041.1| putative ribonuclease D [Synechococcus sp. PCC 7002]
          Length = 207

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 129/209 (61%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M    + + D+  E   RY+   AIA+DTET+GL P RDRLC+VQL    G V  IRIA 
Sbjct: 1   MDQFALFDQDLSLEILERYLKSGAIAIDTETMGLNPYRDRLCLVQLCDDAGYVSAIRIAQ 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  ++   +  K+FH+ RFD+A L + FG+  RP FCTKIAS+L RTYT+ HG
Sbjct: 61  GQTAAPNLKALMEAPEITKVFHFARFDLAQLRHVFGIETRPFFCTKIASKLGRTYTSSHG 120

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  +KEL+G+ + K+ QSSDW +   LS EQL+YA++DV +L  +  + T  LQR  R 
Sbjct: 121 LKALVKELMGVELDKSAQSSDWGNVAVLSAEQLKYASNDVRYLIPMMRKLTAMLQRENRW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            L   C   L     LDL  ++NV  F H
Sbjct: 181 PLMEECLRCLPTFISLDLAFYDNV--FEH 207


>gi|284053636|ref|ZP_06383846.1| 3'-5' exonuclease [Arthrospira platensis str. Paraca]
          Length = 209

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 125/187 (66%), Gaps = 3/187 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+A+DTET+GL+P RDRLC+VQ+    G V  IRI  GQ+ APNL  +L      K+FH
Sbjct: 25  EALAIDTETMGLLPWRDRLCLVQICDPKGQVVAIRIERGQREAPNLKTLLETTNILKVFH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + RFD+A L +  G+ V PVFCTKIAS+L RTYT +HGLKD + EL G+ + K+ QSSDW
Sbjct: 85  FARFDVATLRHNLGIEVNPVFCTKIASKLARTYTGKHGLKDLIMELEGVELDKSSQSSDW 144

Query: 141 -SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWE 199
            +A +LS+ QL YAA+DV +L + + +  + L+R  R DLA  C   L     LDL+ ++
Sbjct: 145 GNAANLSENQLNYAANDVRYLLSAKDKLNQMLKREERWDLALDCFQCLPTIVTLDLMQFD 204

Query: 200 NVDIFSH 206
             DIF H
Sbjct: 205 --DIFKH 209


>gi|291571594|dbj|BAI93866.1| ribonuclease D [Arthrospira platensis NIES-39]
          Length = 207

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 125/187 (66%), Gaps = 3/187 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+A+DTET+GL+P RDRLC+VQ+    G V  IRI  GQ+ APNL  +L      K+FH
Sbjct: 23  EALAIDTETMGLLPWRDRLCLVQICDPKGQVVAIRIERGQREAPNLKTLLETTNILKVFH 82

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + RFD+A L +  G+ V PVFCTKIAS+L RTYT +HGLKD + EL G+ + K+ QSSDW
Sbjct: 83  FARFDVATLRHNLGIEVNPVFCTKIASKLARTYTGKHGLKDLIMELEGVELDKSSQSSDW 142

Query: 141 -SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWE 199
            +A +LS+ QL YAA+DV +L + + +  + L+R  R DLA  C   L     LDL+ ++
Sbjct: 143 GNAANLSENQLNYAANDVRYLLSAKDKLNQMLKREERWDLALDCFQCLPTIVTLDLMQFD 202

Query: 200 NVDIFSH 206
             DIF H
Sbjct: 203 --DIFKH 207


>gi|75908135|ref|YP_322431.1| 3'-5' exonuclease [Anabaena variabilis ATCC 29413]
 gi|75701860|gb|ABA21536.1| 3'-5' exonuclease [Anabaena variabilis ATCC 29413]
          Length = 209

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 3/187 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +AIAVDTET+GL+P+RDRLC++QL   +G V  IRIA GQ  APNL  +L      K+FH
Sbjct: 25  EAIAVDTETMGLLPQRDRLCLIQLCNPEGKVTAIRIARGQTAAPNLKKLLEATNVLKVFH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + RFD+A L +   + V+P+FCTKIAS+L RTYTN+HGLKD + EL  + + K+ QSSDW
Sbjct: 85  FARFDVATLRHHLDIHVQPIFCTKIASKLARTYTNRHGLKDLVYELEQVELDKSAQSSDW 144

Query: 141 -SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWE 199
            +A +L+D QL YAA+DV +L + + +    L+R  R +LA  C   L     LDLL ++
Sbjct: 145 GNAANLTDAQLSYAANDVRYLLSAQQKLVAMLKREERWELAQQCFQVLPTIVSLDLLQFK 204

Query: 200 NVDIFSH 206
             D+F H
Sbjct: 205 --DLFEH 209


>gi|209524209|ref|ZP_03272759.1| 3'-5' exonuclease [Arthrospira maxima CS-328]
 gi|209495300|gb|EDZ95605.1| 3'-5' exonuclease [Arthrospira maxima CS-328]
          Length = 207

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 125/187 (66%), Gaps = 3/187 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+A+DTET+GL+P RDRLC+VQ+    G V  IRI  GQ+ APNL  +L      K+FH
Sbjct: 23  EALAIDTETMGLLPGRDRLCLVQICDPKGQVVAIRIERGQREAPNLKTLLETANILKVFH 82

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + RFD+A L +  G+ V PVFCTKIAS+L RTYT +HGLKD + EL G+ + K+ QSSDW
Sbjct: 83  FARFDVATLRHNLGIEVNPVFCTKIASKLARTYTGKHGLKDLIMELEGVELDKSSQSSDW 142

Query: 141 -SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWE 199
            +A +LS+ QL YAA+DV +L + + +  + L+R  R DLA  C   L     LDL+ ++
Sbjct: 143 GNAANLSENQLNYAANDVRYLLSAKDKLIQMLKREERWDLALDCFQCLPTIVTLDLMQFD 202

Query: 200 NVDIFSH 206
             DIF H
Sbjct: 203 --DIFKH 207


>gi|254409855|ref|ZP_05023636.1| 3'-5' exonuclease, putative [Microcoleus chthonoplastes PCC 7420]
 gi|196183852|gb|EDX78835.1| 3'-5' exonuclease, putative [Microcoleus chthonoplastes PCC 7420]
          Length = 207

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 133/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M   +V + D+P      Y+  +AIAVDTET+GL+ +RDRLC+VQL      V +IRI  
Sbjct: 1   MAEFQVCDRDLPDALLKTYLNAEAIAVDTETMGLIYQRDRLCLVQLCDPQDRVTVIRIDK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
            Q  APNL  +L  +   K+FH+ RFD+A+L     + V+PVFCTKIAS+L RTYTN+HG
Sbjct: 61  KQTEAPNLKQLLEAQTVLKVFHFARFDLAILRQNLDIYVQPVFCTKIASKLARTYTNRHG 120

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + +L  + + K+ QSSDW + ++LSDEQL+YAA+DV +L ++R +    LQR  R 
Sbjct: 121 LKDLVMDLEQVELDKSSQSSDWGNPNNLSDEQLRYAANDVRYLLSVRQKLITMLQREERW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDLL +   DIF H
Sbjct: 181 QLAQECFEALSVMVSLDLLLYR--DIFEH 207


>gi|158334839|ref|YP_001516011.1| ribonuclease D [Acaryochloris marina MBIC11017]
 gi|158305080|gb|ABW26697.1| ribonuclease D [Acaryochloris marina MBIC11017]
          Length = 209

 Score =  177 bits (448), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 128/187 (68%), Gaps = 3/187 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D IAVDTET+GL P RDRLC+VQ+   +G V ++RIA GQ +APNL  ++  +   K+FH
Sbjct: 25  DRIAVDTETMGLKPHRDRLCLVQICNPEGQVTVVRIAQGQMDAPNLKQLMESDTVLKVFH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + RFDIA L +   +   P+FCTKIAS+L RTY+ +HGLK+ ++EL+G  + K+ QSSDW
Sbjct: 85  FARFDIATLLHHLDIETMPIFCTKIASKLVRTYSPRHGLKELVRELVGEELDKSAQSSDW 144

Query: 141 -SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWE 199
            +A++LS+EQL YA++DV +L + +    + L+R  R +LA +C   L     LDL+ ++
Sbjct: 145 GNAENLSEEQLNYASNDVRYLLSAQATLVKMLEREERLELAMACFQCLPTIVTLDLMHFD 204

Query: 200 NVDIFSH 206
           N  IF H
Sbjct: 205 N--IFEH 209


>gi|148284142|ref|YP_001248232.1| ribonuclease D [Orientia tsutsugamushi str. Boryong]
 gi|146739581|emb|CAM79331.1| ribonuclease D [Orientia tsutsugamushi str. Boryong]
          Length = 210

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 123/191 (64%), Gaps = 7/191 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQL-------SPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           +A+DTET+GL   RDRLC++Q        +  D  V +++    Q N+ NL  +L+D  R
Sbjct: 20  LAIDTETMGLNFARDRLCLLQFCQESKDDNIDDKEVFLVKFEDQQYNSHNLKKLLMDCSR 79

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KIFH+ RFD+A + Y  GV +  +FCT +AS+L RTYT+ HGLKD  +ELLGI ISK  
Sbjct: 80  TKIFHFARFDLAAIQYYLGVTLNNIFCTNVASKLVRTYTDSHGLKDLCRELLGIQISKQC 139

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           QSSDW    L+ +Q +YAA DVV+LH ++    E L R  R D+A     FL  RAELD+
Sbjct: 140 QSSDWGRQSLTSDQEEYAAKDVVYLHRIKNILEEMLIREHRLDIAQKIFKFLPARAELDV 199

Query: 196 LGWENVDIFSH 206
           +GW+++DI SH
Sbjct: 200 IGWQDIDILSH 210


>gi|22298627|ref|NP_681874.1| putative ribonuclease D [Thermosynechococcus elongatus BP-1]
 gi|22294807|dbj|BAC08636.1| tlr1083 [Thermosynechococcus elongatus BP-1]
          Length = 211

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 134/209 (64%), Gaps = 14/209 (6%)

Query: 10  DIPAEC---------AARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           D P EC          A +++A  +AVDTET+GL   RDRLC+VQ+   +G V +++I  
Sbjct: 4   DFPLECFDYDLSPTALAHFLNADQLAVDTETMGLNIPRDRLCLVQVCDPEGQVAVVKIGR 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQK AP+L  +L   +  KIFHY RFD+A L Y  G+RV PVFCTKIAS++ RTY+ +HG
Sbjct: 64  GQKEAPHLQQLLEHPRITKIFHYARFDLATLRYHLGIRVHPVFCTKIASKIARTYSPRHG 123

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + +LLG+ I K+ QSSDW +A  L ++QL+YAA+DV +L  LR Q T  L+R  R 
Sbjct: 124 LKDLVLDLLGVEIDKSAQSSDWGNATALREDQLRYAANDVRYLIPLRQQLTAMLKREERF 183

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +L  +  + L    +LDL G+  V  F H
Sbjct: 184 ELVQTALSCLPAIVDLDLAGYTQV--FEH 210


>gi|332709748|ref|ZP_08429707.1| ribonuclease D [Lyngbya majuscula 3L]
 gi|332351575|gb|EGJ31156.1| ribonuclease D [Lyngbya majuscula 3L]
          Length = 216

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 132/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+P      Y+  D++AVDTET+GL+ +RDRLC+VQL    G V  +RI  
Sbjct: 10  LKDFQVCDRDLPESICQEYLRADSLAVDTETMGLIYQRDRLCLVQLCDPQGRVTFVRIDK 69

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  AP L  +L      K+FH+ RFD+A+L    G+ V PVFCTKIAS+L RTYT+ HG
Sbjct: 70  GQTEAPRLKQLLEATNVLKVFHFARFDVAMLRQNLGIDVNPVFCTKIASKLARTYTSSHG 129

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK+ +KEL  I++ K+ QSSDW +  +LSD+QL+YAA+DV +L  +R +    L+R  R 
Sbjct: 130 LKELVKELERIDLDKSAQSSDWGNVANLSDQQLEYAANDVRYLLNVRQKLINMLEREDRW 189

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C   L     LDLL +   D+F H
Sbjct: 190 ELAQQCFEALPTMVSLDLLHYR--DVFEH 216


>gi|56750860|ref|YP_171561.1| ribonuclease D [Synechococcus elongatus PCC 6301]
 gi|81299489|ref|YP_399697.1| 3'-5' exonuclease [Synechococcus elongatus PCC 7942]
 gi|56685819|dbj|BAD79041.1| probable ribonuclease D [Synechococcus elongatus PCC 6301]
 gi|81168370|gb|ABB56710.1| 3'-5' exonuclease [Synechococcus elongatus PCC 7942]
          Length = 211

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 127/202 (62%), Gaps = 5/202 (2%)

Query: 8   EGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           E D+  E  A+Y    AIA+DTE +GL   RDRLC+VQL    G    +RIA GQ  APN
Sbjct: 12  EQDLTDELLAQYRQSPAIAIDTEAMGLNFHRDRLCLVQLCDSAGITTCVRIAQGQTVAPN 71

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +  D +  K+FH+ RFDI  L +  G+ V+P+FCTKIAS+L RTY++QHGLK  L+E
Sbjct: 72  LQALCEDPQITKVFHFARFDITALKHGLGIAVQPIFCTKIASKLARTYSSQHGLKSLLQE 131

Query: 126 LLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           L+G+ + K  QSSDW +A  LS EQ++YA +DV +L A + + T  LQR GR  LA  C 
Sbjct: 132 LVGVELDKTAQSSDWGNAAALSHEQMRYACNDVRYLLAAQAKLTTMLQREGRWQLAQDCF 191

Query: 185 NFLMDRAELDLLGWENVDIFSH 206
             L   A LDL  + +V  F H
Sbjct: 192 ACLPTFAALDLAQFGSV--FEH 211


>gi|33866568|ref|NP_898127.1| putative ribonuclease D [Synechococcus sp. WH 8102]
 gi|33633346|emb|CAE08551.1| putative ribonuclease D [Synechococcus sp. WH 8102]
          Length = 214

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/192 (48%), Positives = 124/192 (64%), Gaps = 3/192 (1%)

Query: 6   VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A+   RY+   A+AVDTE +GL+  RDRLC+VQ++  D  V  IRI  GQ +A
Sbjct: 13  VFDGDLDADWTERYLRMSALAVDTEAMGLIHGRDRLCLVQIADADDRVCCIRIGLGQTSA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L     EK+FH+ RFD+A L    G+ V P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLQRLLEAASVEKVFHFARFDVAALASGLGIAVSPIFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+LSD QL YAA+DV +L   R +    L+R GR DLA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELSDVQLAYAANDVRYLLPARQKLEAMLRREGRWDLAQR 192

Query: 183 CCNFLMDRAELD 194
           C   +   A+LD
Sbjct: 193 CFGCIPVIADLD 204


>gi|119487500|ref|ZP_01621110.1| ribonuclease D [Lyngbya sp. PCC 8106]
 gi|119455669|gb|EAW36805.1| ribonuclease D [Lyngbya sp. PCC 8106]
          Length = 208

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 134/209 (64%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M+  +V + DI  +  + Y+  D +AVDTET+GL+P RDRLC+VQL    G V  ++IA 
Sbjct: 1   MSNFQVCDRDISEDILSSYLTADRLAVDTETMGLLPWRDRLCLVQLCDPKGQVTAVKIAK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
            Q  AP+L  +L      K+FH+ RFD+A L Y   + V PVFCTKIAS+L RTYT +HG
Sbjct: 61  DQTEAPHLKKLLEASNTLKVFHFARFDMATLLYYLDIDVNPVFCTKIASKLARTYTGRHG 120

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK+ ++EL  + + K+ QSSDW +  +LS++QL YAA+DV +L  ++ +    L+R  R 
Sbjct: 121 LKELVQELEQVELDKSSQSSDWGNVGNLSEDQLNYAANDVRYLLNVQQKLMVMLEREERL 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           DLA +C + L     LDLL ++  DIF H
Sbjct: 181 DLAQNCFDCLPTIVTLDLLHYK--DIFEH 207


>gi|260436505|ref|ZP_05790475.1| 3'-5' exonuclease [Synechococcus sp. WH 8109]
 gi|260414379|gb|EEX07675.1| 3'-5' exonuclease [Synechococcus sp. WH 8109]
          Length = 225

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/204 (46%), Positives = 127/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V + D+ A    RY+ +  +AVDTE +GL+  RDRLC+VQ++  +  V  +RI  GQ  A
Sbjct: 24  VFDRDLDAAWTERYLQSPRLAVDTEAMGLIHGRDRLCLVQIADAEDRVACVRIGLGQTEA 83

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L     EK+FH+ RFD+A L    G+ V PVFCTK+ SRL RTYT +HGLKD +
Sbjct: 84  PNLKRLLEAPTVEKVFHFARFDVAALAAGLGIEVNPVFCTKVGSRLGRTYTPRHGLKDLV 143

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R +  + L+R GR DLA  
Sbjct: 144 MELVGVELDKGAQSSDWGRVDELTDAQLAYAANDVRYLLPARERLEKMLRREGRWDLAQR 203

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   AELD L +    IF H
Sbjct: 204 CFQCVPVVAELDRLRFHQ--IFEH 225


>gi|88807852|ref|ZP_01123363.1| putative ribonuclease D [Synechococcus sp. WH 7805]
 gi|88787891|gb|EAR19047.1| putative ribonuclease D [Synechococcus sp. WH 7805]
          Length = 214

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/204 (46%), Positives = 127/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+  E + RY    A+AVDTE +GL+  RDRLC+VQ+      V  IRIA GQ  A
Sbjct: 13  VLDGDLNEEWSERYARSTALAVDTEAMGLIHGRDRLCLVQICDDKDQVACIRIALGQTEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+RV P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PRLKALMEATTIEKVFHFARFDVAALATGLGIRVNPLFCTKVGSRLARTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+D  +L A R Q    L+R GR +LA S
Sbjct: 133 MELVGVELDKQAQSSDWGRVDELTDVQLAYAANDARYLLAARRQLEVMLRREGRWELAQS 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   ++LD   +  V+ F H
Sbjct: 193 CFQCIPVMSDLDRFRF--VNTFEH 214


>gi|148238801|ref|YP_001224188.1| ribonuclease D [Synechococcus sp. WH 7803]
 gi|147847340|emb|CAK22891.1| Ribonuclease D [Synechococcus sp. WH 7803]
          Length = 214

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 127/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ AE + R+    A+AVDTE +GL+  RDRLC+VQ+      V  IRIA GQ  A
Sbjct: 13  VLDGDLNAEWSERFAASTALAVDTEAMGLIHGRDRLCLVQICDDKDQVACIRIALGQSEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+RV P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PRLKALMEAATIEKVFHFARFDVAALATGLGIRVNPIFCTKVGSRLARTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+D  +L   R Q    L+R GR +LA S
Sbjct: 133 MELVGVELDKQAQSSDWGRVDELTDVQLAYAANDARYLLPARRQLEVMLRREGRWELAQS 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   ++LD   +  V+ F H
Sbjct: 193 CFQCIPVMSDLDRFRF--VNTFEH 214


>gi|16331359|ref|NP_442087.1| ribonuclease D [Synechocystis sp. PCC 6803]
 gi|1001530|dbj|BAA10157.1| ribonuclease D [Synechocystis sp. PCC 6803]
          Length = 217

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 130/209 (62%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           ++   V + D+P +   + +    +AVDTET+GL P RDRLC+VQ+   +G V  +RIA 
Sbjct: 7   LSQFEVFDYDLPEDVCQQLLACKEVAVDTETMGLNPHRDRLCLVQICDPEGNVTALRIAK 66

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  ++ D    KIFH+ RFD A L +TF ++  P+FCTKIAS++ RTYT+ HG
Sbjct: 67  GQEEAPNLTRLMEDPGITKIFHFARFDTAQLKHTFDIKTYPIFCTKIASKIARTYTSHHG 126

Query: 119 LKDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL+G+ + K+ Q SDW +A +LS  QL YAA+DV +L  LR +  + L R  R 
Sbjct: 127 LKTLVQELVGVELDKSSQCSDWGNAANLSKAQLAYAANDVRYLIPLRHKLEKMLAREDRL 186

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDL  + NV  F H
Sbjct: 187 RLAQRCFECLPVMVTLDLGMYGNV--FEH 213


>gi|113955257|ref|YP_729699.1| 3'-5' exonuclease family protein [Synechococcus sp. CC9311]
 gi|113882608|gb|ABI47566.1| 3'-5' exonuclease family protein [Synechococcus sp. CC9311]
          Length = 214

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 123/192 (64%), Gaps = 3/192 (1%)

Query: 6   VHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A+ A RY    A+AVDTE +GL+  RDRLC+VQ+   +  V  +RIA GQ  A
Sbjct: 13  VFDGDLDADWAERYSHATALAVDTEAMGLIHGRDRLCLVQICDAEDQVSCVRIALGQTEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+RV P+FCTK+ SRL RTY+ +HGLK+ +
Sbjct: 73  PRLKELMERASIEKVFHFARFDVAALATGLGIRVNPIFCTKVGSRLARTYSPRHGLKEVV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+LS+ QL YAA+D  +L   R +  E LQR GR +LA  
Sbjct: 133 MELVGVELDKQAQSSDWGRVDELSETQLAYAANDARYLLPARDRLKEMLQREGRWELAER 192

Query: 183 CCNFLMDRAELD 194
           C   +   ++LD
Sbjct: 193 CFECIPVMSDLD 204


>gi|37522692|ref|NP_926069.1| ribonuclease D [Gloeobacter violaceus PCC 7421]
 gi|35213694|dbj|BAC91064.1| ribonuclease D [Gloeobacter violaceus PCC 7421]
          Length = 208

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 131/200 (65%), Gaps = 5/200 (2%)

Query: 10  DIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           D+  E A  Y+ +  +AVD+E +GL+P RDRLC+VQL    G V ++R++AG   A  L 
Sbjct: 11  DLSPEVAGTYLQSGLLAVDSEAMGLLPHRDRLCLVQLCDEAGLVSLVRLSAGLTQASQLQ 70

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L      K+FHY RFD+A+L +  G+RV+P+ CTK+AS+L RTY+ +HGLKD + E +
Sbjct: 71  KVLEAPAVIKLFHYARFDVAMLRHHLGIRVQPIVCTKVASKLARTYSPRHGLKDLVLETV 130

Query: 128 GINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
           G+ + K+ QSSDW A  +LS+EQL+YAA+DV +L     +    L+R GR +LA  C   
Sbjct: 131 GVELDKSAQSSDWGAVLELSEEQLRYAANDVRYLIPAWRKLETMLRREGRFELARRCFAH 190

Query: 187 LMDRAELDLLGWENVDIFSH 206
           L  + +LDLLG+ +V  F H
Sbjct: 191 LETQVDLDLLGYSSV--FEH 208


>gi|78211959|ref|YP_380738.1| 3'-5' exonuclease [Synechococcus sp. CC9605]
 gi|78196418|gb|ABB34183.1| 3'-5' exonuclease [Synechococcus sp. CC9605]
          Length = 214

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 125/204 (61%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V + D+ A    RY+ +  +AVDTE +GL+  RDRLC+VQ++  +  V  +RI  GQ  A
Sbjct: 13  VFDRDLDAAWTERYLQSPRLAVDTEAMGLIHGRDRLCLVQIADAEDRVACVRIGLGQTEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +      EK+FH+ RFD+A L     + V PVFCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLKRLFEAPTVEKVFHFARFDVAALAAGLSIEVNPVFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R +  + L+R GR DLA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELTDAQLAYAANDVRYLLPARERLEQMLRREGRWDLAQR 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   AELD L +    IF H
Sbjct: 193 CFQCVPVVAELDRLRFHQ--IFEH 214


>gi|116075800|ref|ZP_01473059.1| putative ribonuclease D [Synechococcus sp. RS9916]
 gi|116067115|gb|EAU72870.1| putative ribonuclease D [Synechococcus sp. RS9916]
          Length = 214

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 126/204 (61%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A  A RY    A+AVDTE +GL+  RDRLC+VQ+   D  V  +RI  GQ  A
Sbjct: 13  VFDGDLDAAWAERYGRAKALAVDTEAMGLIHGRDRLCLVQICDPDDHVACVRIGLGQTEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++  +  EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTYT +HGLKD +
Sbjct: 73  PRLEALMESKAVEKVFHFARFDVAALASGLGIAVNPIFCTKVASRLARTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L++ QL YAA+D  +L   R +    L+R GR +LA  
Sbjct: 133 MELVGVELDKQAQSSDWGRVDELTEAQLAYAANDARYLLPARDRLELMLRREGRWELAER 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   A+LD L +  V  F H
Sbjct: 193 CFPCIPVIADLDRLRFNQV--FEH 214


>gi|87124930|ref|ZP_01080777.1| putative ribonuclease D [Synechococcus sp. RS9917]
 gi|86167250|gb|EAQ68510.1| putative ribonuclease D [Synechococcus sp. RS9917]
          Length = 213

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 122/194 (62%), Gaps = 3/194 (1%)

Query: 6   VHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A  A RY  A  +AVDTE +GL+  RDRLC+VQL  GD  V  +RI  GQ  A
Sbjct: 12  VFDGDLDAAWADRYAKASRLAVDTEAMGLVHGRDRLCLVQLCDGDDNVSCVRIGLGQCEA 71

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+ +HGLK+ +
Sbjct: 72  PRLKALMEAAAVEKVFHFARFDVAALASGLGIAVDPIFCTKVASRLARTYSPKHGLKEVV 131

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   ++LS+ QL YAA+D  +L   R +    L+R GR +LA  
Sbjct: 132 LELVGVELDKQAQSSDWGRVEELSEAQLAYAANDARYLLPARERLEVMLRREGRWELAQR 191

Query: 183 CCNFLMDRAELDLL 196
           C   +   +ELD L
Sbjct: 192 CFRCIPVMSELDRL 205


>gi|116072599|ref|ZP_01469865.1| 3'-5' exonuclease [Synechococcus sp. BL107]
 gi|116064486|gb|EAU70246.1| 3'-5' exonuclease [Synechococcus sp. BL107]
          Length = 214

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 120/192 (62%), Gaps = 3/192 (1%)

Query: 6   VHEGDIPAECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A    RY+   ++AVDTE +GL+  RDRLC+VQ++     V  +RI  GQ  A
Sbjct: 13  VFDGDLDASWTERYLQMPSLAVDTEAMGLIHGRDRLCLVQIADAQDRVACVRIGLGQSTA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +      EK+FH+ RFD+A L     + V+P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLQRLFEAASVEKVFHFARFDVAALAAGLDIAVQPLFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R Q    L+R GR +LA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELTDVQLAYAANDVRYLLPARNQLETMLRREGRWELAQR 192

Query: 183 CCNFLMDRAELD 194
           C   +   AELD
Sbjct: 193 CFTCIPVIAELD 204


>gi|78185488|ref|YP_377923.1| 3'-5' exonuclease [Synechococcus sp. CC9902]
 gi|78169782|gb|ABB26879.1| 3'-5' exonuclease [Synechococcus sp. CC9902]
          Length = 214

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 120/192 (62%), Gaps = 3/192 (1%)

Query: 6   VHEGDIPAECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A    RY+    +AVDTE +GL+  RDRLC+VQ++     V  +RIA GQ  A
Sbjct: 13  VFDGDLDASWTERYLQMPCLAVDTEAMGLIHGRDRLCLVQIADAQDRVACVRIALGQSTA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +      EK+FH+ RFD+A L     + V+P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLQRLFEAPSVEKVFHFARFDVAALAAGLDIAVQPLFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R +    L+R GR +LA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELTDVQLAYAANDVRYLLPARNKLETMLRREGRWELAQR 192

Query: 183 CCNFLMDRAELD 194
           C   +   AELD
Sbjct: 193 CFACIPVMAELD 204


>gi|33863970|ref|NP_895530.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9313]
 gi|33635554|emb|CAE21878.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9313]
          Length = 214

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 128/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ ++ A RY+   AIAVDTE +GL+  RDRLC+VQ+      V  +RI  GQ +A
Sbjct: 13  VFDGDLDSDWANRYLRASAIAVDTEAMGLIHGRDRLCLVQICDPADNVACVRIGLGQTSA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+ +HGLK+ +
Sbjct: 73  PRLQKLMEAPSVEKVFHFARFDVAALASGLGIYVLPIFCTKVASRLARTYSPRHGLKEVV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   ++LSD QL YAA+D  +L   R +    L+R GR ++A  
Sbjct: 133 MELVGVELDKQAQSSDWGRVEELSDVQLAYAANDARYLLPARQRLEMMLRREGRWEIAQR 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C + +   AELD L +    IF H
Sbjct: 193 CFSCIPVIAELDRLRFTQ--IFEH 214


>gi|123969324|ref|YP_001010182.1| putative ribonuclease D [Prochlorococcus marinus str. AS9601]
 gi|123199434|gb|ABM71075.1| putative ribonuclease D [Prochlorococcus marinus str. AS9601]
          Length = 211

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 118/185 (63%), Gaps = 3/185 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +GL+  RDRLC+VQ+         I+I     ++PNL  +L D+K  KIFHY 
Sbjct: 29  LAIDTEAMGLIHGRDRLCLVQICNEFKRTSCIKIELNTSSSPNLKALLEDDKITKIFHYA 88

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW-S 141
           RFD+A L     +  + +FCTKIAS+L RTYTN+HGLKD + ELLGI + K+ QSSDW S
Sbjct: 89  RFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLKDLINELLGIELDKSSQSSDWGS 148

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
            +DL+ +QL YAA+DV +L    L+    L+R  R +LA  C   +   A+LD+L + N 
Sbjct: 149 NEDLTKDQLDYAANDVRYLIEAMLKLKVILKRENRYELAQKCFETVSVHADLDILKFSN- 207

Query: 202 DIFSH 206
            IF H
Sbjct: 208 -IFEH 211


>gi|78780061|ref|YP_398173.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9312]
 gi|78713560|gb|ABB50737.1| 3'-5' exonuclease [Prochlorococcus marinus str. MIT 9312]
          Length = 211

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 118/185 (63%), Gaps = 3/185 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +GL+  RDRLC+VQ+         I+I   + +APNL  +L DEK  KIFHY 
Sbjct: 29  LAIDTEAMGLIHGRDRLCLVQICNELRRTACIKIELNRSSAPNLKALLEDEKITKIFHYA 88

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW-S 141
           RFD+A L    G+  + +FCTKIAS+L RTYTN+HGLKD + ELLG+ + K+ QSSDW S
Sbjct: 89  RFDVAALKCNLGINTKNIFCTKIASKLARTYTNKHGLKDLINELLGVELDKSSQSSDWGS 148

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
            +DL+ +QL YA++DV +L     +    L R  R +LA  C   +   A+LD+L + N 
Sbjct: 149 KEDLTKDQLDYASNDVRYLIEAMHKLKVILDRENRYELAQKCFKTVSVHADLDILKFSN- 207

Query: 202 DIFSH 206
            IF H
Sbjct: 208 -IFEH 211


>gi|183220183|ref|YP_001838179.1| ribonuclease D [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
 gi|189910303|ref|YP_001961858.1| ribonuclease D-like [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167774979|gb|ABZ93280.1| Ribonuclease D-related [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167778605|gb|ABZ96903.1| Ribonuclease D [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 212

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 125/203 (61%), Gaps = 4/203 (1%)

Query: 6   VHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+  +   A +  D +AVD E +GL PRRDRLC+VQ+S     V +++I  GQK A
Sbjct: 12  VLQGDLNEDFFEAFKKDDRLAVDCEMMGLNPRRDRLCVVQISDSKNKVALVQILPGQKEA 71

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P++  +   ++  KIFH+ R D+  L    G++V+ VFCTKIAS+L RTYT++HGLK+ +
Sbjct: 72  PHIQKLFESKEITKIFHFARMDMTFLRARLGIKVQNVFCTKIASKLARTYTDKHGLKELI 131

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +E    NI K  QSSDW    L+ +Q+ YA++DV  L +L    TE + R  R  +A  C
Sbjct: 132 REFFEENIDKKNQSSDWGKKILTKDQVDYASTDVRFLISLESILTEMMIRENRFTIAEKC 191

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  + ELDLL  E  ++F H
Sbjct: 192 FGFLETQVELDLL--EVYNLFEH 212


>gi|123967004|ref|YP_001012085.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9515]
 gi|123201370|gb|ABM72978.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9515]
          Length = 213

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 125/206 (60%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           I ++  DI       Y D+  +AVDTE +GL+  RDRLC++Q+S        I+I     
Sbjct: 10  ITLYNNDITQNLYNIYKDSSYLAVDTEAMGLIHGRDRLCLIQISNEFHLTSCIKIELNNS 69

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           ++P++  +  D K  KIFHY RFD+A L     +    +FCTKIAS+L RTYT++HGLK+
Sbjct: 70  DSPHIKKLFEDNKIMKIFHYARFDVAALKCNLNINTNNIFCTKIASKLARTYTHKHGLKE 129

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + EL+GI + K+ QSSDW S +DLSD+Q+ YAA+DV +L     +    L+R GR DLA
Sbjct: 130 LIHELIGIELDKSSQSSDWGSCEDLSDKQIDYAANDVKYLIEAMRKLRIILEREGRYDLA 189

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C   +   +ELD+L + N  IF H
Sbjct: 190 QKCFQTIPVHSELDILKFSN--IFEH 213


>gi|157414190|ref|YP_001485056.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9215]
 gi|157388765|gb|ABV51470.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9215]
          Length = 211

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 117/185 (63%), Gaps = 3/185 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +GL+  RDRLC+VQ+    G    I+I     ++ +L  +L DEK  KIFHY 
Sbjct: 29  LAIDTEAMGLIHGRDRLCLVQICNEFGRTSCIKIELNTSSSTHLKALLEDEKITKIFHYA 88

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW-S 141
           RFD+A L     +  + +FCTKIAS+L RTYTN+HGLKD + ELLGI + K+ QSSDW S
Sbjct: 89  RFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLKDLINELLGIELDKSSQSSDWGS 148

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
            +DL+ EQL YAA+DV +L     +    L+R  R +LA  C   +   A+LD+L + N 
Sbjct: 149 NEDLTKEQLDYAANDVRYLIEAMHKLKVILKRENRYELAQKCFETVSVHADLDILKFSN- 207

Query: 202 DIFSH 206
            IF H
Sbjct: 208 -IFEH 211


>gi|91070231|gb|ABE11151.1| putative ribonuclease D [uncultured Prochlorococcus marinus clone
           HF10-11H11]
          Length = 211

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 117/185 (63%), Gaps = 3/185 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +GL+  RDRLC+VQ+         I+I     ++P+L  +L D+K  KIFHY 
Sbjct: 29  LAIDTEAMGLIHGRDRLCLVQICNEFNRTSCIKIELNTSSSPHLKALLEDDKITKIFHYA 88

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW-S 141
           RFD+A L     +  + +FCTKIAS+L RTYTN+HGLKD + ELLGI + K+ QSSDW S
Sbjct: 89  RFDVAALKCNLKINTKNIFCTKIASKLARTYTNKHGLKDLINELLGIELDKSSQSSDWGS 148

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
            +DL+ +QL YAA+DV +L     +    L+R  R +LA  C   +   A+LD+L + N 
Sbjct: 149 NEDLTKDQLDYAANDVRYLIEAMHKLKVILERENRYELAQKCFETVSVHADLDILKFSN- 207

Query: 202 DIFSH 206
            IF H
Sbjct: 208 -IFEH 211


>gi|254431401|ref|ZP_05045104.1| RNAse D protein [Cyanobium sp. PCC 7001]
 gi|197625854|gb|EDY38413.1| RNAse D protein [Cyanobium sp. PCC 7001]
          Length = 224

 Score =  160 bits (406), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 120/192 (62%), Gaps = 3/192 (1%)

Query: 6   VHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A  A  Y  A  +AVDTE +GL+  RDRLC+VQ+      V  IR+  GQ +A
Sbjct: 17  VFDGDLDAGWAELYAGARALAVDTEAMGLIHGRDRLCLVQICDDADNVCCIRLRRGQSSA 76

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P+L  ++ +   EK+FH+ RFD+A L    G+ V P+FCTKI SRL RTY+ +HGLKD +
Sbjct: 77  PHLQALMENAAIEKVFHFARFDVAALAENLGIAVHPIFCTKIGSRLARTYSPRHGLKDVV 136

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           +EL+G+ + K  QSSDW   DDLS+ QL YAA DV +L   R +    L+R  R +LA  
Sbjct: 137 QELVGVELDKRAQSSDWGEVDDLSEAQLAYAAGDVRYLLQARDRLERMLRREERWELAQR 196

Query: 183 CCNFLMDRAELD 194
           C   L   A+LD
Sbjct: 197 CFTCLPVFADLD 208


>gi|126697114|ref|YP_001092000.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9301]
 gi|126544157|gb|ABO18399.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9301]
          Length = 211

 Score =  160 bits (406), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 117/185 (63%), Gaps = 3/185 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +GL+  RDRLC+VQ+         I+I     ++P+L  +L DEK  KIFHY 
Sbjct: 29  LAIDTEAMGLIHGRDRLCLVQICNEFKRTSCIKIELNTSSSPHLKKLLEDEKITKIFHYA 88

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW-S 141
           RFD+A L     +  + +FCTKIAS+L RTYTN+HGLKD + ELLGI + K+ QSSDW S
Sbjct: 89  RFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLKDLINELLGIELDKSSQSSDWGS 148

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
            +DL+ +QL YAA+DV +L     +    L+R  R +LA  C   +   A+LD+L + N 
Sbjct: 149 NEDLTKDQLDYAANDVRYLIEAMHKLKVILEREDRYELAQKCFETVSVHADLDILKFSN- 207

Query: 202 DIFSH 206
            IF H
Sbjct: 208 -IFEH 211


>gi|254526817|ref|ZP_05138869.1| 3'-5' exonuclease [Prochlorococcus marinus str. MIT 9202]
 gi|221538241|gb|EEE40694.1| 3'-5' exonuclease [Prochlorococcus marinus str. MIT 9202]
          Length = 211

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 117/185 (63%), Gaps = 3/185 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +GL+  RDRLC+VQ+    G    I+I     ++ +L  +L D+K  KIFHY 
Sbjct: 29  LAIDTEAMGLIHGRDRLCLVQICNEFGRTSCIKIELNTSSSTHLKALLEDDKITKIFHYA 88

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW-S 141
           RFD+A L     +  + +FCTKIAS+L RTYTN+HGLKD + ELLGI + K+ QSSDW S
Sbjct: 89  RFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLKDLINELLGIELDKSSQSSDWGS 148

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
            +DL+ EQL YAA+DV +L     +    L+R  R +LA  C   +   A+LD+L + N 
Sbjct: 149 NEDLTKEQLDYAANDVRYLIEAMHKLKVILKRENRYELAQKCFETVPVHADLDILKFSN- 207

Query: 202 DIFSH 206
            IF H
Sbjct: 208 -IFEH 211


>gi|33862140|ref|NP_893701.1| putative ribonuclease D [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|33634358|emb|CAE20043.1| putative ribonuclease D [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 213

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/210 (42%), Positives = 125/210 (59%), Gaps = 13/210 (6%)

Query: 4   IRVHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           I     DI  +    Y D+  +AVDTE +GL+  RDRLC++Q+         I+I     
Sbjct: 10  INFSHNDINTDLYNLYKDSSYLAVDTEAMGLIHGRDRLCLIQICNELNLTACIKIELNNS 69

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           ++PN+  +  D+   KIFHY RFD+A L     +  R +FCTKIAS+L RTYTN+HGLKD
Sbjct: 70  DSPNIKKLFEDKNIMKIFHYARFDVAALRCNLEINTRNIFCTKIASKLARTYTNKHGLKD 129

Query: 122 NLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHL----HALRLQFTEKLQRLGR 176
            + ELL + + K+ QSSDW S +DLS++Q+ YAA+DV +L    H L+L     L R GR
Sbjct: 130 LINELLEVELDKSSQSSDWGSLEDLSNKQIDYAANDVRYLIETMHKLKLI----LDREGR 185

Query: 177 SDLATSCCNFLMDRAELDLLGWENVDIFSH 206
            +LA  C   +   +ELD+L + N  IF H
Sbjct: 186 YELAQKCFKTIPVHSELDILKFSN--IFEH 213


>gi|159904246|ref|YP_001551590.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9211]
 gi|159889422|gb|ABX09636.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9211]
          Length = 214

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 119/186 (63%), Gaps = 3/186 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           ++A+DTE +GLM  RDRLC+VQ+      V  IRI   QK+AP L  +L +   +KIFH+
Sbjct: 31  SLAIDTEAMGLMHGRDRLCLVQICDESDNVICIRIERNQKSAPLLKNLLENPSIQKIFHF 90

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            RFD+A L     ++V P+FCTK+AS++ RTY+ +HGLK+ + EL+ + + K  QSSDW 
Sbjct: 91  ARFDVAALEVNLDIKVTPIFCTKVASKIGRTYSPRHGLKEVVMELVNVELDKQAQSSDWG 150

Query: 142 A-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWEN 200
           A +DLS +QL YAA+DV +L   + +    L+R GR +L T C   +   +ELD+  + N
Sbjct: 151 AVEDLSAKQLAYAANDVRYLIKAKEKLEHMLKREGRWELTTKCFQCIPVMSELDIYRFGN 210

Query: 201 VDIFSH 206
             IF H
Sbjct: 211 --IFEH 214


>gi|297182779|gb|ADI18933.1| ribonuclease d [uncultured SAR11 cluster bacterium HF0010_09O16]
          Length = 203

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 127/205 (61%), Gaps = 4/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           T I +H+GD+P       +  +AVD E LGL  RRDRLC++Q+S G+    I+++     
Sbjct: 3   TKIELHKGDLPENLDLGTI--VAVDGEFLGLNVRRDRLCLIQVSSGNSDAHIVQLDRENY 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           NAPNLV +L D+  +K+FHY R D+  + Y     V  + C+KI S+L RT+++ H LK 
Sbjct: 61  NAPNLVKILADKNIKKLFHYARSDLTHIKYYLKTDVNNIECSKIKSKLARTFSDSHSLKT 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            +KE   +++SK  Q+SD+   +LS  QL+Y A+DV++LH +  +  + L+R  R DL  
Sbjct: 121 LIKEFANVDVSKQFQTSDFGG-ELSQGQLKYCANDVIYLHKIHSELDKILEREKRMDLYR 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  R +LDLL +++ DI+SH
Sbjct: 180 ECIKFLHTRIKLDLLEFKD-DIWSH 203


>gi|318042597|ref|ZP_07974553.1| ribonuclease [Synechococcus sp. CB0101]
          Length = 234

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 111/174 (63%), Gaps = 1/174 (0%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+AVDTE +GL+  RDRLC+VQ+S     V  IRI  GQ  AP L  ++      K+FH+
Sbjct: 49  ALAVDTEAMGLVHGRDRLCLVQISDDQDNVCCIRILRGQSEAPLLKQLMEHSGIVKVFHF 108

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            RFD+A L    G+ V P+FCTK+ASRL RTYTN+HGLK+ + EL G+ + K  QSSDW 
Sbjct: 109 ARFDVAALGEGLGIAVNPLFCTKVASRLARTYTNRHGLKELVSELCGVELDKGAQSSDWG 168

Query: 142 -ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
             ++LS+ QL YAA+DV +L   R + T+ L+R  R DLA      +   AELD
Sbjct: 169 RVEELSETQLAYAANDVRYLLPARERLTQMLEREERLDLAQRSFQCIPVIAELD 222


>gi|148243178|ref|YP_001228335.1| ribonuclease [Synechococcus sp. RCC307]
 gi|147851488|emb|CAK28982.1| Ribonuclease [Synechococcus sp. RCC307]
          Length = 217

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 122/208 (58%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           T   V +GD+  E    Y    A+AVDTE +GL+  RDRLC+VQ+      V  IRIA G
Sbjct: 10  THFAVFDGDLSPEWFGHYKNAKALAVDTEAMGLIHGRDRLCLVQICDDQDRVCCIRIARG 69

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q  AP L  ++     EK+FHY RFD+A +    G+ V P+FCTK+ASRL RTY+ +HGL
Sbjct: 70  QSEAPLLKELMEATGIEKVFHYARFDVAAMASGLGIAVNPIFCTKVASRLARTYSPRHGL 129

Query: 120 KDNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
              + EL+G+++ K  QSSDW   ++LS++QL YAA+DV +L   R +  + L R  R  
Sbjct: 130 AAVVSELVGVDLDKQAQSSDWGRVEELSEQQLAYAANDVRYLLPARDRLEQMLVREERWS 189

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C  FL      DL  ++   IF H
Sbjct: 190 LAQRC--FLCIPVFSDLDRFQYGSIFEH 215


>gi|87300944|ref|ZP_01083786.1| putative ribonuclease D [Synechococcus sp. WH 5701]
 gi|87284815|gb|EAQ76767.1| putative ribonuclease D [Synechococcus sp. WH 5701]
          Length = 228

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 94/205 (45%), Positives = 128/205 (62%), Gaps = 5/205 (2%)

Query: 6   VHEGDIPAECAA--RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V EGD+ AE  +      A+AVDTE +GL+  RDRLC+VQ++     V  IRIA GQ+ A
Sbjct: 22  VFEGDLDAEWLSLLAQAPALAVDTEAMGLVHGRDRLCLVQIADHLDNVCCIRIARGQQEA 81

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+++HGLK+ +
Sbjct: 82  PRLRELMESPAIEKVFHFARFDLAALGEGLGIAVAPLFCTKVASRLARTYSSRHGLKEVV 141

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           +EL+G+ + K  QSSDW   ++L + QL YAA+DV +L A R      L+R  R DLA  
Sbjct: 142 QELVGVELDKQSQSSDWGRVEELGEAQLVYAANDVRYLLAARHALAAILEREERLDLARR 201

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C   L   AELD   + +V  F HS
Sbjct: 202 CFACLPVFAELDRSRFGSV--FEHS 224


>gi|317968782|ref|ZP_07970172.1| ribonuclease [Synechococcus sp. CB0205]
          Length = 225

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 104/163 (63%), Gaps = 1/163 (0%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+AVDTE +GL+  RDRLC+VQ+S     V  IRI  GQ  AP L  ++     EK+FH+
Sbjct: 40  ALAVDTEAMGLIHGRDRLCLVQISDDHDNVCCIRIHRGQTEAPLLKELMEAAGIEKVFHF 99

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            RFD+A L     + V P+FCTKI SRL RTYTN+HGLKD + EL  + + K  QSSDW 
Sbjct: 100 ARFDVAALAEGLDIHVSPIFCTKIGSRLARTYTNRHGLKDLVNELCHVELDKGAQSSDWG 159

Query: 142 -ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
             ++LS+ QL YAA+DV +L A R +  E L R  R DLA  C
Sbjct: 160 RVEELSESQLAYAANDVRYLLAARTRLIEMLVREERLDLAQRC 202


>gi|124023956|ref|YP_001018263.1| ribonuclease D [Prochlorococcus marinus str. MIT 9303]
 gi|123964242|gb|ABM78998.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9303]
          Length = 212

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 112/173 (64%), Gaps = 3/173 (1%)

Query: 6   VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ ++ A RY+   AIAVDTE +GL+  RDRLC+VQ+      V  +RI  GQ +A
Sbjct: 13  VFDGDLDSDWANRYLRASAIAVDTEAMGLIHGRDRLCLVQICDPADNVACVRIGLGQTSA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+ +HGLK+ +
Sbjct: 73  PRLQKLMEATSVEKVFHFARFDVAALASGLGISVLPIFCTKVASRLARTYSPRHGLKEVV 132

Query: 124 KELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            EL+G+ + K  QSSDW   ++LSD QL YAA+D  +L   R +    L+R G
Sbjct: 133 MELVGVELDKQAQSSDWGRVEELSDVQLAYAANDARYLLPARQRLEMMLRREG 185


>gi|124026737|ref|YP_001015852.1| putative ribonuclease D [Prochlorococcus marinus str. NATL1A]
 gi|123961805|gb|ABM76588.1| putative ribonuclease D [Prochlorococcus marinus str. NATL1A]
          Length = 214

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 125/208 (60%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           +T  + + DI +E   A R   A+AVDTE +GL+  RDRLC++Q+      V  IRI   
Sbjct: 9   STFNIFDQDIDSETEIALRSSSALAVDTEAMGLIHGRDRLCLIQICDEFDNVICIRIERN 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q +AP+L  +L ++  EK+FH+ RFD+A L     + V P+FCTKIAS++ RTY+ +HGL
Sbjct: 69  QHSAPHLKSILENKTIEKVFHFARFDVAALASNLNINVNPIFCTKIASKIGRTYSPRHGL 128

Query: 120 KDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K+ + E +G+ + K  QSSDW    DL+ +QL YAA+DV +L   + +  E L+R  R  
Sbjct: 129 KEVVLETVGVELDKQAQSSDWGKVGDLTQKQLIYAANDVRYLLGAKHKLEEMLKREERWG 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C   +   +ELD   + N  IF H
Sbjct: 189 LAQKCFQCVPVLSELDRRRFTN--IFDH 214


>gi|72382995|ref|YP_292350.1| putative ribonuclease D [Prochlorococcus marinus str. NATL2A]
 gi|72002845|gb|AAZ58647.1| 3'-5' exonuclease [Prochlorococcus marinus str. NATL2A]
          Length = 214

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 85/208 (40%), Positives = 125/208 (60%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           +T  + + DI +E   A R   A+AVDTE +GL+  RDRLC++Q+      V  IRI   
Sbjct: 9   STFNIFDQDIDSETEIALRSSSALAVDTEAMGLIHGRDRLCLIQICDEFDNVICIRIERN 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q +AP+L  +L ++  EK+FH+ RFD+A L     + V P+FCTKIAS++ RTY+ +HGL
Sbjct: 69  QHSAPHLKSILENKTIEKVFHFARFDVAALASNLNINVNPIFCTKIASKIGRTYSPRHGL 128

Query: 120 KDNLKELLGINISKAQQSSDW-SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K+ + E +G+ + K  QSSDW    DL+ +QL YA++DV +L   + +  E L+R  R  
Sbjct: 129 KEVVLETVGVELDKQAQSSDWGKVGDLTQKQLIYASNDVRYLLGAKHKLEEMLKREERWG 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C   +   +ELD   + N  IF H
Sbjct: 189 LAQKCFQCVPVLSELDRRRFTN--IFDH 214


>gi|116327594|ref|YP_797314.1| ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331795|ref|YP_801513.1| ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116120338|gb|ABJ78381.1| Ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125484|gb|ABJ76755.1| Ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 212

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 109/186 (58%), Gaps = 2/186 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D +AVD E +GL PRRDRLC+VQ+      V +++I   QK AP L  +  + +  KIFH
Sbjct: 29  DRLAVDCEMMGLNPRRDRLCVVQICDSSNNVSLVQILPDQKEAPLLKSLFENPEIVKIFH 88

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + R D   L Y  G+ +  VFCTKIAS+L RTYT++HGLKD +KE     I K  QSSDW
Sbjct: 89  FARMDSLFLRYRLGISLENVFCTKIASKLARTYTDKHGLKDLIKEFYDEVIDKKNQSSDW 148

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWEN 200
               L+ +Q++YA+ DV +L +L  + TE L R GR  LA      L    ++D L  E 
Sbjct: 149 GKKILTKDQIEYASGDVKYLISLEQKLTEILVREGRDSLAREAFRCLPVFNQIDWL--EM 206

Query: 201 VDIFSH 206
             +F H
Sbjct: 207 PSLFEH 212


>gi|24215616|ref|NP_713097.1| ribonuclease D [Leptospira interrogans serovar Lai str. 56601]
 gi|45657025|ref|YP_001111.1| ribonuclease D [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|24196771|gb|AAN50115.1|AE011455_9 ribonuclease D [Leptospira interrogans serovar Lai str. 56601]
 gi|45600262|gb|AAS69748.1| ribonuclease D [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 212

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 110/186 (59%), Gaps = 2/186 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D +AVD E +GL PRRDRLC+VQ+      V +++I   QK AP L  +  + +  KIFH
Sbjct: 29  DRLAVDCEMMGLNPRRDRLCVVQICDSSNNVSLVQILPDQKEAPLLKSLFENPEIVKIFH 88

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           + R D   L Y  G+ ++ VFCTKIAS+L RTYT++HGLKD +KE     I K  QSSDW
Sbjct: 89  FARMDSLFLRYRLGINLQNVFCTKIASKLARTYTDKHGLKDLIKEFYDEVIDKKNQSSDW 148

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWEN 200
               L+ +Q++YA+ DV +L +L  + TE L R GR  LA      L    ++D L  E 
Sbjct: 149 GKKILTKDQIEYASGDVKYLISLEQKLTEILVREGRDSLAREAFRCLPVFNQIDWL--EM 206

Query: 201 VDIFSH 206
             +F H
Sbjct: 207 PTLFEH 212


>gi|91762366|ref|ZP_01264331.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718168|gb|EAS84818.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1002]
          Length = 203

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 125/203 (61%), Gaps = 4/203 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I++H  D+P +     +  IAVD E +GL  +RD LC++Q+S G+    II++   + +A
Sbjct: 5   IKLHTSDLPEDLDLGNI--IAVDGEFMGLNVKRDPLCLIQISTGNSDAHIIQLDREKYDA 62

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L DE   KIFHYGR D+A + +        +  TKIAS+L R+Y++ H LK  +
Sbjct: 63  PNLNKVLSDESITKIFHYGRADMAHIKHYLKTETNNILDTKIASKLARSYSDSHSLKTLI 122

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           KE + +++SK  QSSD+   +LS  QL+Y A+DV++LH +  +  + L R  R DL  SC
Sbjct: 123 KEFMNVDVSKQFQSSDFGG-ELSPAQLKYCANDVIYLHKIHEELNKILVREKRIDLYKSC 181

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  R +LDL  +++ DI+SH
Sbjct: 182 LAFLKTRVDLDLALFKD-DIWSH 203


>gi|254456084|ref|ZP_05069513.1| ribonuclease D [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083086|gb|EDZ60512.1| ribonuclease D [Candidatus Pelagibacter sp. HTCC7211]
          Length = 203

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 123/205 (60%), Gaps = 4/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I++H+ D+P +     V  +AVD E +GL  RRD LC++QLS G+    I+++     
Sbjct: 3   NNIKLHQKDLPEDLDLGNV--LAVDGEFMGLNVRRDPLCLIQLSTGNSDAHIVQLDRKSY 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL+ +L DE   KIFHYGR D+A + Y        +  TKIAS+L R+Y++ H LK 
Sbjct: 61  EAPNLIKILKDETITKIFHYGRADMAHIKYYLKTETNNILDTKIASKLARSYSDNHSLKT 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            +KE   ++ISK  QSSD+    L+  QL+Y A+DV++LH +  +  + L+R  R  L  
Sbjct: 121 LIKEFANVDISKQFQSSDFGG-TLTPAQLKYCANDVIYLHQIHDELFKILERENRIKLYK 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C +FL  R +LDL  +++ DI+SH
Sbjct: 180 DCLSFLKTRVDLDLALFKD-DIWSH 203


>gi|262276742|ref|ZP_06054535.1| 3'-5' exonuclease family protein [alpha proteobacterium HIMB114]
 gi|262223845|gb|EEY74304.1| 3'-5' exonuclease family protein [alpha proteobacterium HIMB114]
          Length = 206

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 124/208 (59%), Gaps = 4/208 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M   + +  DI  + + +   +IA+D E  GL P  D+L ++QL  G   V +++   G+
Sbjct: 1   MKNYKFYLSDIDGDTSLKNASSIAIDGEFSGLNPLTDKLHLLQLCDGSDFVHLVKFE-GK 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            NAPNL  +L + K +KIFH+GR D+A L     + V  +F TKI S+++R ++  HGLK
Sbjct: 60  YNAPNLKEILENNKIKKIFHFGRADLAFLKQHLDIHVTNIFDTKIGSKISRKFSPHHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSA--DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           D  ++L+ IN+SK  Q+SDW    ++ S++Q+ YA  DV++LH ++ +  + L+R  + +
Sbjct: 120 DLCRDLININLSKEYQTSDWGKKIEEYSEDQILYACKDVLYLHKIKNELEKILKRENKLE 179

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C  FL  R  LDL+G    DIF H
Sbjct: 180 LAEQCFKFLETRTALDLVGLTG-DIFEH 206


>gi|262276702|ref|ZP_06054497.1| ribonuclease D [alpha proteobacterium HIMB114]
 gi|262225133|gb|EEY75590.1| ribonuclease D [alpha proteobacterium HIMB114]
          Length = 204

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 120/198 (60%), Gaps = 3/198 (1%)

Query: 9   GDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
            D+  + + +   +IA+D E  GL P  D+L ++Q+  G   V  ++   G+ +AP L  
Sbjct: 10  NDLEDDSSLKNASSIAIDGEFSGLNPLTDKLHLLQICDGSNFVHFVKFD-GEYDAPKLKK 68

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +L +   +KIFH+GR D+  +     + V+ ++ TKIAS++ R +T+ HGLKD  ++L+ 
Sbjct: 69  VLENNSIKKIFHFGRADLGFIKKHLNINVKNIYDTKIASKICRKFTSSHGLKDLSRDLIN 128

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           IN+SK  Q+SDW   + SD+Q++YAA+DV+HLH ++ +  + L R  + +LA  C  FL 
Sbjct: 129 INLSKEHQTSDWGKKEYSDDQIKYAANDVLHLHKIKEELDKILIRENKVELAEKCFQFLE 188

Query: 189 DRAELDLLGWENVDIFSH 206
            R +LDL G    DIF H
Sbjct: 189 TRTDLDLCGLG--DIFEH 204


>gi|71083204|ref|YP_265923.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062317|gb|AAZ21320.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1062]
          Length = 203

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/203 (39%), Positives = 125/203 (61%), Gaps = 4/203 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I++H+ D+P +     +  IAVD E +GL  +RD LC++Q+S G+    II++   + +A
Sbjct: 5   IKLHKNDLPEDLDLGNI--IAVDGEFMGLNVKRDPLCLIQISTGNSDAHIIQLDREKYDA 62

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L D    KIFHYGR D+A + +        +  TKIAS+L R+Y++ H LK  +
Sbjct: 63  PNLNKVLSDASIIKIFHYGRADMAHIKHYLKTETNNILDTKIASKLARSYSDSHSLKTLI 122

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           KE + +++SK  QSSD+   +LS  QL+Y A+DV++LH +  +  + L R  R DL  SC
Sbjct: 123 KEFMNVDVSKQFQSSDFGG-ELSPAQLKYCANDVIYLHKIHEELNKILVREKRIDLYKSC 181

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
             FL  R +LDL  +++ DI+SH
Sbjct: 182 LAFLKTRVDLDLALFKD-DIWSH 203


>gi|225629620|ref|ZP_03787627.1| 3'-5' exonuclease [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591525|gb|EEH12558.1| 3'-5' exonuclease [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 135

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 67/130 (51%), Positives = 90/130 (69%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+   ELL   ++K QQ
Sbjct: 4   KIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKELCLELLDTKLNKQQQ 63

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
           SSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA  C  FL  R ELDL+
Sbjct: 64  SSDWGDENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQKCFEFLPTRIELDLM 123

Query: 197 GWENVDIFSH 206
           GWENVDIF+H
Sbjct: 124 GWENVDIFNH 133


>gi|33241189|ref|NP_876131.1| putative ribonuclease D [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|33238719|gb|AAQ00784.1| Ribonuclease D [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 214

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 120/207 (57%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           + +V E D+  +    +     +A+DTE +GL+  RDRLC+VQ+      V  I+I   Q
Sbjct: 10  SFKVFETDLDDQWTQHFSTQSCLAIDTEAMGLIHGRDRLCLVQICDEQDNVACIKIQQHQ 69

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             A NL  ++ D   EK+FHY RFD+A +     + V  +FCTK+AS++ RTY+ +HGLK
Sbjct: 70  TKANNLQSLMEDSAIEKVFHYARFDVAAISCNLNIAVNSIFCTKLASKIGRTYSPRHGLK 129

Query: 121 DNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           + + EL+GI + K  QSSDW    +L+++QL+YA +DV +L   R Q  + L R  R +L
Sbjct: 130 EVILELVGIELDKQAQSSDWGRVGELTEKQLEYATNDVRYLIQARNQLEKMLIREDRWEL 189

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
              C   +   +ELD+  + N  IF H
Sbjct: 190 TKRCFECISVMSELDIRRFHN--IFEH 214


>gi|297183461|gb|ADI19592.1| ribonuclease d [uncultured SAR11 cluster bacterium HF0770_37D02]
          Length = 214

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 122/211 (57%), Gaps = 6/211 (2%)

Query: 1   MTTIRVHEGDIPAECAARYVD--AIAVDTETLGL-MPRRDRLCIVQLSPGDGTVDIIRIA 57
           MT I   + DI AE      +  ++A+DTE  GL +P RD+L +VQ S G+    II+  
Sbjct: 5   MTKIYKFQDDIAAEALKELENHSSLAIDTEGSGLQIPHRDKLSLVQFSTGNNDAYIIQPN 64

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                APN+  +L ++K  KI HY R+DI+ L Y     V+ +F TK+AS+L RTY+  H
Sbjct: 65  RKDYKAPNIKKILENDKITKIGHYLRYDISGLEYFLKCNVKNIFDTKLASKLCRTYSQNH 124

Query: 118 GLKDNLKELLGINISKAQQSSDWSA--DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           GLKD   E  G  + K   SSDW+   D+L+D QLQY ++DV++LH ++ +  + L R  
Sbjct: 125 GLKDLALEFCGKKLDKRLGSSDWNKNLDELTDAQLQYCSNDVIYLHKIKDELYKMLVREN 184

Query: 176 RSDLATSCCNFLMDRAELDLLGWENVDIFSH 206
           R +L  +C  FL  R +LD  G+   DIF H
Sbjct: 185 RLELYENCIKFLKTRIKLDQSGFAE-DIFQH 214


>gi|167041251|gb|ABZ06007.1| putative 3'-5' exonuclease [uncultured marine microorganism
           HF4000_005D21]
 gi|167045755|gb|ABZ10401.1| putative 3'-5' exonuclease [uncultured marine bacterium
           HF4000_APKG3108]
          Length = 214

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 118/211 (55%), Gaps = 6/211 (2%)

Query: 1   MTTIRVHEGDIPAECAARYV--DAIAVDTETLGL-MPRRDRLCIVQLSPGDGTVDIIRIA 57
           MT I   + DI  +         ++A+DTE  GL +P RD+L +VQ S G+    I++  
Sbjct: 5   MTKIYKFQDDISTDALKELEKHSSLAIDTEGSGLQIPHRDKLSLVQFSAGNNDAYIVQPN 64

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                APN+V +L + K  KI HY R+D++ L Y     V+ +F TKIAS+L RTY+  H
Sbjct: 65  RKSYKAPNIVKILENAKITKIGHYLRYDVSGLEYFLKCNVKNIFDTKIASKLCRTYSQNH 124

Query: 118 GLKDNLKELLGINISKAQQSSDWSAD--DLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           GLKD   E     + K   SSDW+ +  +L+D QLQY ++DV++LH ++    + L R  
Sbjct: 125 GLKDLALEFCSKKLDKRLGSSDWNKNLYELTDAQLQYCSNDVIYLHKIKDALYKMLVREN 184

Query: 176 RSDLATSCCNFLMDRAELDLLGWENVDIFSH 206
           R +L  SC  FL  R +LD  G+   DIF H
Sbjct: 185 RLELYESCIQFLKTRIKLDQSGFAE-DIFQH 214


>gi|15895183|ref|NP_348532.1| ribonuclease D [Clostridium acetobutylicum ATCC 824]
 gi|15024889|gb|AAK79872.1|AE007698_6 Ribonuclease D [Clostridium acetobutylicum ATCC 824]
 gi|325509325|gb|ADZ20961.1| Ribonuclease D [Clostridium acetobutylicum EA 2018]
          Length = 205

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 100/183 (54%), Gaps = 4/183 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IA+DTET GL P +D+LC++Q+   +    I  I     N  NL+G+L   K  KIFH+ 
Sbjct: 26  IAIDTETTGLDPLKDKLCLIQICAKEK---IFLIKYNNSNQKNLIGILQCSKIIKIFHHA 82

Query: 83  RFDIAVLFYTFGV-RVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            FD+  L     +  +  V CTKIA++L      ++ LK  L++ L INI K  Q S+WS
Sbjct: 83  NFDLRFLMKNLKIYNINNVVCTKIAAKLLNGIEIENSLKKLLRKYLNINIDKKLQKSNWS 142

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
           A++L+ EQ+QYA  DV++L  L      +L +     LA  C  +L   A L   G EN+
Sbjct: 143 AENLTKEQIQYATYDVIYLEKLWRALKAELIKANLYSLAEECFKYLPTNAILHNRGIENI 202

Query: 202 DIF 204
            I+
Sbjct: 203 FIY 205


>gi|319950372|ref|ZP_08024289.1| ribonuclease D-like protein [Dietzia cinnamea P4]
 gi|319435942|gb|EFV91145.1| ribonuclease D-like protein [Dietzia cinnamea P4]
          Length = 210

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 108/203 (53%), Gaps = 7/203 (3%)

Query: 3   TIRVHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           T ++ EGDI A     Y+ A  IAVDTET GL    DRL ++QLS       ++R++AG 
Sbjct: 6   THQILEGDIDAPTFEAYISAGRIAVDTETSGLSWAADRLNLIQLSAQSVGGSLVRLSAGA 65

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRL--TRTYTNQHG 118
             AP L  +L      KIFH+  FD+  +      + + + CTK AS+L   +    QH 
Sbjct: 66  --APLLKDLLESRDVVKIFHFAPFDLRFITQLGVAQAQNIRCTKTASKLLDPQLDPKQHS 123

Query: 119 LKDNLKELLGINISKAQ-QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           L+  L   LG+ I+K + ++SDWSA  LSD Q++YA  DV HL  L  +  ++L+     
Sbjct: 124 LRALLLRKLGVEITKGEARTSDWSARSLSDSQIRYALDDVAHLERLHSKLEKELEERSLI 183

Query: 178 DLATSCCNFLMDRAELDLLGWEN 200
           +L    C+++   A L+  G  N
Sbjct: 184 ELYRQICDYIPIDALLETSGVPN 206


>gi|162146523|ref|YP_001600982.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543478|ref|YP_002275707.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785098|emb|CAP54642.1| putative Ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531155|gb|ACI51092.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
          Length = 393

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 92/170 (54%), Gaps = 4/170 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE-KIFHY 81
           +++DTE +        LC+VQL+  D  V +  +A G   AP  +G+L+D+    K+FH 
Sbjct: 34  VSIDTEFVRERTYWPELCLVQLAGQDEVVVVDTLAPGIDLAP--LGVLLDDPEVVKVFHA 91

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            R D+ +  Y FG     +F T++A+ +   + +Q G  + +  L G +I KA + SDWS
Sbjct: 92  ARQDLEIFLYLFGHLPAALFDTQVAA-MVAGFGDQVGYDNLVASLTGAHIDKAHRFSDWS 150

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           A  LS+ Q+ YAA+DV HL  +     E+L+R GR D   S    L D A
Sbjct: 151 ARPLSEAQIAYAAADVTHLRTVYQLLLERLEREGRLDWVASDLAVLSDPA 200


>gi|296117272|ref|ZP_06835863.1| ribonuclease D [Gluconacetobacter hansenii ATCC 23769]
 gi|295976165|gb|EFG82952.1| ribonuclease D [Gluconacetobacter hansenii ATCC 23769]
          Length = 421

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 2/165 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE +        LC+VQL+  D  V +  +A G   AP L  +L DE   K+FH  
Sbjct: 55  ITIDTEFVRERTYWPELCLVQLASADEVVVVDALAPGMDLAP-LGELLADEGVIKVFHAA 113

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  + F    +P+F T++A+ +   Y +Q G    +  ++G  I K+ + SDW+A
Sbjct: 114 RQDLEIFLHLFDRLPQPLFDTQVAA-MVAGYGDQVGYDSLVASVVGAQIDKSHRFSDWAA 172

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             LS  Q++YAA+DV +L  +  +   +L R GR D  T+  + L
Sbjct: 173 RPLSAAQIEYAAADVTYLREVYQRLVAQLDREGRKDWMTAEMDVL 217


>gi|296536446|ref|ZP_06898543.1| ribonuclease D [Roseomonas cervicalis ATCC 49957]
 gi|296263225|gb|EFH09753.1| ribonuclease D [Roseomonas cervicalis ATCC 49957]
          Length = 394

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 79/154 (51%), Gaps = 2/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC+VQL+  +    I   A G   AP L  +L D K  K+FH  
Sbjct: 34  VTVDTEFMRERTYWPELCVVQLAGAEDVAVIDAQAEGLDLAP-LGELLADPKVTKVFHAA 92

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +    FG   RP+F T+IA+ +   + +Q      ++ L G  I KA + SDW+A
Sbjct: 93  RQDVEICILRFGAPPRPLFDTQIAA-MVAGFGDQASYDSLVRALAGAQIDKAHRFSDWAA 151

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS  Q+ YAA+DV HL  +     E+L + GR
Sbjct: 152 RPLSPAQINYAAADVTHLRRVYTALVERLTQEGR 185


>gi|53803525|ref|YP_114794.1| ribonuclease D [Methylococcus capsulatus str. Bath]
 gi|53757286|gb|AAU91577.1| ribonuclease D [Methylococcus capsulatus str. Bath]
          Length = 388

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 90/172 (52%), Gaps = 8/172 (4%)

Query: 10  DIPAECAA--RYVDA---IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           D PAE AA  R +     IAVDTE +       + C++Q++ G     I  +A   ++  
Sbjct: 13  DSPAELAAFCRSIGGSPWIAVDTEFMRDKTYYPKFCLLQIANGTQAACIDPLAI--EDLR 70

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            +  +L +    K+FH  R D+ + F+ F     P+F T++A+ L   +  Q G    + 
Sbjct: 71  EVECLLFNRAITKVFHAARQDLEIFFHRFRAVPAPIFDTQLAAPLV-GHPEQVGYASLVS 129

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            +LG+ + K    +DWS   LS  Q +YAA+DV+HL AL  +  E+L+RLGR
Sbjct: 130 AMLGVTVDKEHTRTDWSQRPLSAAQKEYAANDVIHLAALYPRMREQLERLGR 181


>gi|158425285|ref|YP_001526577.1| ribonuclease D [Azorhizobium caulinodans ORS 571]
 gi|158332174|dbj|BAF89659.1| ribonuclease D [Azorhizobium caulinodans ORS 571]
          Length = 383

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 87/167 (52%), Gaps = 2/167 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE L       +LC++Q++  D  + I  +A G   AP    ++ +EK +K+FH
Sbjct: 21  DFVTVDTEFLRETTFWPKLCVIQVASVDEAIIIDALAEGLDLAP-FFALMGNEKVKKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            GR DI ++++   +   PVF T++A+ +   Y +       ++ + G  I K+ + +DW
Sbjct: 80  AGRQDIEIVWHLAEIIPHPVFDTQVAA-MVLGYGDSISYDQLVQRITGHAIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           S   LS  QL YA +DV HL  +  +  E L+  GR+D      N L
Sbjct: 139 SRRPLSQAQLTYAVADVTHLRDVYKKLMEDLESRGRADWMGEEMNIL 185


>gi|261414901|ref|YP_003248584.1| 3'-5' exonuclease [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261371357|gb|ACX74102.1| 3'-5' exonuclease [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302327506|gb|ADL26707.1| putative ribonuclease D [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 386

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 87/172 (50%), Gaps = 8/172 (4%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D  AVDTE   +     RLC++Q++ G+    I+    G   AP      +   +  IFH
Sbjct: 27  DMAAVDTEADSMYHYTARLCLIQITIGEHHY-IVDPLCGLDLAPLFKARAM---QTLIFH 82

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH-GLKDNLKELLGINISKAQQSSD 139
              +D+ +L+ T+G   + +F T +A+++      QH GL D +KE  G  + K  Q +D
Sbjct: 83  GADYDLRLLWQTYGFSPKSIFDTMLAAKIL---GEQHLGLADLVKEYFGDELKKENQRAD 139

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           W+   LS +  +YA  D  +LH L     EKLQ+ GR +  T  CN L++ A
Sbjct: 140 WTIRPLSLDMCEYAIHDTFYLHELCAILAEKLQQAGRMNWLTEQCNTLIEHA 191


>gi|306842001|ref|ZP_07474675.1| ribonuclease D [Brucella sp. BO2]
 gi|306843696|ref|ZP_07476296.1| ribonuclease D [Brucella sp. BO1]
 gi|306276006|gb|EFM57715.1| ribonuclease D [Brucella sp. BO1]
 gi|306287929|gb|EFM59346.1| ribonuclease D [Brucella sp. BO2]
          Length = 385

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DEK  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEKIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAA-MVCGFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|254718869|ref|ZP_05180680.1| Rnd, ribonuclease D [Brucella sp. 83/13]
 gi|265983854|ref|ZP_06096589.1| ribonuclease D [Brucella sp. 83/13]
 gi|306837628|ref|ZP_07470498.1| ribonuclease D [Brucella sp. NF 2653]
 gi|264662446|gb|EEZ32707.1| ribonuclease D [Brucella sp. 83/13]
 gi|306407277|gb|EFM63486.1| ribonuclease D [Brucella sp. NF 2653]
          Length = 385

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DEK  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEKIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAA-MVCGFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|254419933|ref|ZP_05033657.1| ribonuclease D [Brevundimonas sp. BAL3]
 gi|196186110|gb|EDX81086.1| ribonuclease D [Brevundimonas sp. BAL3]
          Length = 383

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 97/196 (49%), Gaps = 7/196 (3%)

Query: 1   MTTIRVHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           MT I  +E    A+  AR   A  I VDTE +       RLC++Q +  D    I  +A 
Sbjct: 1   MTPITTNEAL--ADFCARLATAPFITVDTEFMRETTYWPRLCLIQAASADHAGIIDPMAE 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G    P L  +L D K  K+FH  R D+ + F   G   RP+F T++A+ +   +  Q  
Sbjct: 59  GLDLEPFL-DLLRDPKIIKVFHACRQDVEI-FVRLGAMPRPMFDTQVAA-MAAGFGEQVA 115

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++++L + + K  + +DW+   LSD QL YA  DV HL AL  +  ++L++ GR D
Sbjct: 116 YDSLVRQMLRVELDKGSRFTDWARRPLSDSQLVYALGDVTHLAALYPKLRDRLKKEGRLD 175

Query: 179 LATSCCNFLMDRAELD 194
              S    L+D A  D
Sbjct: 176 WVMSEMESLIDPALYD 191


>gi|329850483|ref|ZP_08265328.1| ribonuclease D [Asticcacaulis biprosthecum C19]
 gi|328840798|gb|EGF90369.1| ribonuclease D [Asticcacaulis biprosthecum C19]
          Length = 417

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 90/177 (50%), Gaps = 5/177 (2%)

Query: 1   MTTIRVHEGDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           MT I  +  D+ A C A +    I VDTE +       +LC++Q +  D    I  +A  
Sbjct: 1   MTPI-TNTNDLIAFCEAIKSAPFITVDTEFMRETTYWPKLCLIQAASEDHAAIIDPLAKS 59

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
               P L  +L DEK  K+FH  R D+ + F   G    P+F T++A+ +   Y +Q   
Sbjct: 60  LDLKPFL-DILADEKILKVFHACRQDMEI-FVNLGTMPMPIFDTQVAA-MAAGYGDQVAY 116

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
              +++ L I+I K  + +DWS   LSD+QLQYA  DV HL  L  +  ++L R GR
Sbjct: 117 DSLVRQKLKIDIDKGSRFTDWSRRPLSDQQLQYALGDVTHLAKLYPKLRDRLAREGR 173


>gi|82699633|ref|YP_414207.1| 3'-5' exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|82615734|emb|CAJ10730.1| HRDC domain:3'-5' exonuclease:Ribonuclease D [Brucella melitensis
           biovar Abortus 2308]
          Length = 385

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDELAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAA-MVCGFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|256159482|ref|ZP_05457250.1| Rnd, ribonuclease D [Brucella ceti M490/95/1]
 gi|256254768|ref|ZP_05460304.1| Rnd, ribonuclease D [Brucella ceti B1/94]
 gi|261221947|ref|ZP_05936228.1| ribonuclease D [Brucella ceti B1/94]
 gi|265997910|ref|ZP_06110467.1| ribonuclease D [Brucella ceti M490/95/1]
 gi|260920531|gb|EEX87184.1| ribonuclease D [Brucella ceti B1/94]
 gi|262552378|gb|EEZ08368.1| ribonuclease D [Brucella ceti M490/95/1]
          Length = 385

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAAMVC-GFGDAISYDQLMQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|161618719|ref|YP_001592606.1| ribonuclease D [Brucella canis ATCC 23365]
 gi|260566676|ref|ZP_05837146.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335530|gb|ABX61835.1| ribonuclease D [Brucella canis ATCC 23365]
 gi|260156194|gb|EEW91274.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 382

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAAMVC-GFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|23501637|ref|NP_697764.1| ribonuclease D [Brucella suis 1330]
 gi|254704076|ref|ZP_05165904.1| ribonuclease D [Brucella suis bv. 3 str. 686]
 gi|261754734|ref|ZP_05998443.1| ribonuclease D [Brucella suis bv. 3 str. 686]
 gi|23347555|gb|AAN29679.1| ribonuclease D [Brucella suis 1330]
 gi|261744487|gb|EEY32413.1| ribonuclease D [Brucella suis bv. 3 str. 686]
          Length = 385

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAAMVC-GFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|288958469|ref|YP_003448810.1| ribonuclease D [Azospirillum sp. B510]
 gi|288910777|dbj|BAI72266.1| ribonuclease D [Azospirillum sp. B510]
          Length = 396

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 83/169 (49%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L       +LC+VQ+   DG V I  +A G    P L  ++ D    K+FH  
Sbjct: 23  ITVDTEFLREKTYWPQLCLVQVGGPDGAVAIDPLAEGIDLTP-LFALMSDPSVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ + ++  G    P+F T++A+ +   +    G +  + +L G  I K+ + +DWS 
Sbjct: 82  RQDVEIFWHLSGQIPHPLFDTQVAAMVC-GFGESVGYETLVTKLAGARIDKSSRFTDWSH 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             L++ QL YA SDV+HL     +   +L R GRS         L D A
Sbjct: 141 RPLTERQLTYALSDVIHLRPAYEKLKRRLARSGRSHWLEEEMAILTDPA 189


>gi|17987486|ref|NP_540120.1| ribonuclease D [Brucella melitensis bv. 1 str. 16M]
 gi|225852267|ref|YP_002732500.1| ribonuclease D [Brucella melitensis ATCC 23457]
 gi|256044440|ref|ZP_05447344.1| ribonuclease D [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113284|ref|ZP_05454152.1| ribonuclease D [Brucella melitensis bv. 3 str. Ether]
 gi|256264225|ref|ZP_05466757.1| RND family transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|260563791|ref|ZP_05834277.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990860|ref|ZP_06103417.1| ribonuclease D [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994696|ref|ZP_06107253.1| ribonuclease D [Brucella melitensis bv. 3 str. Ether]
 gi|17983183|gb|AAL52384.1| ribonuclease d [Brucella melitensis bv. 1 str. 16M]
 gi|225640632|gb|ACO00546.1| ribonuclease D [Brucella melitensis ATCC 23457]
 gi|260153807|gb|EEW88899.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|262765809|gb|EEZ11598.1| ribonuclease D [Brucella melitensis bv. 3 str. Ether]
 gi|263001644|gb|EEZ14219.1| ribonuclease D [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094471|gb|EEZ18293.1| RND family transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|326408773|gb|ADZ65838.1| ribonuclease D [Brucella melitensis M28]
 gi|326538491|gb|ADZ86706.1| ribonuclease D [Brucella melitensis M5-90]
          Length = 385

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAAMVC-GFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEIAVLTARQTYDL 193


>gi|254689015|ref|ZP_05152269.1| Rnd, ribonuclease D [Brucella abortus bv. 6 str. 870]
 gi|260754508|ref|ZP_05866856.1| ribonuclease D [Brucella abortus bv. 6 str. 870]
 gi|260674616|gb|EEX61437.1| ribonuclease D [Brucella abortus bv. 6 str. 870]
          Length = 384

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAAMVC-GFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|62289703|ref|YP_221496.1| RND, ribonuclease D [Brucella abortus bv. 1 str. 9-941]
 gi|148560669|ref|YP_001258731.1| ribonuclease D [Brucella ovis ATCC 25840]
 gi|163843022|ref|YP_001627426.1| ribonuclease D [Brucella suis ATCC 23445]
 gi|189023953|ref|YP_001934721.1| Rnd, ribonuclease D [Brucella abortus S19]
 gi|225627251|ref|ZP_03785288.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|237815192|ref|ZP_04594190.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|254693498|ref|ZP_05155326.1| Rnd, ribonuclease D [Brucella abortus bv. 3 str. Tulya]
 gi|254697150|ref|ZP_05158978.1| Rnd, ribonuclease D [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701527|ref|ZP_05163355.1| Rnd, ribonuclease D [Brucella suis bv. 5 str. 513]
 gi|254707023|ref|ZP_05168851.1| Rnd, ribonuclease D [Brucella pinnipedialis M163/99/10]
 gi|254709868|ref|ZP_05171679.1| Rnd, ribonuclease D [Brucella pinnipedialis B2/94]
 gi|254713869|ref|ZP_05175680.1| Rnd, ribonuclease D [Brucella ceti M644/93/1]
 gi|254717074|ref|ZP_05178885.1| Rnd, ribonuclease D [Brucella ceti M13/05/1]
 gi|254730046|ref|ZP_05188624.1| Rnd, ribonuclease D [Brucella abortus bv. 4 str. 292]
 gi|256031360|ref|ZP_05444974.1| Rnd, ribonuclease D [Brucella pinnipedialis M292/94/1]
 gi|256060870|ref|ZP_05451030.1| Rnd, ribonuclease D [Brucella neotomae 5K33]
 gi|256257265|ref|ZP_05462801.1| Rnd, ribonuclease D [Brucella abortus bv. 9 str. C68]
 gi|256369183|ref|YP_003106691.1| ribonuclease D [Brucella microti CCM 4915]
 gi|260168494|ref|ZP_05755305.1| ribonuclease D [Brucella sp. F5/99]
 gi|260545541|ref|ZP_05821282.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260757729|ref|ZP_05870077.1| ribonuclease D [Brucella abortus bv. 4 str. 292]
 gi|260761554|ref|ZP_05873897.1| ribonuclease D [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883537|ref|ZP_05895151.1| ribonuclease D [Brucella abortus bv. 9 str. C68]
 gi|261213756|ref|ZP_05928037.1| ribonuclease D [Brucella abortus bv. 3 str. Tulya]
 gi|261218885|ref|ZP_05933166.1| ribonuclease D [Brucella ceti M13/05/1]
 gi|261314491|ref|ZP_05953688.1| ribonuclease D [Brucella pinnipedialis M163/99/10]
 gi|261317409|ref|ZP_05956606.1| ribonuclease D [Brucella pinnipedialis B2/94]
 gi|261321616|ref|ZP_05960813.1| ribonuclease D [Brucella ceti M644/93/1]
 gi|261324867|ref|ZP_05964064.1| ribonuclease D [Brucella neotomae 5K33]
 gi|261752075|ref|ZP_05995784.1| ribonuclease D [Brucella suis bv. 5 str. 513]
 gi|261757962|ref|ZP_06001671.1| ribonuclease D [Brucella sp. F5/99]
 gi|265988446|ref|ZP_06101003.1| ribonuclease D [Brucella pinnipedialis M292/94/1]
 gi|297248110|ref|ZP_06931828.1| ribonuclease D [Brucella abortus bv. 5 str. B3196]
 gi|62195835|gb|AAX74135.1| Rnd, ribonuclease D [Brucella abortus bv. 1 str. 9-941]
 gi|148371926|gb|ABQ61905.1| ribonuclease D [Brucella ovis ATCC 25840]
 gi|163673745|gb|ABY37856.1| ribonuclease D [Brucella suis ATCC 23445]
 gi|189019525|gb|ACD72247.1| Rnd, ribonuclease D [Brucella abortus S19]
 gi|225617256|gb|EEH14301.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|237790029|gb|EEP64239.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|255999343|gb|ACU47742.1| ribonuclease D [Brucella microti CCM 4915]
 gi|260096948|gb|EEW80823.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260668047|gb|EEX54987.1| ribonuclease D [Brucella abortus bv. 4 str. 292]
 gi|260671986|gb|EEX58807.1| ribonuclease D [Brucella abortus bv. 2 str. 86/8/59]
 gi|260873065|gb|EEX80134.1| ribonuclease D [Brucella abortus bv. 9 str. C68]
 gi|260915363|gb|EEX82224.1| ribonuclease D [Brucella abortus bv. 3 str. Tulya]
 gi|260923974|gb|EEX90542.1| ribonuclease D [Brucella ceti M13/05/1]
 gi|261294306|gb|EEX97802.1| ribonuclease D [Brucella ceti M644/93/1]
 gi|261296632|gb|EEY00129.1| ribonuclease D [Brucella pinnipedialis B2/94]
 gi|261300847|gb|EEY04344.1| ribonuclease D [Brucella neotomae 5K33]
 gi|261303517|gb|EEY07014.1| ribonuclease D [Brucella pinnipedialis M163/99/10]
 gi|261737946|gb|EEY25942.1| ribonuclease D [Brucella sp. F5/99]
 gi|261741828|gb|EEY29754.1| ribonuclease D [Brucella suis bv. 5 str. 513]
 gi|264660643|gb|EEZ30904.1| ribonuclease D [Brucella pinnipedialis M292/94/1]
 gi|297175279|gb|EFH34626.1| ribonuclease D [Brucella abortus bv. 5 str. B3196]
          Length = 385

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++ G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAAMVC-GFGDAISYDQLVQKVTGKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|139437245|ref|ZP_01771405.1| Hypothetical protein COLAER_00384 [Collinsella aerofaciens ATCC
           25986]
 gi|133776892|gb|EBA40712.1| Hypothetical protein COLAER_00384 [Collinsella aerofaciens ATCC
           25986]
          Length = 377

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 86/164 (52%), Gaps = 7/164 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQL-SPGDGT-VDIIRIAAGQKNAPNLVGMLVDEK 74
           AR  DAIAVDTE L       RLC+VQ+ +P +   VD + I     +   L  ++ DE 
Sbjct: 16  AREFDAIAVDTEFLRERTFHPRLCLVQIATPAESVAVDPLVI----DDLSPLAELMADES 71

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+FH    D+ V+ +T GV  RP+F T++A+        Q      ++   G+++ K 
Sbjct: 72  VTKVFHACSQDMEVMLHTVGVLPRPIFDTQVAAAFL-GERQQISYGALVQTFCGVSLPKT 130

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           +  +DWS   L+D+Q++YA  DV +L     +   +L+ LGR D
Sbjct: 131 ESLTDWSRRPLTDKQIEYAIDDVKYLIVAYTEMMSRLRELGRVD 174


>gi|115525280|ref|YP_782191.1| ribonuclease D [Rhodopseudomonas palustris BisA53]
 gi|115519227|gb|ABJ07211.1| ribonuclease D [Rhodopseudomonas palustris BisA53]
          Length = 392

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 89/194 (45%), Gaps = 7/194 (3%)

Query: 13  AECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGML 70
           A   AR+     I VDTE L        LC+VQ++  D  V I  +A G    P    ++
Sbjct: 11  AAACARFAKQPVITVDTEFLRETTYYPLLCVVQIASADEAVVIDSLAPGIDLKP-FFELM 69

Query: 71  VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGIN 130
            DE   K+FH  R DI ++++  G+   P+F T++A+ +   Y +       ++ + G  
Sbjct: 70  ADEHVLKVFHAARQDIEIVWHRAGILPHPIFDTQVAA-MVLGYGDSIAYDQLVERITGHR 128

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             K  + +DWS   L++EQ+ YA SDV HL  +       L++ GRSD  +     L   
Sbjct: 129 PDKTHRFTDWSRRPLTEEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEILTSP 188

Query: 191 AELDL---LGWENV 201
              D      WE +
Sbjct: 189 KTYDFHPERAWERL 202


>gi|288870561|ref|ZP_06409803.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
 gi|288866720|gb|EFC99018.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
          Length = 653

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 89/188 (47%), Gaps = 10/188 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTET GL P  DRL ++Q+S     V +I  AA   +    +  L++   EKIFH  
Sbjct: 99  LAIDTETTGLDPHSDRLRLIQISAPGIPVLVIDCAAFLPDGFACLKELLNTPSEKIFHNA 158

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN--QHGLKDNLKELLGINISKAQQSSDW 140
           RFD+  L    G+   PVF T +A++L R      + GL       LGI + K +Q+  W
Sbjct: 159 RFDLQFLM-GIGIDCFPVFDTMLAAQLLRPCGGPLKAGLAVVADHYLGIKLDKTEQTGSW 217

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQR--LGRSDLATSCCNFLMDRAE-----L 193
            +  L+  QL YAA D   L  L       L R  LGR+      C   + R E     L
Sbjct: 218 DSASLTGSQLAYAALDAWILLKLYDVMNPLLARHGLGRTASIEFACVSAIARTEYDGINL 277

Query: 194 DLLGWENV 201
           DL  W+ +
Sbjct: 278 DLEKWDEL 285


>gi|327194287|gb|EGE61150.1| ribonuclease III protein [Rhizobium etli CNPAF512]
          Length = 381

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (49%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D I +DTE L        LC++Q++     V +  +A G   AP    ++ D K  K+FH
Sbjct: 19  DFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAP-FFELMADTKVLKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F    +   P+F T++A+ +   + +       +  +  ++I K+ + +DW
Sbjct: 78  AARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIKNVHIDKSSRFTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           S   LSD+QL+YA +DV HL  + L    +L R GR+   T   N L  R   D+
Sbjct: 137 SRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLTEEMNILEARETYDM 191


>gi|190891177|ref|YP_001977719.1| ribonuclease III protein [Rhizobium etli CIAT 652]
 gi|190696456|gb|ACE90541.1| ribonuclease III protein [Rhizobium etli CIAT 652]
          Length = 381

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (49%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D I +DTE L        LC++Q++     V +  +A G   AP    ++ D K  K+FH
Sbjct: 19  DFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAP-FFELMADTKVLKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F    +   P+F T++A+ +   + +       +  +  ++I K+ + +DW
Sbjct: 78  AARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIKNVHIDKSSRFTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           S   LSD+QL+YA +DV HL  + L    +L R GR+   T   N L  R   D+
Sbjct: 137 SRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLTEEMNILEARETYDM 191


>gi|329890110|ref|ZP_08268453.1| ribonuclease D [Brevundimonas diminuta ATCC 11568]
 gi|328845411|gb|EGF94975.1| ribonuclease D [Brevundimonas diminuta ATCC 11568]
          Length = 384

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 89/174 (51%), Gaps = 6/174 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQL--SPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           I VDTE +       +LC++Q   SP D  + I  +A G    P  + +L DE   K+FH
Sbjct: 23  ITVDTEFMRETTYWPKLCLIQAAASPTDAAI-IDPMAEGLDLEP-FLDILRDESILKVFH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R D+ + F   G   RP+F T++A+ +   + +Q   +  ++++L   + K  + +DW
Sbjct: 81  AARQDVEI-FNKLGAMPRPLFDTQVAA-MAAGFGDQVSYEALVRQMLRQELDKGSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
           +   LSD QL YA  DV HL AL  +  ++LQ+ GR D   S    + D A  D
Sbjct: 139 ARRPLSDAQLTYALGDVTHLSALYPKLRDRLQKEGRLDWVMSEMGAVTDPALYD 192


>gi|86749614|ref|YP_486110.1| ribonuclease D [Rhodopseudomonas palustris HaA2]
 gi|86572642|gb|ABD07199.1| ribonuclease D [Rhodopseudomonas palustris HaA2]
          Length = 382

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 85/182 (46%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L        LC+VQ++  D  V +  +A G    P    ++ +E   K+FH  
Sbjct: 23  ITVDTEFLRETTYYPLLCVVQMASRDEAVVVDTLAPGIDLKP-FFDLMANENVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   Y +       ++ + G    K  + +DWS 
Sbjct: 82  RQDIEIVWHRAGIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERITGHRPDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGWE 199
             L+DEQL YA SDV HL  +       L++ GRSD  +     L      D      WE
Sbjct: 141 RPLTDEQLHYAVSDVTHLRDVFAALDADLKQRGRSDWVSEEMEVLTSPKTYDFHPESAWE 200

Query: 200 NV 201
            +
Sbjct: 201 RL 202


>gi|294852115|ref|ZP_06792788.1| ribonuclease D [Brucella sp. NVSL 07-0026]
 gi|294820704|gb|EFG37703.1| ribonuclease D [Brucella sp. NVSL 07-0026]
          Length = 385

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 90/175 (51%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADEEIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF T++A+ +   + +       ++++   ++ K+ + +DW
Sbjct: 80  AARQDIEIVFHLGNLIPSPVFDTQVAAMVC-GFGDAISYDQLVQKVTSKHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193


>gi|254454077|ref|ZP_05067514.1| ribonuclease D [Octadecabacter antarcticus 238]
 gi|198268483|gb|EDY92753.1| ribonuclease D [Octadecabacter antarcticus 238]
          Length = 395

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 91/180 (50%), Gaps = 7/180 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS----PGDGTVDIIRIAAGQKNAPNLVGMLV 71
           AA+Y   + VDTE L       +LC++QL+     GD  V +  +A G   AP L  +  
Sbjct: 27  AAKY-PYVTVDTEFLRERTYYSKLCLIQLAYMGEGGDDAVLVDPLAEGLDLAP-LYELFK 84

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           DE   K+FH  R D+ + F   G+  +P+F T++A+ +   +  Q G +  ++++   N+
Sbjct: 85  DENVVKVFHAARQDLEIFFVDQGIIPKPLFDTQVAAMVC-GFGEQAGYETLVRKIAKDNV 143

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
            K+ + +DWS   L+D Q  YA +DV HL  +    + +L++ GR          L D A
Sbjct: 144 DKSSRFTDWSRRPLTDAQKTYALADVTHLRVIYENLSAELEKSGRKKWVAEEMAVLNDPA 203


>gi|330991792|ref|ZP_08315742.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
 gi|329761260|gb|EGG77754.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
          Length = 395

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 92/182 (50%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTE +        LC+VQL+ G+  V +I   A   +  +L G+L D    K+FH  
Sbjct: 34  VTIDTEFVRERTYWPELCLVQLA-GENDVVVIDTTAPGIDLSSLGGLLDDAGVIKVFHAA 92

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  + F      +F T++A+ +   Y +Q G  + +  LLG+ I K+ + SDWS 
Sbjct: 93  RQDLEIFLHLFDRLPAALFDTQVAA-MVAGYGDQVGYDNLVWSLLGVQIDKSHRFSDWSV 151

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL---DLLGWE 199
             LS  Q+ YAA+DV +L  +  Q   +L++ GR D   +  + L + A      L  WE
Sbjct: 152 RPLSAAQIGYAAADVTYLRQVYGQLLAQLEKEGRLDWVAAELDVLNNPATFRPDPLTLWE 211

Query: 200 NV 201
            +
Sbjct: 212 KM 213


>gi|153009869|ref|YP_001371084.1| ribonuclease D [Ochrobactrum anthropi ATCC 49188]
 gi|151561757|gb|ABS15255.1| ribonuclease D [Ochrobactrum anthropi ATCC 49188]
          Length = 385

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 89/175 (50%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE   K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAP-FFRLMADETIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF +++A+ +   + +       ++++ G  I K+ + +DW
Sbjct: 80  AARQDIEIVFHLGDLIPSPVFDSQVAAMVC-GFGDAISYDQLVQKVTGKQIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LSD+QL YA +DV +L  + L   E+L++ GRS+        L  R   D+
Sbjct: 139 RRRPLSDKQLDYALADVTYLRDIYLYLKEELEKEGRSEWVNEEMAVLTSRETYDM 193


>gi|197105155|ref|YP_002130532.1| ribonuclease D [Phenylobacterium zucineum HLK1]
 gi|196478575|gb|ACG78103.1| ribonuclease D [Phenylobacterium zucineum HLK1]
          Length = 392

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 86/173 (49%), Gaps = 3/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE +       +LC++Q +       +I   A   +    + +L DE  +K+FH  
Sbjct: 23  VAVDTEFMRETTYWPKLCLIQAAAPSAEA-VIDPLADDIDLSCFLDILRDESIQKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ + F   G   +P+F T++A  +   +  Q      ++++L I I K+ + +DW+ 
Sbjct: 82  RQDVEI-FNNLGAMPKPLFDTQVAG-MAAGFGEQIAYDALVRQMLKIEIDKSSRFTDWAR 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             LSD QL YA +DV HL  L     ++L+R GR    T   N L D A  D+
Sbjct: 140 RPLSDSQLTYALADVTHLAKLYPLLRQRLEREGRLAWVTDEMNDLTDPANYDV 192


>gi|239831578|ref|ZP_04679907.1| ribonuclease D [Ochrobactrum intermedium LMG 3301]
 gi|239823845|gb|EEQ95413.1| ribonuclease D [Ochrobactrum intermedium LMG 3301]
          Length = 385

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 91/175 (52%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++  + T  +  +A G   AP    ++ DEK  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMASPNHTALVDALAPGLDLAP-FFSLMADEKVVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F+   +   PVF +++A+ +   + +       ++++ G +I K+ + +DW
Sbjct: 80  AARQDIEIVFHLGDLIPSPVFDSQVAAMVC-GFGDAISYDQLVQKVTGKHIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
               LS++QL YA +DV +L  + L   ++L++ GRS+        L  R   DL
Sbjct: 139 RRRPLSEKQLDYALADVTYLRDIYLYLKQELEKEGRSEWVNEEMAVLTSRETYDL 193


>gi|298291118|ref|YP_003693057.1| ribonuclease D [Starkeya novella DSM 506]
 gi|296927629|gb|ADH88438.1| ribonuclease D [Starkeya novella DSM 506]
          Length = 385

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 85/156 (54%), Gaps = 2/156 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L       +LC+VQL+  +  + +  +A G   AP    ++ DEK  K+FH G
Sbjct: 23  ITVDTEFLRETTFWPKLCVVQLASVEEAIVVDAVADGIDLAP-FFALMSDEKVLKVFHAG 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   PVF T++A+ +   + +       ++ + G  + K+ + +DWS 
Sbjct: 82  RQDIEIVWHLAGIIPHPVFDTQVAA-MVLGHGDSISYDQLVQRITGEVLDKSLRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             LS  Q+ YA +DV HL  + L+    L++ GR+D
Sbjct: 141 RPLSAAQIAYAEADVTHLRDVFLKLDADLKKRGRAD 176


>gi|209548705|ref|YP_002280622.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534461|gb|ACI54396.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 381

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 87/175 (49%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D I +DTE L        LC++Q++     V +  +A G   AP    ++ D K  K+FH
Sbjct: 19  DFITIDTEFLRETTFWPELCLIQMASPTTEVLVDPLAKGIDLAP-FFELMADPKVLKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F    +   P+F T++A+ +   + +       +  +  ++I K+ + +DW
Sbjct: 78  AARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIKNVHIDKSSRFTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           S   LSD+QL+YA +DV HL  + L    +L R GR+   +   + L  R   DL
Sbjct: 137 SRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLSEEMDILEARETYDL 191


>gi|254439069|ref|ZP_05052563.1| ribonuclease D [Octadecabacter antarcticus 307]
 gi|198254515|gb|EDY78829.1| ribonuclease D [Octadecabacter antarcticus 307]
          Length = 395

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 91/180 (50%), Gaps = 7/180 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDII---RIAAGQKNAPNLVGMLV 71
           AA+Y   + VDTE L       +LC++QL+  GDG  D +    +A G   AP L  +  
Sbjct: 27  AAKY-PYVTVDTEFLRERTYYSKLCLIQLAYMGDGDDDAVLLDPLANGLDLAP-LYDLFK 84

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           DE   K+FH  R D+ + F   G+  +P+F T++A+ +   +  Q G +  ++++   N+
Sbjct: 85  DENVVKVFHAARQDLEIFFVDQGIIPKPLFDTQVAAMVC-GFGEQAGYETLVRKIAKDNV 143

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
            K+ + +DWS   LSD Q  YA +DV HL  +    + +L + GR          L D A
Sbjct: 144 DKSSRFTDWSRRPLSDAQKTYALADVTHLRVIYEYLSAELDKSGRKKWVAEEMAVLNDPA 203


>gi|257063921|ref|YP_003143593.1| ribonuclease D [Slackia heliotrinireducens DSM 20476]
 gi|256791574|gb|ACV22244.1| ribonuclease D [Slackia heliotrinireducens DSM 20476]
          Length = 392

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 85/166 (51%), Gaps = 3/166 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +LC++QL+  +  V +  +     +A N+  +  DE   
Sbjct: 15  ARAHKVLAIDTEFMREKTYWPKLCLIQLATPERAVAVDPLRLHDLSALNV--LFQDENIL 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ ++    G    P+F T+IA+ L   +T Q G    +   LG+++ KA  
Sbjct: 73  KLFHASRQDLEIINIEMGCLPAPIFDTQIAAALL-GHTTQIGYGPLVMNELGVHLKKADS 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            +DWS   L+  QLQYA  DV++L  L    + KL++L R D   S
Sbjct: 132 YTDWSRRPLTKSQLQYALDDVIYLPKLYDSMSRKLKKLNRMDWLAS 177


>gi|116251369|ref|YP_767207.1| ribonuclease D [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256017|emb|CAK07098.1| putative ribonuclease D [Rhizobium leguminosarum bv. viciae 3841]
          Length = 381

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 9   GDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP   
Sbjct: 6   ADLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTTEVLVDPLAKGIDLAP-FF 64

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ D K  K+FH  R DI ++F    +   P+F T++A+ +   + +       +  + 
Sbjct: 65  ELMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIK 123

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            ++I K+ + +DWS   LSD+QL YA +DV HL  + L    +L R GRS   +   + L
Sbjct: 124 NVHIDKSSRFTDWSRRPLSDKQLDYALADVTHLRDVYLSLKAELDREGRSSWLSEEMDIL 183

Query: 188 MDRAELDL 195
             R   D+
Sbjct: 184 ESRETYDM 191


>gi|269215504|ref|ZP_06159358.1| ribonuclease D [Slackia exigua ATCC 700122]
 gi|269130991|gb|EEZ62066.1| ribonuclease D [Slackia exigua ATCC 700122]
          Length = 399

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 85/163 (52%), Gaps = 7/163 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV--DIIRIAAGQKNAPNLVGMLVDEK 74
           AR  D +A+DTE L       +LC++QL   + +V  D +++     +   L  ++VD  
Sbjct: 18  ARTCDVVAIDTEFLRERCYWAKLCLIQLGTDERSVVVDPLKV----HDLSPLRDLMVDTS 73

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+FH    D+ +LF+   V   P+F T++A+ L    T Q G    +    G+ + KA
Sbjct: 74  VVKVFHAATQDLDILFHELDVMPDPIFDTQVAAALL-GQTVQVGYGTLVLNECGVRLKKA 132

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
              +DW+   LS  Q+ YA  DVV+L  +  Q TE+L+ LGR+
Sbjct: 133 DSFTDWARRPLSSSQINYALEDVVYLPRIYRQLTERLEALGRA 175


>gi|114326875|ref|YP_744031.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
 gi|114315049|gb|ABI61109.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
          Length = 429

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 86/176 (48%), Gaps = 5/176 (2%)

Query: 3   TIRVHEGDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           T+     D+ A C   R    + +DTE +        LC+VQL   D    I  +A    
Sbjct: 47  TLITKSEDLAALCTTLRREPYVTIDTEFMRERTYWPELCVVQLGGADCVAVIDTLAPELD 106

Query: 62  NAPNLVG-MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            AP  VG +L D    K+FH  R DI +    FG   +P+F T++A+ +   + +Q G  
Sbjct: 107 LAP--VGELLADPAVIKVFHACRQDIEIFLLRFGSIPQPMFDTQVAA-MVAGFGDQVGYD 163

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             +  L G +I KA + SDWS   LS  Q+ YAA+DV HL  +     ++L++ GR
Sbjct: 164 TLVSSLTGGHIDKAHRFSDWSRRPLSQAQIDYAAADVTHLRGVYETLRDRLEKEGR 219


>gi|90423836|ref|YP_532206.1| ribonuclease D [Rhodopseudomonas palustris BisB18]
 gi|90105850|gb|ABD87887.1| ribonuclease D [Rhodopseudomonas palustris BisB18]
          Length = 384

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 86/183 (46%), Gaps = 5/183 (2%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           AI VDTE L        LC+VQ++  +  V +  +A G    P    ++ ++   K+FH 
Sbjct: 22  AITVDTEFLRETTYYPLLCVVQMASAEDAVVVDTLAPGIDLKP-FFDLMANDDVLKVFHA 80

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            R DI ++++  G+   P+F T++A+ +   Y +       ++ + G    K  + +DW+
Sbjct: 81  ARQDIEIVWHRAGIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERITGHRPDKTHRFTDWA 139

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGW 198
              L+DEQL YA SDV HL  +       L++ GRSD  +     L      D      W
Sbjct: 140 RRPLTDEQLHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTSPKTYDFHPERAW 199

Query: 199 ENV 201
           E +
Sbjct: 200 ERL 202


>gi|241203984|ref|YP_002975080.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857874|gb|ACS55541.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 381

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 86/175 (49%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D I +DTE L        LC++Q++     V +  +A G   AP    ++ D K  K+FH
Sbjct: 19  DFITIDTEFLRETTFWPELCLIQMASPRTEVLVDPLAKGIDLAP-FFELMADTKVLKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F    +   P+F T++A+ +   + +       +  +  ++I K+ + +DW
Sbjct: 78  AARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIKNVHIDKSSRFTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           S   LSD+QL YA +DV HL  + L    +L R GRS   +   + L  R   D+
Sbjct: 137 SRRPLSDKQLDYALADVTHLRDVYLSLKAELDREGRSSWLSEEMDILESRETYDM 191


>gi|218670444|ref|ZP_03520115.1| ribonuclease III protein [Rhizobium etli GR56]
          Length = 212

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 91/188 (48%), Gaps = 3/188 (1%)

Query: 9   GDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP   
Sbjct: 6   ADLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAP-FF 64

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ D K  K+FH  R DI ++F    +   P+F T++A+ +   + +       +  + 
Sbjct: 65  ELMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIK 123

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            ++I K+ + +DWS   LSD+QL+YA +DV HL  + L    +L R GR+   +   + L
Sbjct: 124 SVHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLSEEMDIL 183

Query: 188 MDRAELDL 195
             R   D+
Sbjct: 184 EARETYDM 191


>gi|91977418|ref|YP_570077.1| ribonuclease D [Rhodopseudomonas palustris BisB5]
 gi|91683874|gb|ABE40176.1| ribonuclease D [Rhodopseudomonas palustris BisB5]
          Length = 392

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 84/182 (46%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L        LC+VQ++  D  V +  +A G    P    ++ +E   K+FH  
Sbjct: 23  ITVDTEFLRETTYYPLLCVVQMASPDEAVVVDTLAPGIDLKP-FFDLMANENVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   Y +       ++ + G    K  + +DWS 
Sbjct: 82  RQDIEIVWHRAGIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERITGHRPDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGWE 199
             L+DEQL YA SDV HL  +       L++  RSD  +     L      D      WE
Sbjct: 141 RPLTDEQLHYAVSDVTHLRDVFAALDADLKKRDRSDWVSEEMEILTSPKTYDFHPESAWE 200

Query: 200 NV 201
            +
Sbjct: 201 RL 202


>gi|163868507|ref|YP_001609716.1| hypothetical protein Btr_1359 [Bartonella tribocorum CIP 105476]
 gi|161018163|emb|CAK01721.1| Ribonuclease D [Bartonella tribocorum CIP 105476]
          Length = 384

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 91/180 (50%), Gaps = 2/180 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R  D + VDTE +       +LC++QL+  D TV I  IA      P    +++D+K 
Sbjct: 17  ALRNSDFVTVDTEFIRETTFWPQLCLIQLASPDVTVLIDPIAPDIDLQP-FFDLMIDKKI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI  ++Y  GV   P+F T+IA  +   + +       ++   G ++ K+ 
Sbjct: 76  VKVFHSARQDIETIYYLGGVIPSPLFDTQIAGSIC-GFGDSISYDQIVQHCTGHHLDKSS 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DWS   LS++QL YA +DV +L  + L   ++L++  R+         L++    D+
Sbjct: 135 RFTDWSCRPLSEKQLLYALADVTYLRDVYLLLKKRLEKNQRTHWMDDEVTILLNPKTYDM 194


>gi|148261351|ref|YP_001235478.1| ribonuclease D [Acidiphilium cryptum JF-5]
 gi|146403032|gb|ABQ31559.1| ribonuclease D [Acidiphilium cryptum JF-5]
          Length = 392

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 77/169 (45%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC+VQL   +    I   A G   AP L  +  +    K+FH  
Sbjct: 32  VTVDTEFMREKTYFPELCVVQLGGANDVAVIDAQAEGLDLAP-LGALFANPAVTKVFHAC 90

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI +    FG    P+F T++A+ +   + +Q G    +  L G  I KA + SDWSA
Sbjct: 91  RQDIEIFLLKFGAVPAPLFDTQVAA-MVAGFGDQVGYDTLVSSLAGGRIDKAHRFSDWSA 149

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             LS  Q+ YAA+DV  L  +      +L R GR D        L D A
Sbjct: 150 RPLSRAQIAYAAADVTWLRPVYEGLRARLTREGRLDWVAEEAAVLADPA 198


>gi|256827062|ref|YP_003151021.1| ribonuclease D [Cryptobacterium curtum DSM 15641]
 gi|256583205|gb|ACU94339.1| ribonuclease D [Cryptobacterium curtum DSM 15641]
          Length = 399

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 84/163 (51%), Gaps = 5/163 (3%)

Query: 16  AARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A R +D+  +A+DTE L       RLC++Q+   D T+ +   A        L  +    
Sbjct: 31  AKRALDSSVLAIDTEFLREKTYYARLCLLQMQTDDETIIVDPFAVSDLGV--LAPLFQSS 88

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              KI H GR D+ +L    G+  +P+F T++A+ L   +T Q G    +  + G+ ++K
Sbjct: 89  SIMKIVHSGRQDLEILNREVGLLPQPLFDTQVAAALL-GHTQQIGYGSLVSAVCGVQLAK 147

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
               +DWS   LS  Q+ YAA DV++L  L    T++L+RLGR
Sbjct: 148 MDSFTDWSRRPLSASQISYAADDVIYLPQLYHTMTDELERLGR 190


>gi|326404838|ref|YP_004284920.1| ribonuclease D [Acidiphilium multivorum AIU301]
 gi|325051700|dbj|BAJ82038.1| ribonuclease D [Acidiphilium multivorum AIU301]
          Length = 392

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 77/169 (45%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC+VQL   +    I   A G   AP L  +  +    K+FH  
Sbjct: 32  VTVDTEFMREKTYFPELCVVQLGGANDVAVIDAQAEGLDLAP-LGALFANPAVTKVFHAC 90

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI +    FG    P+F T++A+ +   + +Q G    +  L G  I KA + SDWSA
Sbjct: 91  RQDIEIFLLKFGAVPTPLFDTQVAA-MVAGFGDQVGYDTLVSSLAGGRIDKAHRFSDWSA 149

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             LS  Q+ YAA+DV  L  +      +L R GR D        L D A
Sbjct: 150 RPLSRAQIAYAAADVTWLRPVYEGLRARLTREGRLDWVAEEAAVLADPA 198


>gi|144899165|emb|CAM76029.1| Ribonuclease D [Magnetospirillum gryphiswaldense MSR-1]
          Length = 406

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 81/156 (51%), Gaps = 2/156 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE +       +LC+VQL+  D    +  +A G   AP L  ++ +    K+FH  
Sbjct: 30  ITVDTEFMREKTYYPQLCLVQLAGPDEARAVDPLAPGMDLAP-LFELMANPNVLKVFHAA 88

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  +  G    P+F T++A+ +   + +  G +    +L    I K+Q+ +DW+ 
Sbjct: 89  RQDVEIFLHLSGAVPAPLFDTQVAAMVC-GFGDSVGYETLASQLAKARIDKSQRFTDWAL 147

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             L+++Q+QYA +DV HL     +   KL+R GR D
Sbjct: 148 RPLTEKQVQYALADVTHLRVAYEKLVRKLERNGRLD 183


>gi|189426679|ref|YP_001953856.1| 3'-5' exonuclease [Geobacter lovleyi SZ]
 gi|189422938|gb|ACD97336.1| 3'-5' exonuclease [Geobacter lovleyi SZ]
          Length = 381

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 85/168 (50%), Gaps = 8/168 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+D E   +   R+++C++QLS   GT  VD +R++    +   L  +L       + H
Sbjct: 28  LALDLEADSMHHYREKVCLLQLSNRAGTWLVDPLRLS----DLSPLRVLLARPGLRTVLH 83

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G +DI  L   FG+ V+ +F T +A++ T     + GL   L+E  GI + K  Q +DW
Sbjct: 84  GGDYDIRSLHRDFGIVVQQMFDTMVAAQFT--GATEFGLAALLREHFGIELDKRFQKADW 141

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           S   L+ E   YAA D  HL  L  +   +L++LGR +     C  L+
Sbjct: 142 SKRPLTTEMADYAAHDTAHLLELADRLHARLEQLGRREWVAEECALLV 189


>gi|218515424|ref|ZP_03512264.1| ribonuclease III protein [Rhizobium etli 8C-3]
          Length = 177

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 9   GDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP   
Sbjct: 6   ADLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAP-FF 64

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ D K  K+FH  R DI ++F    +   P+F T++A+ +   + +       +  + 
Sbjct: 65  ELMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIK 123

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++I K+ + +DWS   LSD+QL+YA +DV HL  + L    +L R GR+   T
Sbjct: 124 NVHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLT 177


>gi|302383325|ref|YP_003819148.1| ribonuclease D [Brevundimonas subvibrioides ATCC 15264]
 gi|302193953|gb|ADL01525.1| ribonuclease D [Brevundimonas subvibrioides ATCC 15264]
          Length = 382

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 81/160 (50%), Gaps = 3/160 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTE +       +LC++Q +       I   A G    P  + +L D    K+FH  
Sbjct: 23  IAVDTEFMRETTYWPKLCLIQAATPTHEAIIDPQADGLDLTP-FLDILRDPAIVKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D  + F   G   +P+F T++A+ +   + +Q      ++++L I++ K  + +DWS 
Sbjct: 82  RQDTEI-FVKLGAMPKPMFDTQVAA-MAAGFGDQVAYDGLVRQMLKIDLDKGSRFTDWSR 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
             LSD QL YA  DV HL AL  +  ++L R GR D  TS
Sbjct: 140 RPLSDAQLTYAIGDVTHLAALYPKLRDRLAREGRLDWVTS 179


>gi|257791482|ref|YP_003182088.1| ribonuclease D [Eggerthella lenta DSM 2243]
 gi|317490632|ref|ZP_07949102.1| ribonuclease D [Eggerthella sp. 1_3_56FAA]
 gi|325831419|ref|ZP_08164673.1| ribonuclease D [Eggerthella sp. HGA1]
 gi|257475379|gb|ACV55699.1| ribonuclease D [Eggerthella lenta DSM 2243]
 gi|316910256|gb|EFV31895.1| ribonuclease D [Eggerthella sp. 1_3_56FAA]
 gi|325486673|gb|EGC89121.1| ribonuclease D [Eggerthella sp. HGA1]
          Length = 381

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 3/160 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A +   +A+DTE L       +LC++QL+  D T  +   A        L  +L +E   
Sbjct: 16  AMHSSVLAIDTEFLREKTYYAKLCLIQLATDDETAIVDPFAVDDLKV--LAPVLRNENVM 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH G  D+ +L    GV   P+F T++A+ L   +T Q G    +    G+ + K   
Sbjct: 74  KLFHAGNQDLEILLREVGVLPHPLFDTQVAAALL-GHTQQIGYAALVHAECGVTLKKIDS 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            +DWS   LSD QL+YAA DVV+L  +  +   +L  LGR
Sbjct: 133 FTDWSRRPLSDSQLEYAADDVVYLPRMYERMRAQLVELGR 172


>gi|87199358|ref|YP_496615.1| ribonuclease D [Novosphingobium aromaticivorans DSM 12444]
 gi|87135039|gb|ABD25781.1| ribonuclease D [Novosphingobium aromaticivorans DSM 12444]
          Length = 405

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 85/159 (53%), Gaps = 3/159 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD-EKREKIF 79
           D + VDTE +        LC+VQ++       I  +A G   +P L+ +LVD E   K+F
Sbjct: 24  DFVTVDTEFMRENTYWPELCLVQIADDKEAAAIDPLAPGLDMSP-LLDLLVDNEDVLKVF 82

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H G  D+ +++   G    P+F T+IA  +  + + Q G  + ++  LG++I K  + +D
Sbjct: 83  HAGGQDVEIIYNLTGKTPHPIFDTQIAM-MAVSQSEQIGYSNLVESWLGLSIDKGARFTD 141

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           WS   L++ Q++YA  DV HL  +  +  ++L + GR +
Sbjct: 142 WSRRPLTERQIEYAIGDVTHLSKIFPKLLKRLIKTGRGE 180


>gi|254466167|ref|ZP_05079578.1| ribonuclease D [Rhodobacterales bacterium Y4I]
 gi|206687075|gb|EDZ47557.1| ribonuclease D [Rhodobacterales bacterium Y4I]
          Length = 385

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 94/192 (48%), Gaps = 9/192 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI---AAGQKNAPNLVGMLVDEKREKI 78
           + VDTE L       +LC++QL+  G+G  D + +   A G    P L  +  DE   K+
Sbjct: 23  VTVDTEFLRERTYYSKLCLIQLAFSGNGEDDAVLVDPLADGISLEP-LYALFRDENVVKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ + +   GV  +P+F T++A+ +   +  Q G +  +++++   + K  + +
Sbjct: 82  FHAARQDLEIFWVDAGVFPKPLFDTQVAA-MVCGFGEQAGYETLVRKIVKQGLDKTSRFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL-- 196
           DWS   LS+ Q  YA +DV HL  +      +L++ GRS         L D A  D+   
Sbjct: 141 DWSRRPLSEAQKTYALADVTHLRKIYEFLAAELEKSGRSHWVAEELQVLTDPATYDIQPQ 200

Query: 197 -GWENVDIFSHS 207
             W+ V   ++S
Sbjct: 201 EAWQRVKTRTNS 212


>gi|254448397|ref|ZP_05061858.1| ribonuclease D [gamma proteobacterium HTCC5015]
 gi|198262010|gb|EDY86294.1| ribonuclease D [gamma proteobacterium HTCC5015]
          Length = 384

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 83/156 (53%), Gaps = 3/156 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTE L       +LC++Q++  D    I  +A    +   L  +L DE   K+ H  
Sbjct: 26  LTLDTEFLREKTYYPQLCLIQIANHDLIACIDPLAID--DLTPLYALLHDESIVKVLHAA 83

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D  +L+ +     +PVF T++A+ L   Y +Q G    ++++ G+ + K+Q  +DWS 
Sbjct: 84  VQDQEILYQSSQQPPKPVFDTQVAASLL-GYGDQMGYAKLVEKICGVQLDKSQSRTDWSR 142

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             L+++Q+ YAA DV HL  +      +L+RLGRSD
Sbjct: 143 RPLNEKQIDYAADDVRHLREIYQHLKTELERLGRSD 178


>gi|146340329|ref|YP_001205377.1| ribonuclease D (RNase D) [Bradyrhizobium sp. ORS278]
 gi|146193135|emb|CAL77147.1| Ribonuclease D (RNase D) [Bradyrhizobium sp. ORS278]
          Length = 389

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 92/198 (46%), Gaps = 8/198 (4%)

Query: 9   GDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
            D+ A CA  A++   I VDTE L        LC+VQ++  D  V I  +A G  +    
Sbjct: 15  ADLAAACARLAQH-PVITVDTEFLRETTYYPLLCVVQMASQDEAVVIDALAEGI-DLKAF 72

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             ++ +EK  K+FH  R DI ++++  G+   P+F T++A+ +   Y +       ++ +
Sbjct: 73  FELMANEKVLKVFHAARQDIEIIWHRAGIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERI 131

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G    K  + +DWS   L+ EQ  YA +DV HL  +       L++ GRSD  +     
Sbjct: 132 TGHRPDKTHRFTDWSRRPLTKEQAHYAEADVTHLRDVFAALDTDLKKRGRSDWVSEEMEI 191

Query: 187 LMDRAELDL---LGWENV 201
           L      D      WE +
Sbjct: 192 LTSPKTYDFHPERAWERL 209


>gi|159184639|ref|NP_354170.2| ribonuclease D [Agrobacterium tumefaciens str. C58]
 gi|159139937|gb|AAK86955.2| ribonuclease D [Agrobacterium tumefaciens str. C58]
          Length = 388

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 88/173 (50%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC+VQ++     V +  +A G    P +  ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPELCLVQMASPTLEVLVDPLAKGIDLTP-MFELMANPNVVKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   + +       ++++  + I K+ + +DWS 
Sbjct: 80  RQDIEIIYHLGGLIPHPIFDTQVAA-MVCGFGDSISYDQLVQKIKNVQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             L+++QL YA +DV HL  + L    +L+R GRS   T   N L  R   D+
Sbjct: 139 RPLTEKQLDYALADVTHLRDVYLSLKAQLEREGRSLWLTEEMNILESRDTYDM 191


>gi|222148187|ref|YP_002549144.1| ribonuclease D [Agrobacterium vitis S4]
 gi|221735175|gb|ACM36138.1| ribonuclease D [Agrobacterium vitis S4]
          Length = 384

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 88/173 (50%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC++Q++  D  V +  +A G   AP    ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPELCLIQMASPDLEVIVDPLAEGLDLAP-FFKLMANGDVIKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++F+   +   P+F T++A+ +   + +       ++++  I+I K+ + +DWS 
Sbjct: 80  RQDIEIIFHLGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVQKIKNIHIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             LS++QL YA +DV HL  + L    +L+R GR+   +     L  R   DL
Sbjct: 139 RPLSEKQLDYALADVTHLRDVYLTLNAELEREGRASWLSEEMAILESRDTYDL 191


>gi|190575218|ref|YP_001973063.1| putative ribonuclease D [Stenotrophomonas maltophilia K279a]
 gi|190013140|emb|CAQ46772.1| putative ribonuclease D [Stenotrophomonas maltophilia K279a]
          Length = 359

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 75/154 (48%), Gaps = 3/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE +       +L +VQ++ G   + I  +  G   A  L   L DE   K+ H  
Sbjct: 22  IGLDTEFIRERTFWPQLALVQMAVGQDILLIDPLIPGMTEA--LAHWLADESITKVMHSA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+    +  GV  RP+F T+I + L        G +  + E+ G+ ++K +  SDW  
Sbjct: 80  SEDLVAFRWACGVLPRPLFDTQIGASLA-GIGGGMGYQKLVAEITGVALAKGETRSDWMR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS+ QLQYAA DV HL AL      +LQ LGR
Sbjct: 139 RPLSESQLQYAADDVEHLFALHDAIDARLQALGR 172


>gi|194366535|ref|YP_002029145.1| ribonuclease D [Stenotrophomonas maltophilia R551-3]
 gi|194349339|gb|ACF52462.1| ribonuclease D [Stenotrophomonas maltophilia R551-3]
          Length = 358

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 75/154 (48%), Gaps = 3/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE +       +L +VQ++ G   + I  +  G   A  L   L DE   K+ H  
Sbjct: 22  IGLDTEFIRERTFWPQLALVQMAVGQDILLIDPLIPGMAEA--LAPWLADESIIKVMHSA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+    +  GV  RP+F T+I + L        G +  + E+ G+ ++K +  SDW  
Sbjct: 80  SEDLVAFKWACGVLPRPLFDTQIGASLA-GIGGGMGYQKLVAEITGVALAKGETRSDWMR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS+ QLQYAA DV HL A+      KLQ LGR
Sbjct: 139 RPLSESQLQYAADDVEHLFAMHDAIDAKLQALGR 172


>gi|163736203|ref|ZP_02143622.1| ribonuclease D [Phaeobacter gallaeciensis BS107]
 gi|161390073|gb|EDQ14423.1| ribonuclease D [Phaeobacter gallaeciensis BS107]
          Length = 385

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 103/215 (47%), Gaps = 11/215 (5%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI-- 56
           M T+   E D+ A C AA   D + VDTE L       +LC+VQL+ PG G  + + +  
Sbjct: 1   MKTLTSTE-DLQAFCEAAAQHDYVTVDTEFLRERTYYSKLCLVQLAYPGAGDENAVLVDP 59

Query: 57  -AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
            A G    P L  +  +E   K+FH  R D+ + +    V  +P+F T++A+ +   +  
Sbjct: 60  LADGLSLEP-LYDLFRNETVVKVFHAARQDLEIFWVDAQVFPKPLFDTQVAAMVC-GFGE 117

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  +++++   + K  + +DWS   LSD Q  YA +DV HL  +      +L+R G
Sbjct: 118 QVGYETLVRKIVKQGLDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEYLAAELKRTG 177

Query: 176 RSDLATSCCNFLMDRAELDL---LGWENVDIFSHS 207
           R+         L D A  D+     W  V   ++S
Sbjct: 178 RARWVEEELQVLTDPATYDVDPQEAWRRVKTRTNS 212


>gi|163741269|ref|ZP_02148661.1| ribonuclease D [Phaeobacter gallaeciensis 2.10]
 gi|161385622|gb|EDQ09999.1| ribonuclease D [Phaeobacter gallaeciensis 2.10]
          Length = 385

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 103/215 (47%), Gaps = 11/215 (5%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI-- 56
           M T+   E D+ A C AA   D + VDTE L       +LC+VQL+ PG G  + + +  
Sbjct: 1   MKTLTSTE-DLQAFCEAAAQHDYVTVDTEFLRERTYYSKLCLVQLAYPGAGDENAVLVDP 59

Query: 57  -AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
            A G    P L  +  +E   K+FH  R D+ + +    V  +P+F T++A+ +   +  
Sbjct: 60  LADGLSLEP-LYDLFRNETVVKVFHAARQDLEIFWVDAQVFPKPLFDTQVAAMVC-GFGE 117

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  +++++   + K  + +DWS   LSD Q  YA +DV HL  +      +L+R G
Sbjct: 118 QVGYETLVRKIVKQGLDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEYLAAELKRTG 177

Query: 176 RSDLATSCCNFLMDRAELDL---LGWENVDIFSHS 207
           R+         L D A  D+     W  V   ++S
Sbjct: 178 RARWVEEELQVLTDPATYDVDPQEAWRRVKTRTNS 212


>gi|149915004|ref|ZP_01903533.1| ribonuclease D [Roseobacter sp. AzwK-3b]
 gi|149811192|gb|EDM71029.1| ribonuclease D [Roseobacter sp. AzwK-3b]
          Length = 385

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 82/168 (48%), Gaps = 4/168 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI--AAGQKNAPNLVGMLVDE 73
           AR  D + VDTE L       +LC+VQL+ PG G  D + +   AG  +   L  +  DE
Sbjct: 17  ARQFDYVTVDTEFLRERTYYSKLCLVQLAVPGTGAEDAVLVDPLAGDLSMAPLYDLFRDE 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + F   GV   P+F T++ + +   +  Q G +  ++++    + K
Sbjct: 77  SVVKVFHAARQDLEIFFVDAGVIPAPLFDTQVTAMVC-GFGEQVGYETLVRKIAKEQLDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             + +DWS   L+D Q +YA +DV HL  +      KL +  R    T
Sbjct: 136 TSRFTDWSRRPLTDAQKKYALADVTHLRDIYEFLARKLAQSDRQKWVT 183


>gi|86357133|ref|YP_469025.1| RNase D protein [Rhizobium etli CFN 42]
 gi|86281235|gb|ABC90298.1| RNase D protein [Rhizobium etli CFN 42]
          Length = 381

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 87/175 (49%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D I +DTE L        LC++Q++     V +  +A G   AP    ++ D K  K+FH
Sbjct: 19  DFITIDTEFLRETTFWPELCLIQMASPTMEVLVDPLAKGIDLAP-FFELMADTKVLKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F    +   P+F T++A+ +   + +       +  +  ++I K+ + +DW
Sbjct: 78  AARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIKNVHIDKSSRFTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           S   LS++QL+YA +DV HL  + L  + +L R GR+       + L  R   D+
Sbjct: 137 SRRPLSEKQLEYALADVTHLRDVYLSLSSQLDREGRTSWLREEMDILEARETYDM 191


>gi|316933724|ref|YP_004108706.1| ribonuclease D [Rhodopseudomonas palustris DX-1]
 gi|315601438|gb|ADU43973.1| ribonuclease D [Rhodopseudomonas palustris DX-1]
          Length = 387

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 87/182 (47%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L        LC+VQ++  +  + I  +A G    P    ++ +E+  K+FH  
Sbjct: 23  ITVDTEFLRETTFYPLLCVVQMASAEDALVIDALADGIDLKP-FFDLMANEQVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   Y +       ++ + G    K  + +DWS 
Sbjct: 82  RQDIEIVWHRAGIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERITGHRPDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGWE 199
             L+ EQ+ YA SDV HL  +       L++ GRSD  +     L   +  D+     WE
Sbjct: 141 RPLTQEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTSPSTYDVHPERAWE 200

Query: 200 NV 201
            +
Sbjct: 201 RL 202


>gi|126731278|ref|ZP_01747085.1| ribonuclease D [Sagittula stellata E-37]
 gi|126708189|gb|EBA07248.1| ribonuclease D [Sagittula stellata E-37]
          Length = 385

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 83/171 (48%), Gaps = 6/171 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAA---GQKNAPNLVGMLVDEKREKI 78
           I VDTE L       +LC++QL+ PG G  D + +     G    P L+ +  DE   K+
Sbjct: 23  ITVDTEFLRERTYYSKLCLIQLALPGKGDEDAVLVDPMVDGLSLDP-LLELFRDESIVKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ + F   GV  +P+F T++A+ +   +  Q G +  +K +    + K+ + +
Sbjct: 82  FHAARQDLEIFFIDHGVIPQPLFDTQVAAMVC-GFGEQVGYETLVKRIAKQQLDKSSRFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           DWS   L+D Q  YA +DV HL  +      KL+  GRS         L D
Sbjct: 141 DWSRRPLTDAQKSYALADVTHLREIYEFLAAKLEESGRSRWVAEELGVLTD 191


>gi|218461991|ref|ZP_03502082.1| RNase D protein [Rhizobium etli Kim 5]
          Length = 293

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 86/175 (49%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D I +DTE L        LC++Q++     V +  +A G   AP    ++ D K  K+FH
Sbjct: 19  DFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAP-FFELMADTKVLKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F    +   P+F T++A+ +   + +       +     ++I K+ + +DW
Sbjct: 78  AARQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRSKNVHIDKSSRFTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           S   LSD+QL+YA +DV HL  + L  + +L R GR+       + L  R   D+
Sbjct: 137 SRRPLSDKQLEYALADVTHLRDVYLSLSSQLDREGRTSWLREEMDVLEARETYDM 191


>gi|39936108|ref|NP_948384.1| ribonuclease D [Rhodopseudomonas palustris CGA009]
 gi|39649962|emb|CAE28486.1| ribonuclease D [Rhodopseudomonas palustris CGA009]
          Length = 392

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 87/182 (47%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L        LC+VQ++  +  + I  +A G    P    ++ +E+  K+FH  
Sbjct: 23  ITVDTEFLRETTFYPLLCVVQMASAEEALVIDALADGIDLKP-FFDLMANEQVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   Y +       ++ + G    K  + +DWS 
Sbjct: 82  RQDIEIVWHRAGIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERITGHRPDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGWE 199
             L+ EQ+ YA SDV HL  +       L++ GRSD  +     L   +  D+     WE
Sbjct: 141 RPLTQEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTSPSTYDVHPERAWE 200

Query: 200 NV 201
            +
Sbjct: 201 RL 202


>gi|240850739|ref|YP_002972139.1| ribonuclease D [Bartonella grahamii as4aup]
 gi|240267862|gb|ACS51450.1| ribonuclease D [Bartonella grahamii as4aup]
          Length = 384

 Score = 75.5 bits (184), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 94/189 (49%), Gaps = 5/189 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R  D + VDTE +       +LC++QL+  D TV I  IA      P    +++D+K 
Sbjct: 17  ALRTSDFVTVDTEFIRETTFWPQLCLIQLASPDVTVLIDPIAPDIDLQP-FFDLMIDKKV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI  +++  GV   P+F T+IA  +   + +       ++   G ++ K+ 
Sbjct: 76  VKVFHAARQDIETIYHLGGVIPSPLFDTQIAGSIC-GFGDSISYDQIVQRCTGHHLDKSS 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DWS   LS++QL YA +DV +L  + L   ++L++  R+         L++    D+
Sbjct: 135 RFTDWSCRPLSEKQLLYALADVTYLRDVYLLLKKRLEKNQRAHWMDDELTILLNPKTYDM 194

Query: 196 L---GWENV 201
                W+ V
Sbjct: 195 PEDEAWKKV 203


>gi|302037758|ref|YP_003798080.1| ribonuclease D [Candidatus Nitrospira defluvii]
 gi|300605822|emb|CBK42155.1| Ribonuclease D [Candidatus Nitrospira defluvii]
          Length = 401

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 82/158 (51%), Gaps = 4/158 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP--NLVGMLVDEKREKIFH 80
           IA+DTE +G      RL ++Q++  +G   +I   A Q+ AP      ++ D + EK+ H
Sbjct: 30  IAIDTEFMGEEHFIPRLELIQVA-AEGVAAVIDFPAVQEAAPMARFWEIVCDARIEKVLH 88

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            GR D+ +  +  G   +P F T+IA+ +   Y  Q    + ++ + G+ + KA   ++W
Sbjct: 89  AGRQDLELFAHHAGRLPKPFFDTQIAAAMV-GYGAQTAYANLVQRVQGVKLDKAHTFTNW 147

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           S   LS EQL YA  DV  L  +     +KL  +GRS+
Sbjct: 148 SQRPLSREQLVYALDDVTFLLPVHRHLRQKLSVMGRSE 185


>gi|83858515|ref|ZP_00952037.1| ribonuclease D [Oceanicaulis alexandrii HTCC2633]
 gi|83853338|gb|EAP91190.1| ribonuclease D [Oceanicaulis alexandrii HTCC2633]
          Length = 384

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 93/189 (49%), Gaps = 16/189 (8%)

Query: 15  CAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CA  R  + +AVDTE +       +LC++Q +  D  V I  +A G    P    +L D+
Sbjct: 14  CAKLRQAEYVAVDTEFMRESTFWPQLCLIQAAGDDTEVLIDPLAEGLDLQP-FYDLLTDQ 72

Query: 74  KREKIFHYGRFDIAVLFYTFG-VRVRPVFCTKIASRLTRTYTNQHGLKDNL------KEL 126
              K+FH  R D+ + F+  G +  +P+F ++IA+          GL D++      + L
Sbjct: 73  NVIKVFHACRQDLEIFFHEGGGIIPKPLFDSQIAAMAV-------GLGDSISYDNLVRAL 125

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
           + +N+ K  + +DWS   LSD+Q +YA +DV HL  L     EKL ++GR          
Sbjct: 126 VKVNLDKGSRFTDWSRRPLSDKQKEYALADVTHLRDLFPILREKLAKVGREAWLAEEMKT 185

Query: 187 LMDRAELDL 195
           L D A  ++
Sbjct: 186 LTDPATYEM 194


>gi|117928371|ref|YP_872922.1| 3'-5' exonuclease [Acidothermus cellulolyticus 11B]
 gi|117648834|gb|ABK52936.1| 3'-5' exonuclease [Acidothermus cellulolyticus 11B]
          Length = 550

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 73/139 (52%), Gaps = 3/139 (2%)

Query: 26  DTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFD 85
           D ET GL    DR+C VQL+ G+  V ++++  G      L  +L D+   KIFH  RFD
Sbjct: 380 DIETTGLNWYADRICTVQLACGN-RVAVVQLPEGH-TPQRLSQILGDQNILKIFHNARFD 437

Query: 86  IAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ-HGLKDNLKELLGINISKAQQSSDWSADD 144
           +  + Y + V  + V CT    RL        H L++ L+  L + I K Q  SDW+   
Sbjct: 438 LRFMVYHWSVIPQNVACTLELVRLLNPRERAGHTLREVLERYLAVQIIKDQTCSDWTTAQ 497

Query: 145 LSDEQLQYAASDVVHLHAL 163
           L+ EQ++YA +DV +L  L
Sbjct: 498 LTQEQIRYATNDVRYLPVL 516


>gi|192291826|ref|YP_001992431.1| ribonuclease D [Rhodopseudomonas palustris TIE-1]
 gi|192285575|gb|ACF01956.1| ribonuclease D [Rhodopseudomonas palustris TIE-1]
          Length = 392

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 87/182 (47%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L        LC+VQ++  +  + I  +A G    P    ++ +E+  K+FH  
Sbjct: 23  ITVDTEFLRETTFYPLLCVVQMASAEEALVIDALADGIDLKP-FFDLMANEQVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   Y +       ++ + G    K  + +DWS 
Sbjct: 82  RQDIEIVWHRAGIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERITGHRPDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGWE 199
             L+ EQ+ YA SDV HL  +       L++ GRSD  +     L   +  D+     WE
Sbjct: 141 RPLTQEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTSPSTYDVHPERAWE 200

Query: 200 NV 201
            +
Sbjct: 201 RL 202


>gi|49474343|ref|YP_032385.1| ribonuclease D [Bartonella quintana str. Toulouse]
 gi|49239847|emb|CAF26240.1| Ribonuclease D [Bartonella quintana str. Toulouse]
          Length = 404

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 86/164 (52%), Gaps = 2/164 (1%)

Query: 13  AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD 72
           A  A R  D + VDTE +       +LC++QL+  D T+ I  +A      P    ++VD
Sbjct: 34  ALAALRPSDFVTVDTEFIRETTFWPQLCLIQLASPDVTMLIDPMAQDMDLKP-FFDLMVD 92

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           EK  K+FH  R DI ++++  GV   P+F T+IA  +   + +       ++   G  + 
Sbjct: 93  EKIVKVFHAARQDIEIIYHLGGVIPYPLFDTQIAGSIC-GFGDSISYDQIVQRCTGHQLD 151

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           K+ + +DWS   LS++QL YA +DV +L  + L   ++L++  R
Sbjct: 152 KSSRFTDWSCRPLSEKQLLYALADVTYLRDVYLLLKKQLEKNKR 195


>gi|254522754|ref|ZP_05134809.1| ribonuclease D [Stenotrophomonas sp. SKA14]
 gi|219720345|gb|EED38870.1| ribonuclease D [Stenotrophomonas sp. SKA14]
          Length = 359

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 80/168 (47%), Gaps = 6/168 (3%)

Query: 12  PAECAARY---VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           PAE  A +      I +DTE +       +L +VQ++ G   + I  +  G   A  L  
Sbjct: 8   PAELDAYFQQRPSRIGLDTEFIRERTFWPQLALVQMAVGRDILLIDPLIPGMTEA--LAP 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
            L DE   K+ H    D+    +  GV  RP+F T+I + L        G +  + E+ G
Sbjct: 66  WLADESIIKVMHSASEDLVAFKWACGVLPRPLFDTQIGASLA-GIGGGMGYQKLVAEITG 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           + ++K +  SDW    LS+ QLQYAA DV HL AL      +LQ LGR
Sbjct: 125 VALAKGETRSDWMRRPLSESQLQYAADDVEHLFALHDAIGARLQALGR 172


>gi|163792851|ref|ZP_02186827.1| Ribonuclease D [alpha proteobacterium BAL199]
 gi|159181497|gb|EDP66009.1| Ribonuclease D [alpha proteobacterium BAL199]
          Length = 386

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 84/169 (49%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE +       +LC+VQL+  D  V +  +A G   AP L  ++ +    K+FH  
Sbjct: 23  VAVDTEFMRDKTYYAKLCLVQLAGADEAVAVDTLAPGIDLAP-LYALMANPDVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  +       P+F T+IA+ +   + +       ++ L G+ + K  + +DWS 
Sbjct: 82  RQDVEIFVHQADAVPAPLFDTQIAAMVC-GFGDAVSYDRLVRGLTGVKLDKTSRFTDWSH 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             LS  Q++YA +DV+HL     +   KL++ GR +  +     L D A
Sbjct: 141 RPLSSRQIEYALADVIHLRPAYEKLHRKLEKTGRLEWLSEEMAVLTDTA 189


>gi|13195121|gb|AAK13017.1| RNase D [Agrobacterium tumefaciens]
          Length = 388

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 87/173 (50%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I  DTE L        LC+VQ++     V +  +A G    P +  ++ +    K+FH  
Sbjct: 21  ITTDTEFLRETTFWPELCLVQMASPTLEVLVDPLAKGIDLTP-MFELMANPNVVKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   + +       ++++  + I K+ + +DWS 
Sbjct: 80  RQDIEIIYHLGGLIPHPIFDTQVAAMVC-GFGDSISYDQLVQKIKNVQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             L+++QL YA +DV HL  + L    +L+R GRS   T   N L  R   D+
Sbjct: 139 RPLTEKQLDYALADVTHLRDVYLSLKAQLEREGRSLWLTEEMNILESRDTYDM 191


>gi|148255258|ref|YP_001239843.1| ribonuclease D (RNase D) [Bradyrhizobium sp. BTAi1]
 gi|146407431|gb|ABQ35937.1| Ribonuclease D (RNase D) [Bradyrhizobium sp. BTAi1]
          Length = 384

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 89/181 (49%), Gaps = 5/181 (2%)

Query: 9   GDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
            D+ A CA  A++   I VDTE L        LC+VQ++  D  + I  +A G  +  + 
Sbjct: 8   ADLSAACARLAQH-PVITVDTEFLRETTYYPLLCVVQMASPDEALVIDALAEGI-DLTSF 65

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             ++ +EK  K+FH  R DI ++++   +   P+F T++A+ +   Y +       ++ +
Sbjct: 66  FELMANEKVLKVFHAARQDIEIIWHRANIVPHPIFDTQVAA-MVLGYGDSIAYDQLVERI 124

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G    K  + +DWS   LS EQ+ YA +DV HL  +       L++ GRSD  +     
Sbjct: 125 TGHRPDKTHRFTDWSRRPLSKEQVHYAEADVTHLRDVFAALDADLKKRGRSDWVSEEMEI 184

Query: 187 L 187
           L
Sbjct: 185 L 185


>gi|126725300|ref|ZP_01741142.1| ribonuclease D [Rhodobacterales bacterium HTCC2150]
 gi|126704504|gb|EBA03595.1| ribonuclease D [Rhodobacterales bacterium HTCC2150]
          Length = 385

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 98/195 (50%), Gaps = 10/195 (5%)

Query: 1   MTTIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGD---GTVDII 54
           M TI   E D+   C  AA++   + VDTE L       +LC+VQL+ PGD     V + 
Sbjct: 1   MRTITTTE-DLAEYCTQAAKF-PYVTVDTEFLRERTYYAKLCLVQLAMPGDDDSNAVLVD 58

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
            +A G   AP L  +  DE   K+FH  R D+ + F   GV   P+F T++A+ +   + 
Sbjct: 59  PLAKGLSLAP-LYDLFRDENVVKVFHAARQDLEIFFVEEGVIPSPLFDTQVAAMVC-GFG 116

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           +Q G +  ++++    + K+ + +DWS   LSD Q  YA +DV HL  +     ++L++ 
Sbjct: 117 DQVGYETLVRKIAREAVDKSSRFTDWSRRPLSDAQKTYALADVTHLRVVYEYLAKELEKS 176

Query: 175 GRSDLATSCCNFLMD 189
            R+   T     L +
Sbjct: 177 KRTKWVTEELGVLTE 191


>gi|58584516|ref|YP_198089.1| ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418832|gb|AAW70847.1| Ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 399

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 88/169 (52%), Gaps = 3/169 (1%)

Query: 10  DIPAECAARYVDAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           DI  E  A+    IA DTE +   +    RL ++Q+S G+ +  I+   A + +   +  
Sbjct: 11  DICEELIAKKPKFIAADTEFIRNHLTYYPRLSLIQISYGEKSF-IVDALAPEVDLSFIKK 69

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++++ +  K+FH  R DI  LF  F     P+F T++A+     Y +  G    +++  G
Sbjct: 70  IMLNREITKVFHSCRQDIESLFTVFKCIPAPIFDTQVAAMFCHYYHDFIGYSKVVEQYQG 129

Query: 129 INISKAQ-QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           + + K + ++SDW    LS +QL YA SDVVHL+ L     ++L+  GR
Sbjct: 130 VVLDKIKAKNSDWLRRPLSKDQLDYAISDVVHLYDLHQILCDRLEESGR 178


>gi|154247067|ref|YP_001418025.1| ribonuclease D [Xanthobacter autotrophicus Py2]
 gi|154161152|gb|ABS68368.1| ribonuclease D [Xanthobacter autotrophicus Py2]
          Length = 382

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 87/169 (51%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L       +LC+VQ++  +  V I  +A G   AP    ++ +E+  K+FH G
Sbjct: 23  VTVDTEFLRETTFWPKLCVVQVASPEEAVLIDALADGLDLAP-FYRLMANERVMKVFHAG 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++   +   PVF T++A+ +   Y +       ++ + G  + K+ + +DWS 
Sbjct: 82  RQDIEIIWHQARLIPHPVFDTQVAA-MVLGYGDSISYDQLVQRVTGHALDKSSRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             LS  Q+ YA +DV HL  + ++ T  L+  GR++      + L   A
Sbjct: 141 RPLSQAQIVYAVADVTHLRDIYIKLTTDLETRGRAEWVGEEMHVLTSPA 189


>gi|89069870|ref|ZP_01157204.1| ribonuclease D [Oceanicola granulosus HTCC2516]
 gi|89044546|gb|EAR50665.1| ribonuclease D [Oceanicola granulosus HTCC2516]
          Length = 385

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 91/181 (50%), Gaps = 8/181 (4%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI-- 56
           M TI   E D+   CA A     + VDTE L        LC+VQL+ PGDG  D + +  
Sbjct: 1   MRTITTTE-DLATFCAEAAKAPYVTVDTEFLRERTYYPHLCLVQLAYPGDGKTDAVLVDP 59

Query: 57  -AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
              G   AP L  +  D    K+FH  R D+ + ++   V   P+F T++A+ +   +  
Sbjct: 60  LEGGLDLAP-LYALFQDHGVVKVFHAARQDLEIFWHGGQVIPEPLFDTQVAAMVC-GFGE 117

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  ++++   N+ K+ + +DWS   LS+ Q +YA +DV HL  +  +   +L + G
Sbjct: 118 QVGYETLVRKIARENLDKSSRFTDWSRRPLSEAQKRYALADVTHLRVIYEELKAELDKSG 177

Query: 176 R 176
           R
Sbjct: 178 R 178


>gi|126737525|ref|ZP_01753255.1| ribonuclease D [Roseobacter sp. SK209-2-6]
 gi|126720918|gb|EBA17622.1| ribonuclease D [Roseobacter sp. SK209-2-6]
          Length = 388

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 98/201 (48%), Gaps = 10/201 (4%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI---AAGQKNAPNLVGM 69
           E AA+Y   + VDTE L       +LC++QL+  GDG  D + +   A G    P L  +
Sbjct: 15  EEAAQYA-YVTVDTEFLRERTYYSKLCLIQLAFAGDGEEDAVLVDPLAEGLALDP-LYDL 72

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
             +E   K+FH  R D+ + +   GV  +P+F T++A+ +   +  Q G +  ++++   
Sbjct: 73  FRNEAVVKVFHAARQDLEIFWVDAGVFPKPLFDTQVAAMVC-GFGEQVGYETLVRKIAKQ 131

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           ++ K+ + +DWS   LS  Q  YA +DV HL  +     ++L++ GRS         L D
Sbjct: 132 SLDKSSRFTDWSRRPLSGAQKTYALADVTHLRRIYEFLAKELEKSGRSHWVAEELKVLTD 191

Query: 190 RAELDLL---GWENVDIFSHS 207
            A  D+     W  V   + S
Sbjct: 192 PATYDIRPEEAWRRVKTRTSS 212


>gi|299133731|ref|ZP_07026925.1| ribonuclease D [Afipia sp. 1NLS2]
 gi|298591567|gb|EFI51768.1| ribonuclease D [Afipia sp. 1NLS2]
          Length = 382

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 80/165 (48%), Gaps = 2/165 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L        LC+VQL+  D  V +  +A G    P    ++ DEK  K+FH  
Sbjct: 23  VTVDTEFLRETTYYPLLCVVQLASSDEAVVVDALAEGIDLKP-FFDLMADEKVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   PVF T++A+ +   Y +       +  + G  + K  + +DWS 
Sbjct: 82  RQDIEIVWHLAGIVPHPVFDTQVAA-MVLGYGDSIAYDQLVGRITGHKLDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             L+ EQ  YA +DV HL  +       L++  R+D  +   + L
Sbjct: 141 RPLTKEQSAYALADVTHLRDVFTALDADLKKRKRADWVSEEMDVL 185


>gi|325292526|ref|YP_004278390.1| Ribonuclease D [Agrobacterium sp. H13-3]
 gi|325060379|gb|ADY64070.1| Ribonuclease D [Agrobacterium sp. H13-3]
          Length = 386

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 87/173 (50%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC+VQ++     V +  +A G    P L  ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPELCLVQMASPTLEVLVDPLAKGLDLTP-LFELMANPDVVKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   + +       ++ +  + I K+ + +DWS 
Sbjct: 80  RQDIEIIYHLGGLIPHPIFDTQVAAMVC-GFGDSISYDQLVQRIKNVQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             L+++QL YA +DV HL  + L    +L+R GRS   T   + L  R   D+
Sbjct: 139 RPLTEKQLDYALADVTHLRDVYLALKAQLEREGRSLWLTEEMDILESRETYDM 191


>gi|103487237|ref|YP_616798.1| ribonuclease D [Sphingopyxis alaskensis RB2256]
 gi|98977314|gb|ABF53465.1| ribonuclease D [Sphingopyxis alaskensis RB2256]
          Length = 395

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 87/189 (46%), Gaps = 6/189 (3%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD-EKREKIF 79
           D IAVDTE +        LC++Q++  +    I  +A G    P L+ +LVD E   K+F
Sbjct: 24  DFIAVDTEFMRENTFWPELCLIQVADTEHAAAIDPMAQGMDLKP-LLDLLVDNEDMLKVF 82

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H G  D+ ++F   G    P+F T+I  ++      Q G  + ++  LG+ + K  + +D
Sbjct: 83  HAGGQDVEIIFNLTGKTPHPIFDTQI-GQMALGQAEQVGYSNLVEAWLGLQLDKGARFTD 141

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---L 196
           WS   L   Q+ YA  DV HL  +     +KL R GR          L D A   +    
Sbjct: 142 WSRRPLDKRQIDYAIGDVTHLAKIFPMMLDKLIRTGRGHWLDEEMEKLADPANYSVDPDK 201

Query: 197 GWENVDIFS 205
            W+ + I S
Sbjct: 202 AWQRIKIPS 210


>gi|75675781|ref|YP_318202.1| ribonuclease D [Nitrobacter winogradskyi Nb-255]
 gi|74420651|gb|ABA04850.1| ribonuclease D [Nitrobacter winogradskyi Nb-255]
          Length = 382

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 84/182 (46%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE L        LC++QL+  D  V +  +A G    P    ++ +E   K+FH  
Sbjct: 23  ITVDTEFLRETTYYPLLCVIQLASPDEAVVVDALAGGIDLKP-FFALMSNESVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   PVF T++A+ +   + +       ++ + G    K  + +DWS 
Sbjct: 82  RQDIEIIWHQAGLIPHPVFDTQVAA-MVLGHGDSIAYDALVERITGHRPDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGWE 199
             L+ EQL+YA +DV HL  +       L + GRSD  +     L      D      WE
Sbjct: 141 RPLTAEQLEYAVADVTHLRDVFAALDADLSKRGRSDWVSEEMEVLTSPKTYDFHPERAWE 200

Query: 200 NV 201
            +
Sbjct: 201 RL 202


>gi|332702439|ref|ZP_08422527.1| ribonuclease D [Desulfovibrio africanus str. Walvis Bay]
 gi|332552588|gb|EGJ49632.1| ribonuclease D [Desulfovibrio africanus str. Walvis Bay]
          Length = 409

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 83/177 (46%), Gaps = 3/177 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R  DA+ +DTE +        L ++QL   DG V ++    G  +   LV +L D +  K
Sbjct: 43  RGCDAVGMDTEFVRSRTYFPTLGLIQLV-ADGGVFLVD-PLGVDDLSPLVEILADPRLIK 100

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           IFH  + D+  L+Y  G    PVF T++A+     Y  Q G    +K L G+ + K +  
Sbjct: 101 IFHSCQEDLEALYYLCGFAPGPVFDTQVAASFL-GYGFQPGYGSLVKALFGVELDKDETR 159

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
           S+W    LS+ QL YAA DV +L A+     + L   GR   A   C  L   A  +
Sbjct: 160 SNWIKRPLSESQLIYAAQDVRYLPAMYSILGQALTEQGRLSWAREECAALEGEARFE 216


>gi|167646508|ref|YP_001684171.1| ribonuclease D [Caulobacter sp. K31]
 gi|167348938|gb|ABZ71673.1| ribonuclease D [Caulobacter sp. K31]
          Length = 389

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 84/173 (48%), Gaps = 3/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTE +       +LC++Q++  D    I  +A G    P L+ +L D    K+FH  
Sbjct: 23  IAVDTEFMRETTYWPKLCLIQVASPDIEACIDPLAEGMDLEP-LLEILRDPGVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ + F        P+F T++A  +   +  Q      ++++L I + K+ + +DW+ 
Sbjct: 82  RQDVEI-FNNLNAMPTPLFDTQVAG-MAAGFGEQIAYDALVRQMLKIELDKSSRFTDWAR 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             LSD QL YA +DV HL  L     E+L++ GR          L D A  D+
Sbjct: 140 RPLSDAQLTYAVADVTHLATLFPILRERLEKAGRLAWVEEEMKALNDPAAYDV 192


>gi|170746940|ref|YP_001753200.1| ribonuclease D [Methylobacterium radiotolerans JCM 2831]
 gi|170653462|gb|ACB22517.1| ribonuclease D [Methylobacterium radiotolerans JCM 2831]
          Length = 395

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 78/154 (50%), Gaps = 1/154 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DGT  ++   A   +    + ++ DE+  K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQMAAPDGTAVLVDPLAPGIDLDPFIALMADERTVKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+   P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLIGGILPHPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKAKIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS+ QL YA SDV HL  +      +L R  R
Sbjct: 142 RPLSEAQLTYALSDVTHLVKIYEVLVAELLRTDR 175


>gi|326388937|ref|ZP_08210519.1| ribonuclease D [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206537|gb|EGD57372.1| ribonuclease D [Novosphingobium nitrogenifigens DSM 19370]
          Length = 445

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 88/169 (52%), Gaps = 5/169 (2%)

Query: 13  AECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGML 70
           A+  AR   A  + VDTE +        LC+VQ++       I  +A G   +P L+ +L
Sbjct: 14  ADICARLAKAEFVTVDTEFMRENTYWPELCLVQIADDKEAAAIDPMAPGIDLSP-LLDLL 72

Query: 71  VD-EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           VD E   K+FH G  D+ +++   G    P+F T+IA  +  + + Q G  + ++  LG 
Sbjct: 73  VDNEDVLKVFHAGGQDVEIIYNLTGRTPHPIFDTQIAM-MAVSQSEQIGYSNLVESWLGF 131

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           +I K  + +DWS   L++ Q++YA  DV HL  +  +  ++L + GR +
Sbjct: 132 SIDKGARFTDWSRRPLTERQIEYAIGDVTHLSKIFPRILKRLIKTGRGE 180


>gi|226228424|ref|YP_002762530.1| putative ribonuclease [Gemmatimonas aurantiaca T-27]
 gi|226091615|dbj|BAH40060.1| putative ribonuclease [Gemmatimonas aurantiaca T-27]
          Length = 388

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 6/162 (3%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV-DEKREKI 78
           V AIA+DTE        DR+ ++QLS  D    I  +  G    P  +G+L+ D + E +
Sbjct: 25  VRAIALDTEGASFHRFVDRIYLLQLSTADHEAVIDPLPIG---TPTRLGVLLEDPQVEVV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
            H   +D+ +L   +G RV  +F T++A++L        GL   L++  GI + K  Q +
Sbjct: 82  LHDADYDLRLLRQDYGWRVTHLFDTRVAAQLL--GIRAFGLAALLEQFFGIKLDKKHQRA 139

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           DWS   L+ + L YAA D  HL  LR +  ++L + GR   A
Sbjct: 140 DWSMRPLTADMLDYAAHDTRHLLGLRDRLHDELVQKGRWSWA 181


>gi|251792786|ref|YP_003007512.1| ribonuclease D [Aggregatibacter aphrophilus NJ8700]
 gi|247534179|gb|ACS97425.1| ribonuclease D [Aggregatibacter aphrophilus NJ8700]
          Length = 385

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 81/169 (47%), Gaps = 3/169 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+A+DTE +       +L ++QL  GD  V +I     Q  +P  + +L DE+  K+ H 
Sbjct: 35  AVALDTEFVRTRTFYPKLGLIQLYAGD-EVALIDPTTIQDFSP-FIALLADERVTKVLHA 92

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+ V  + F    +P+  T++ +     + N  G    +K    I I K    +DW 
Sbjct: 93  SGEDLEVFQHYFQQLPQPMCDTQVVANFL-GFANSPGFATLVKHYFQIEIDKGASCTDWL 151

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           A  LSD QLQYAA+DV +L  L  Q   +L +        + C FL+++
Sbjct: 152 ARPLSDTQLQYAAADVWYLLPLYQQMKAQLAQTEWQSAVENECEFLLNK 200


>gi|77917938|ref|YP_355753.1| RNase D [Pelobacter carbinolicus DSM 2380]
 gi|77544021|gb|ABA87583.1| RNase D [Pelobacter carbinolicus DSM 2380]
          Length = 375

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 78/154 (50%), Gaps = 4/154 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVD E   L   ++++C++Q+S    TV +  +A   ++   L  +L D    KIFH  
Sbjct: 26  IAVDLEADSLHSYQEKVCLLQISTSTRTVLVDPLAV--EDLAALAPVLADPTIRKIFHAA 83

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +DI  LF  F + V+ +F T IA ++      + GL D L + L + + K  Q +DWS 
Sbjct: 84  DYDIRCLFRDFRIEVQGLFDTMIACQML--GEKRVGLADVLAKYLDVELDKRYQRADWSK 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             L +  + YA  D  HLH L      +L+ +GR
Sbjct: 142 RPLEEGMILYAMEDTCHLHRLTEILEGRLRDMGR 175


>gi|85717198|ref|ZP_01048155.1| ribonuclease D [Nitrobacter sp. Nb-311A]
 gi|85695978|gb|EAQ33879.1| ribonuclease D [Nitrobacter sp. Nb-311A]
          Length = 420

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 90/194 (46%), Gaps = 7/194 (3%)

Query: 13  AECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGML 70
           A   AR+     I VDTE L        LC++Q++  D  + I  +A G  +  +   ++
Sbjct: 49  ASVCARFAKHPVITVDTEFLRETTYYPLLCVIQMASPDEAIAIDALAEGI-DLNSFFTLM 107

Query: 71  VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGIN 130
            +E   K+FH  R DI ++++  G+   PVF T++A+ +   Y +       ++ + G  
Sbjct: 108 SNEGVLKVFHAARQDIEIIWHQAGIIPHPVFDTQVAA-MVLGYGDSIAYDALVERVTGHR 166

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             K  + +DWS   L+ EQL+YA +DV HL  +       L++ GRSD  +     L   
Sbjct: 167 PDKTHRFTDWSRRPLTAEQLEYAVADVTHLRDVFAALDVDLRKRGRSDWVSEEMEILTSP 226

Query: 191 AELDL---LGWENV 201
              D      WE +
Sbjct: 227 KTYDFHPERAWERL 240


>gi|83951561|ref|ZP_00960293.1| ribonuclease D [Roseovarius nubinhibens ISM]
 gi|83836567|gb|EAP75864.1| ribonuclease D [Roseovarius nubinhibens ISM]
          Length = 385

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 88/179 (49%), Gaps = 6/179 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGD---GTVDIIRIAAGQKNAPNLVGMLVD 72
           AR    + VDTE L       +LC+VQL+ PG+   G V +  +A G    P L  +  D
Sbjct: 17  ARKHPYVTVDTEFLRERTYYSKLCLVQLAMPGEDDAGAVLVDPLAEGLSLEP-LYELFRD 75

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           E   K+FH  R D+ + +   G+  +P+F T++A+ +   +  Q G +  ++ +    + 
Sbjct: 76  ENVVKVFHAARQDLEIFYVDAGLIPQPLFDTQVAAMVC-GFGEQVGYETLVRRIAKEQLD 134

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           K+ + +DWS   LS+ Q +YA  DV HL  +      +L++ GR          LMD A
Sbjct: 135 KSSRFTDWSRRPLSEAQKKYALGDVTHLRRIYEYLAAELEKSGRDAWVKEELGTLMDPA 193


>gi|304321318|ref|YP_003854961.1| ribonuclease D [Parvularcula bermudensis HTCC2503]
 gi|303300220|gb|ADM09819.1| ribonuclease D [Parvularcula bermudensis HTCC2503]
          Length = 383

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 79/156 (50%), Gaps = 2/156 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +       +LC++Q++  +    I  +AA    AP L  +L D    K+FH
Sbjct: 21  DFVTVDTEFMRERTYYPKLCLIQVASTEEAAIIDPLAAALDLAPFL-ELLADPSVLKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R D+ + +   G    P+F T+IA+ +   + +Q G +  ++E+ G  + K  + +DW
Sbjct: 80  AARQDLEIFYKLMGKVPAPLFDTQIAA-MACGHGDQVGYEALIREVTGAQVDKGSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           +   LSD+QL YA  DV HL         +L+  GR
Sbjct: 139 AKRPLSDKQLTYALGDVTHLVDAYQALITELEEKGR 174


>gi|284046840|ref|YP_003397180.1| ribonuclease D [Conexibacter woesei DSM 14684]
 gi|283951061|gb|ADB53805.1| Ribonuclease D [Conexibacter woesei DSM 14684]
          Length = 396

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 85/180 (47%), Gaps = 7/180 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDG-TVDIIRIAA----GQKNAPNLVGMLV 71
           AR    + +DTE +     R  LC+VQ++  D    + +RIA      + +   L  +L 
Sbjct: 22  ARAAGRLGIDTEFMSEGRYRALLCLVQVAVDDADAPNGVRIALFDPFDKLDFAPLAAVLA 81

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           D + E + H  R D+A++   +   VR VF T++A+     Y  Q G  + L   LG  +
Sbjct: 82  DPEIEIVLHAARQDVAIMRRAWRTDVREVFDTQVAAGFA-GYGAQTGYGNLLGAALGQRV 140

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
            K    + W A  L++EQL YAA DV+HL  L     +KL   GR   A   C   MD A
Sbjct: 141 GKTASYTRWDARPLTEEQLSYAAEDVLHLLQLSDALHDKLSAHGRLQWAQEECRR-MDEA 199


>gi|58039094|ref|YP_191058.1| ribonuclease D [Gluconobacter oxydans 621H]
 gi|58001508|gb|AAW60402.1| Ribonuclease D [Gluconobacter oxydans 621H]
          Length = 396

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 77/152 (50%), Gaps = 6/152 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTE +        LC+VQL+  +  V I  +A G   AP L  +L      K+FH  
Sbjct: 33  VTIDTEFVRERTYWPELCLVQLAGTEDVVLIDTLAPGIDLAP-LGALLAKPDCTKVFHAA 91

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  + F      VF T++A+ +   + +Q G    +  + G +I KA + SDWSA
Sbjct: 92  RQDLEIFLHIFDRLPASVFDTQVAA-MVAGFGDQVGYDSLVGAITGRSIDKAHRFSDWSA 150

Query: 143 DDLSDEQLQYAASDVVHLH----ALRLQFTEK 170
             LS  Q+ YAA+DV HL     ALR Q  E+
Sbjct: 151 RPLSKAQIAYAATDVTHLRTVYDALRKQLAEQ 182


>gi|114767452|ref|ZP_01446239.1| ribonuclease D [Pelagibaca bermudensis HTCC2601]
 gi|114540462|gb|EAU43543.1| ribonuclease D [Roseovarius sp. HTCC2601]
          Length = 385

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 95/193 (49%), Gaps = 6/193 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI-- 56
           M TI   E D+ A C+ A     + VDTE L       +LC++QL+ PG G  + + +  
Sbjct: 1   MKTITSTE-DLAAFCSEAATAPYVTVDTEFLRERTYYSKLCLIQLAYPGQGDENAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            AG+ +   L+ +  +    K+FH  R D+ + F   GV   P+F T++A+ +   +  Q
Sbjct: 60  LAGELSLEPLLELFRNTNVVKVFHAARQDLEIFFIDHGVIPDPLFDTQVAAMVC-GFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K +    + K+ + +DWS   L+D Q +YA +DV HL  +      +L+R GR
Sbjct: 119 VGYETLVKRIAKQGLDKSSRFTDWSRRPLTDAQKKYALADVTHLRVIYEYLAAELERTGR 178

Query: 177 SDLATSCCNFLMD 189
           +         L D
Sbjct: 179 ARWVAEELGVLTD 191


>gi|86138715|ref|ZP_01057288.1| ribonuclease D [Roseobacter sp. MED193]
 gi|85824775|gb|EAQ44977.1| ribonuclease D [Roseobacter sp. MED193]
          Length = 385

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 92/192 (47%), Gaps = 9/192 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI---AAGQKNAPNLVGMLVDEKREKI 78
           + VDTE L       +LC++Q++  GDG  D + +   + G    P L  +  DE   K+
Sbjct: 23  VTVDTEFLRERTYYSKLCLIQIAFSGDGENDAVLVDPLSEGLSLEP-LYALFRDESVVKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ + +    V  +P+F T++A+ +   + +Q G +  +++++   + K+ + +
Sbjct: 82  FHAARQDLEIFWVDANVFPKPLFDTQVAAMVC-GFGDQVGYETLVRKIVKEGVDKSSRFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL-- 196
           DWS   LS+ Q  YA +DV HL  +       L+R GRS         L D A  ++   
Sbjct: 141 DWSRRPLSEAQQAYALADVTHLRRVYEYLAADLERSGRSHWVAEELQVLTDPATYNIQPQ 200

Query: 197 -GWENVDIFSHS 207
             W  V   + S
Sbjct: 201 DAWRRVKTRTSS 212


>gi|289207511|ref|YP_003459577.1| ribonuclease D [Thioalkalivibrio sp. K90mix]
 gi|288943142|gb|ADC70841.1| ribonuclease D [Thioalkalivibrio sp. K90mix]
          Length = 392

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 75/146 (51%), Gaps = 8/146 (5%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
            D IA+DTE L       +LC+VQ +  D    +D +R+   Q     L  +  D    K
Sbjct: 23  TDWIALDTEFLREKTYYPQLCLVQAATLDQLACIDPLRLDIQQ-----LAPLFRDPGITK 77

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH    D+ +L+   G    PVF T+IA+ +   Y  Q G  + +K +L  ++ K+Q  
Sbjct: 78  VFHAASQDMELLYRELGFVPSPVFDTQIAASML-GYGEQVGYANLVKTVLERDLDKSQTR 136

Query: 138 SDWSADDLSDEQLQYAASDVVHLHAL 163
           +DWS   LS EQ++YAA DV HL  L
Sbjct: 137 TDWSRRPLSAEQIRYAADDVRHLATL 162


>gi|114569802|ref|YP_756482.1| ribonuclease D [Maricaulis maris MCS10]
 gi|114340264|gb|ABI65544.1| ribonuclease D [Maricaulis maris MCS10]
          Length = 386

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 84/164 (51%), Gaps = 16/164 (9%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE +       +LC++Q + G+  V I  +A G    P    ++ DE+  K+FH  
Sbjct: 23  VAVDTEFMRETVYWPQLCLIQAAAGETEVIIDPLAEGIDLEP-FWELMADERIIKVFHAA 81

Query: 83  RFDIAVLFYTFG--VRVRPVFCTKIASRLTRTYTNQHGLKDNL------KELLGINISKA 134
           R D+ + F+  G  +   P+F +++A+          GL D++      + LL   I K 
Sbjct: 82  RQDLEIFFHQGGDALIPHPMFDSQVAAMAL-------GLGDSIAYDALVRTLLNRPIDKG 134

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            + +DWS   LSD Q +YA +DV HL  L     E+L++ GR++
Sbjct: 135 PRFTDWSRRPLSDAQTKYAIADVTHLRDLYPMMVERLEKTGRTE 178


>gi|300024345|ref|YP_003756956.1| ribonuclease D [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526166|gb|ADJ24635.1| ribonuclease D [Hyphomicrobium denitrificans ATCC 51888]
          Length = 384

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 82/157 (52%), Gaps = 2/157 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D +AVDTE L        LC++QL+  +    +  +A G   AP    ++ D    K+FH
Sbjct: 21  DYVAVDTEFLREQTFWPLLCLIQLAGPEAEAIVDPLAPGLDLAP-FYHLMADTSTVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++F   GV   PVF +++A+ +   + +     + +K+  G ++ K+ + +DW
Sbjct: 80  AARQDIEIVFLKSGVVPTPVFDSQVAAMVC-GFGDSISYVNLVKKTTGADLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           S   LS +QL YA +DV +L  +  +  + L + GR+
Sbjct: 139 SRRPLSPKQLDYALADVTYLRDVYQRLRQTLDKTGRT 175


>gi|254486025|ref|ZP_05099230.1| ribonuclease D [Roseobacter sp. GAI101]
 gi|214042894|gb|EEB83532.1| ribonuclease D [Roseobacter sp. GAI101]
          Length = 385

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 80/160 (50%), Gaps = 4/160 (2%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLS-PG--DGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           D + +DTE L       +LC++Q++ PG  D    ++   AG  +   L  +  D    K
Sbjct: 21  DYVTIDTEFLRERTYYSKLCLIQMAMPGTDDSGAVLVDPLAGDMSLEPLYALFRDTSVVK 80

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R D+ + F   GV   P+F T++A+ +   +  Q G +  ++++    + K  + 
Sbjct: 81  VFHAARQDLEIFFVDAGVFPEPLFDTQVAAMVC-GFGEQVGYETLVRKIAHQAVDKTSRF 139

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           +DWS   L+D Q +YA +DV HL  +      KL+  GR+
Sbjct: 140 TDWSRRPLTDAQAKYALADVTHLRQVYEFLARKLEETGRA 179


>gi|46202610|ref|ZP_00208583.1| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 398

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 77/154 (50%), Gaps = 2/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC+VQ++  D    I  +A G    P L  ++ D    K+FH  
Sbjct: 23  VTVDTEFMREKTYWPQLCLVQVAGPDEARAIDPLAPGMDLTP-LFELMADTNVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  +       P+F T+IA+ +   + +  G +    +L    I K+ + +DWS 
Sbjct: 82  RQDVEIFLHLADAIPTPIFDTQIAA-MVCGFGDSVGYETLASQLAKARIDKSMRFTDWSI 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS++Q+QYA +DV HL     +   KL+R GR
Sbjct: 141 RPLSEKQIQYALADVTHLRVAYEKLVRKLERNGR 174


>gi|319404161|emb|CBI77754.1| Ribonuclease D [Bartonella rochalimae ATCC BAA-1498]
          Length = 383

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 86/163 (52%), Gaps = 2/163 (1%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEK 74
            A R  + + VDTE +       +LC++Q++  D T+ +I   A   N      +++D+K
Sbjct: 15  AALRKSNFVTVDTEFIRKTTFWPQLCLIQVASPDITI-LIDPMAQDINLQPFFDLMIDKK 73

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+FH  R DI ++++  G+   P+F T++A  +   + +       ++   G ++ K+
Sbjct: 74  VVKVFHAARQDIEIIYHLGGIIPSPLFDTQVAGSIC-GFGDSISYDQIVQRCTGHHLDKS 132

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            + +DWS   LS++QL YA SDV +L  + L   ++L+   R+
Sbjct: 133 SRFTDWSCRPLSEKQLLYAVSDVTYLRDVYLALKKQLEEKKRT 175


>gi|99081315|ref|YP_613469.1| ribonuclease D [Ruegeria sp. TM1040]
 gi|99037595|gb|ABF64207.1| ribonuclease D [Ruegeria sp. TM1040]
          Length = 385

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 95/198 (47%), Gaps = 8/198 (4%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI--AAGQKNAPNLVGMLVD 72
           AA+Y   + VDTE L       +LC++Q++  GDG  D + +   +G  +   L  +  +
Sbjct: 17  AAKY-PYVTVDTEFLRERTYYSKLCLIQIAYRGDGETDAVLVDPLSGDLSLEPLYELFRN 75

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           E   K+FH  R D+ + +   GV  +P+F T++A+ +   +  Q G +  ++++    + 
Sbjct: 76  EDVVKVFHAARQDLEIFWVDAGVFPKPLFDTQVAAMVC-GFGEQVGYETLVRKICKQGLD 134

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           K  + +DWS   LSD Q  YA +DV HL  +     ++L +  RS         L D A 
Sbjct: 135 KTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEHLRKELDKTKRSHWVAEELQVLTDPAT 194

Query: 193 LDLL---GWENVDIFSHS 207
            ++     W  V   ++S
Sbjct: 195 YNIQPREAWRRVKTRTNS 212


>gi|328955332|ref|YP_004372665.1| ribonuclease D [Coriobacterium glomerans PW2]
 gi|328455656|gb|AEB06850.1| ribonuclease D [Coriobacterium glomerans PW2]
          Length = 377

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 87/182 (47%), Gaps = 13/182 (7%)

Query: 4   IRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQ 60
           I  HE  + A C AAR    +A+DTE L       RLC+VQ++  +    VD + I    
Sbjct: 3   ISTHE-QLAALCDAARSFSIVAIDTEFLRERTYHPRLCLVQVATPEVSALVDPLEI---- 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRL--TRTYTNQHG 118
           ++   L  ++ DE   KIFH    D+ VL     V   P+F T++A+     R   +  G
Sbjct: 58  EDLSPLAALMADEGTRKIFHACSQDMEVLLNALDVLPNPIFDTQVAAAFLGERVQMSYDG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           L   +K   G+++ K    +DWS   L+ EQ+ YA  DV +L        E+L++ GR  
Sbjct: 118 L---VKAFCGVSLPKTASLTDWSHRPLTAEQMDYAEDDVRYLICAYEVMAERLEQRGRMS 174

Query: 179 LA 180
            A
Sbjct: 175 WA 176


>gi|209885458|ref|YP_002289314.1| ribonuclease D [Oligotropha carboxidovorans OM5]
 gi|209873654|gb|ACI93450.1| ribonuclease D [Oligotropha carboxidovorans OM5]
          Length = 386

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 80/169 (47%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L        LC+VQL+  D  V +  +A G    P    ++ +EK  K+FH  
Sbjct: 23  VTVDTEFLRETTYYPLLCVVQLASTDEAVVVDALAEGIDLKP-FFDLMANEKVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++   +   PVF T++A+ +   Y +       +  + G  + K  + +DWS 
Sbjct: 82  RQDIEIVWHLANIVPHPVFDTQVAA-MVLGYGDSIAYDQLVGRITGHKLDKTHRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             L+ EQ  YA +DV HL  + L     L++  R+D  +     L   A
Sbjct: 141 RPLTQEQTTYALADVTHLRDVFLVLDADLKKRNRADWVSEEMQILTSPA 189


>gi|294084191|ref|YP_003550949.1| ribonuclease D [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663764|gb|ADE38865.1| ribonuclease D [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 409

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 80/157 (50%), Gaps = 4/157 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDI-IRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           +A+DTE +       +LC++Q+  GDGT  + I   A   N   L  ++ DE   K+FH 
Sbjct: 50  LAIDTEFMRERTYYPQLCLIQV--GDGTKAVAIDPLAKNLNLEPLWSLMRDESIIKVFHA 107

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
           G  D+ +     G    PV+ T+IA  L   + +Q G    +K +LG N+ K  + +DWS
Sbjct: 108 GNQDMEIFLNEMGGLPSPVYDTQIAG-LVCGHGDQIGYDSLVKSILGKNVDKTSRFTDWS 166

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
              L+D Q+ YA  DV++L  +     +K+    R++
Sbjct: 167 KRPLTDRQISYALDDVIYLAQIYPIMLDKIASENRTN 203


>gi|56697032|ref|YP_167394.1| ribonuclease D [Ruegeria pomeroyi DSS-3]
 gi|56678769|gb|AAV95435.1| ribonuclease D [Ruegeria pomeroyi DSS-3]
          Length = 385

 Score = 72.4 bits (176), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 95/206 (46%), Gaps = 10/206 (4%)

Query: 10  DIPAECAARYVDA-IAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDIIRIAAGQKNAP 64
           ++ A C A    A + VDTE L       +LC++QL+ PG   D  V +  +A G +  P
Sbjct: 9   ELAAFCKAAASHAYVTVDTEFLRERTYYSKLCLIQLAYPGEDADSAVLVDPLAEGLELEP 68

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +  D    K+FH  R D+ + +   GV   P+F T++A+ +   +  Q G +  ++
Sbjct: 69  -LYTLFRDTSVVKVFHAARQDLEIFWVDAGVFPEPLFDTQVAAMVC-GFGEQVGYETLVR 126

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           ++    + K  + +DWS   LSD Q  YA +DV HL  +       L + GRS       
Sbjct: 127 KICRQGLDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEHLAADLAKTGRSHWVAEEL 186

Query: 185 NFLMDRAELDLL---GWENVDIFSHS 207
             L D A  D+     W  +   ++S
Sbjct: 187 RTLTDPATYDIRPEEAWRRIKTRTNS 212


>gi|259416057|ref|ZP_05739977.1| ribonuclease D [Silicibacter sp. TrichCH4B]
 gi|259347496|gb|EEW59273.1| ribonuclease D [Silicibacter sp. TrichCH4B]
          Length = 385

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 94/200 (47%), Gaps = 8/200 (4%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI--AAGQKNAPNLVGML 70
           E AA Y   + VDTE L       +LC++Q++  GDG  D + +   +   +   L  + 
Sbjct: 15  EEAANY-PYVTVDTEFLRERTYYSKLCLIQIAFRGDGKTDAVLVDPLSSDLSLEPLYELF 73

Query: 71  VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGIN 130
            +E   K+FH  R D+ + +    V  +P+F T++A+ +   +  Q G +  ++++    
Sbjct: 74  RNEDVVKVFHAARQDLEIFWVDASVFPKPLFDTQVAAMVC-GFGEQVGYETLVRKICKQG 132

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           + K  + +DWS   LSD Q  YA +DV HL  +     ++L + GRS         L D 
Sbjct: 133 LDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEHLRKELDKTGRSHWVAEELQVLTDP 192

Query: 191 AELDLL---GWENVDIFSHS 207
           A  D+     W  V   ++S
Sbjct: 193 ATYDIQPREAWRRVKTRTNS 212


>gi|319405613|emb|CBI79236.1| Ribonuclease D [Bartonella sp. AR 15-3]
          Length = 383

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 87/165 (52%), Gaps = 2/165 (1%)

Query: 13  AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD 72
           A  A R  + + VDTE +       +LC++Q++  D T+ +I   A   N      +++D
Sbjct: 13  AIAALRKSNFVTVDTEFIRETTFWPQLCLIQVASSDVTI-LIDPMAQDINLQPFFDLMID 71

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           +K  K+FH  R DI ++++  GV   P+F T++A  +   + +       ++   G ++ 
Sbjct: 72  KKIVKVFHAARQDIEIIYHLGGVIPSPLFDTQVAGSIC-GFGDSISYDQIVQRCTGHHLD 130

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           K+ + +DWS   LS++QL YA +DV +L  + L   ++L+   R+
Sbjct: 131 KSSRFTDWSCRPLSEKQLLYALADVTYLREVYLVLKKQLEEKKRT 175


>gi|110679520|ref|YP_682527.1| ribonuclease D [Roseobacter denitrificans OCh 114]
 gi|109455636|gb|ABG31841.1| ribonuclease D [Roseobacter denitrificans OCh 114]
          Length = 387

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 80/160 (50%), Gaps = 4/160 (2%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLS-PG--DGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           D + VDTE L       +LC++QL+ PG  D T  I+   A   +   L  +  D    K
Sbjct: 21  DYVTVDTEFLRERTYYSKLCLIQLAMPGEDDSTGCIVDPLAPGLSLEPLYALFRDTSVVK 80

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R D+ + +    V   P+F T++A+ +   +  Q G +  ++ +    + K  + 
Sbjct: 81  VFHAARQDLEIFYVDAEVFPEPLFDTQVAAMVC-GFGEQVGYETLVRRIAKKPLDKTSRF 139

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           +DWS   L+D Q++YA +DV HL  +     EKL+  GRS
Sbjct: 140 TDWSRRPLTDAQMKYALADVTHLREVYEFLAEKLEETGRS 179


>gi|297184397|gb|ADI20513.1| ribonuclease d [uncultured alpha proteobacterium EB080_L58F04]
          Length = 387

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 86/165 (52%), Gaps = 6/165 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDG---TVDIIRIAAGQKNAPNLVGMLV 71
           AA+  D + +DTE L       +LC++QL+ PG G    V +  +A G K    L  +  
Sbjct: 16  AAKAFDYVTIDTEFLRERTYYSKLCLIQLAVPGKGDDHAVLVDPLAHGLK-LDALYALFE 74

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           DE   K+FH  R D+ +     GV  +P+F T++A+ +   +  Q G +  ++++   +I
Sbjct: 75  DETVVKVFHAARQDLEIFCVDAGVLPKPLFDTQVAA-MVCGFGEQVGYETLVRKITKNSI 133

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            K+ + +DWS   L++ Q  YA +DV HL  +      K+++ GR
Sbjct: 134 DKSSRFTDWSRRPLTEAQKSYALADVTHLRQVYEFLRAKIEKTGR 178


>gi|118340523|gb|ABK80573.1| putative ribonuclease D [uncultured marine Nitrospinaceae
           bacterium]
          Length = 386

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 86/185 (46%), Gaps = 14/185 (7%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +       R  ++Q+  G+    I  IA    +   L+ +L D  + K+FH
Sbjct: 20  DVLVVDTEFVRERTYFHRTGLIQVGGGEHFAAIDPIAL--PDMTPLLELLKDPTKVKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R D+ +L    G  + P+F T+IA+ L   +  Q      + + LG  I K++  +DW
Sbjct: 78  AARQDLEILVRFCGQVIPPIFDTQIAAALV-GWGTQISFAKIVYKALGKKIHKSETYTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWEN 200
               LSD Q++YA  DV +L  +  +  E+L+++GR D      N            WE+
Sbjct: 137 CRRPLSDSQIEYAIDDVRYLMPVYNKLIERLKKMGRLDWVQGEVN-----------AWED 185

Query: 201 VDIFS 205
              F+
Sbjct: 186 PKTFA 190


>gi|92117640|ref|YP_577369.1| ribonuclease D [Nitrobacter hamburgensis X14]
 gi|91800534|gb|ABE62909.1| ribonuclease D [Nitrobacter hamburgensis X14]
          Length = 396

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 5/182 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L        LC+VQ++  D  V +  +A G    P    ++ +E+  K+FH  
Sbjct: 37  VTVDTEFLRETTYYPLLCVVQMASPDEAVVVDALAEGIDLKP-FFDLMSNERVLKVFHAA 95

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++++  G+   P+F T++A+ +   Y +       ++ + G    K  + +DWS 
Sbjct: 96  RQDIEIVWHQAGIIPHPIFDTQVAA-MVLGYGDSIAYDALVERVNGHRPDKTHRFTDWSR 154

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL---LGWE 199
             L+ +QL+YA +DV HL  +       L++ GR D  +     L      D      WE
Sbjct: 155 RPLTKDQLEYAVADVTHLRDVFAALDADLKKRGRGDWVSEEMEVLTSPKTYDFHPERAWE 214

Query: 200 NV 201
            +
Sbjct: 215 RL 216


>gi|210632651|ref|ZP_03297493.1| hypothetical protein COLSTE_01396 [Collinsella stercoris DSM 13279]
 gi|210159428|gb|EEA90399.1| hypothetical protein COLSTE_01396 [Collinsella stercoris DSM 13279]
          Length = 377

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 84/171 (49%), Gaps = 8/171 (4%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C  AR   AIA+DTE L       +LC+VQ++  D  V I  +     +   L  
Sbjct: 8   DLSAFCGRARCHVAIAIDTEFLRERTYHAKLCLVQVATPDECVVIDPLTIDDLSP--LAE 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRL--TRTYTNQHGLKDNLKEL 126
           ++ D    K+FH    D+ VL +T GV   P+F T++A+     R   + H L   +   
Sbjct: 66  LMADVDTLKVFHACSQDMEVLVHTLGVCPAPIFDTQVAAGFLGERAQCSYHNL---VHSF 122

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            G+++ K +  +DWS   LS +Q++YA  DV +L         KL  LGR+
Sbjct: 123 CGVSLPKTESLTDWSRRPLSPQQIEYAVDDVRYLIDAYRVIESKLHSLGRT 173


>gi|300863439|ref|ZP_07108394.1| putative DNA polymerase I [Oscillatoria sp. PCC 6506]
 gi|300338502|emb|CBN53536.1| putative DNA polymerase I [Oscillatoria sp. PCC 6506]
          Length = 597

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 92/177 (51%), Gaps = 4/177 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTET GL P  +R+ ++Q++     V I+ +AA   +  + +  L++    K+F  G
Sbjct: 37  IGIDTETTGLDPLTERIRLIQIAAPQHPVIIVDLAALADSELSPLKALLNSSALKVFQNG 96

Query: 83  RFDIAVLFYTFGVRVR-PVFCTKIASRLTRT-YTNQHGLKDNLKELLGINISKAQQSSDW 140
           +FD  VL    G+R   P F   +AS++ R+     H L+    E LGI + K+ QSS++
Sbjct: 97  KFDWQVLEMA-GLRPSGPFFDVMLASQVLRSGLKKDHDLQSLTFEFLGIKLDKSLQSSNF 155

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLG 197
            A  LS  QL+YAA D   L  LR +   KL+  G  + A      +   A+++L G
Sbjct: 156 -AGKLSASQLEYAALDAAVLLKLRARLHSKLRSAGLLETAKIEFAAMPAVAQMELNG 211


>gi|95928412|ref|ZP_01311160.1| 3'-5' exonuclease [Desulfuromonas acetoxidans DSM 684]
 gi|95135683|gb|EAT17334.1| 3'-5' exonuclease [Desulfuromonas acetoxidans DSM 684]
          Length = 374

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 70/141 (49%), Gaps = 4/141 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
            AVD E   +   ++++C++Q +  D TV +  +AAG  +   L  +L D    KIFH  
Sbjct: 26  FAVDLEADSMHSYQEKVCLLQFTYHDTTVLLDPLAAG--DLAPLKPVLADSSIRKIFHAA 83

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +DI  L   F + +R +F T IAS+       + GL D L +   + + K  Q +DWS 
Sbjct: 84  DYDIRCLARDFDIEIRGLFDTMIASQFL--GEEKVGLADVLGKYFDVTLDKRFQRADWSK 141

Query: 143 DDLSDEQLQYAASDVVHLHAL 163
             LS E   YAA D  HL  L
Sbjct: 142 RPLSPEMCHYAAEDTRHLEKL 162


>gi|85702967|ref|ZP_01034071.1| ribonuclease D [Roseovarius sp. 217]
 gi|85671895|gb|EAQ26752.1| ribonuclease D [Roseovarius sp. 217]
          Length = 386

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 90/196 (45%), Gaps = 7/196 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDG---TVDIIR 55
           M TI   E D+   CA AR    + VDTE L       +LC++QL+ PG G    V +  
Sbjct: 1   MKTITTTE-DLAEFCAMARTHSYVTVDTEFLRERTYYSKLCLLQLAVPGKGDDSAVLVDP 59

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           I     +   L  +  D    K+FH  R D+ + +   GV   P+F T++A+ +   +  
Sbjct: 60  IEGEDMSMEPLYELFRDTSVVKVFHAARQDLEIFYVDAGVIPDPMFDTQVAAMVC-GFGE 118

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  +K +    + K+ + +DWS   L+D Q  YA +DV HL  +     +KL   G
Sbjct: 119 QVGYETLVKRIAKQTVDKSSRFTDWSRRPLTDAQKTYALADVTHLRVVYEFLAKKLASSG 178

Query: 176 RSDLATSCCNFLMDRA 191
           R        + L D A
Sbjct: 179 RDKWVAEELSVLTDPA 194


>gi|84501108|ref|ZP_00999343.1| ribonuclease D [Oceanicola batsensis HTCC2597]
 gi|84391175|gb|EAQ03593.1| ribonuclease D [Oceanicola batsensis HTCC2597]
          Length = 385

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 91/180 (50%), Gaps = 6/180 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PG--DGTVDIIRI 56
           M TI   E D+ A C  A   D + VDTE L       +LC++Q++ PG  D    +I  
Sbjct: 1   MRTITTTE-DLAAFCNEAASCDYVTVDTEFLRERTYYSQLCLIQMAMPGEDDENAVLIDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            +G  +   L  +  ++   K+FH  R D+ + +   GV  +P+F T+IA+ +   +  Q
Sbjct: 60  LSGNLDLAPLYELFRNQAVVKVFHAARQDLEIFYVDAGVIPQPLFDTQIAAMVC-GFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K +    + K+ + +DWS   L++ Q +YA +DV HL  +     +KL+R  R
Sbjct: 119 VGYETLVKRIAKQQLDKSSRFTDWSRRPLTEAQKKYALADVTHLRKIYEYLADKLRRQKR 178


>gi|319407179|emb|CBI80818.1| Ribonuclease D [Bartonella sp. 1-1C]
          Length = 383

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 92/190 (48%), Gaps = 5/190 (2%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEK 74
            A R  + + VDTE +       +LC++Q++  D T+ +I       N      +++D+K
Sbjct: 15  AALRKSNFVTVDTEFIRETTFWPQLCLIQVASQDITI-LIDPMVQDINLQPFFDLMIDKK 73

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+FH  R DI ++++  G+   P+F T++A  +   + +       ++   G ++ K+
Sbjct: 74  VVKVFHAARQDIEIIYHLGGIIPSPLFDTQVAGSIC-GFGDSISYDQIVQRCTGHHLDKS 132

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
            + +DWS   LS++QL YA SDV +L  + L   ++L+   R+         L+     D
Sbjct: 133 SRFTDWSCRPLSEKQLLYAVSDVTYLRDVYLALKKQLEEKKRTHWMHDEMTLLLTPTTYD 192

Query: 195 LL---GWENV 201
           +     W+ V
Sbjct: 193 IPENEAWKKV 202


>gi|222085490|ref|YP_002544020.1| ribonuclease D [Agrobacterium radiobacter K84]
 gi|221722938|gb|ACM26094.1| ribonuclease D [Agrobacterium radiobacter K84]
          Length = 381

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 82/173 (47%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC++Q++     V +  +A G    P    ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPELCLIQMASPTTEVLVDPLAKGLDLKP-FFELMANTAVMKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++F    +   P+F T++A+ +   + +       +  +  I I K+ + +DWS 
Sbjct: 80  RQDIEIIFNRGNLIPHPIFDTQVAAMVC-GFGDSVSYDQLVSRIKNIQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             LS++QL YA +DV HL  + L   E+L+R GR+         L  R   DL
Sbjct: 139 RPLSEKQLDYALADVTHLRDVYLSLKEQLEREGRASWLLEEMAILEARETYDL 191


>gi|209964842|ref|YP_002297757.1| ribonuclease D, putative [Rhodospirillum centenum SW]
 gi|209958308|gb|ACI98944.1| ribonuclease D, putative [Rhodospirillum centenum SW]
          Length = 385

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 76/155 (49%), Gaps = 2/155 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC+VQ++  D    I  +A G    P L  +L D    K+FH  
Sbjct: 23  VTVDTEFMREKTYWPQLCLVQVAGPDEAAAIDPLAEGMDLTP-LFELLHDPGVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  +  G    P+F T+IA+ +   + +  G +  + +L    I K+ + +DWS 
Sbjct: 82  RQDVEIFVHLTGAVPAPLFDTQIAA-MVCGFGDSVGYETLITKLTSARIDKSSRFTDWSQ 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
             L++ QL YA SDV HL     +   +L + GR 
Sbjct: 141 RPLTERQLSYALSDVTHLRPAYEKLRRRLAKTGRE 175


>gi|110633474|ref|YP_673682.1| ribonuclease D [Mesorhizobium sp. BNC1]
 gi|110284458|gb|ABG62517.1| ribonuclease D [Chelativorans sp. BNC1]
          Length = 392

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 86/180 (47%), Gaps = 14/180 (7%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++    T  +  +A G   AP    ++ +E+  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPELCLIQMAAPGVTALVDPLADGMDLAP-FFRLMGNEQVVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK------ELLGINISKA 134
             R DI +++   G+   P+F T++A+ +        G  D++        + G +I K 
Sbjct: 80  AARQDIEIIYNRGGLIPHPIFDTQVAAMVC-------GFGDSISYDQLVLRITGEHIDKT 132

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
            + +DW    LS++QL+YA +DV HL  +    T +LQR GR        + L  R   D
Sbjct: 133 SRFTDWRHRPLSEKQLRYALADVTHLIPVYAHLTTELQRGGREGWLKEEMDVLTARETYD 192


>gi|49475730|ref|YP_033771.1| ribonuclease D [Bartonella henselae str. Houston-1]
 gi|49238537|emb|CAF27773.1| Ribonuclease D [Bartonella henselae str. Houston-1]
          Length = 406

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 84/160 (52%), Gaps = 2/160 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R  D + +DTE +       +LC++QL+  D TV I  I+      P    ++V++K  K
Sbjct: 41  RNSDFVTIDTEFIRETTFWPQLCLIQLASPDTTVLIDPISQDIDLKP-FFDLMVNKKIVK 99

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R DI  +++  GV   P+F T+IA  +   + +       ++   G  + K+ + 
Sbjct: 100 VFHAARQDIETIYHLGGVIPSPLFDTQIAGSIC-GFGDSISYDQIVQRCTGYQLDKSSRF 158

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           +DWS   LS++QL YA +DV +L  + L   ++L++  R+
Sbjct: 159 TDWSFRPLSEKQLLYALADVTYLRDVYLLLKKQLEKNKRT 198


>gi|46204778|ref|ZP_00049503.2| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 214

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 76/154 (49%), Gaps = 1/154 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DG   ++   A   +    + ++ DE   K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKGLDLKPFLDLMADESTVKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+   P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLLGGLLPHPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKARIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LSD QL YA SDV HL  +      +L R  R
Sbjct: 142 RPLSDAQLAYALSDVTHLVTIYQVLAAELVRTDR 175


>gi|332185190|ref|ZP_08386939.1| ribonuclease D [Sphingomonas sp. S17]
 gi|332014914|gb|EGI56970.1| ribonuclease D [Sphingomonas sp. S17]
          Length = 392

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 76/158 (48%), Gaps = 1/158 (0%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
            D I VDTE +        LC++Q++       I   A G    P L  ++ +++  K+F
Sbjct: 23  ADFITVDTEFMRESTYWPELCLIQIADTQEAAAIDPKAPGLDMTPLLDLLVNNDEVLKVF 82

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H G  DI +++   G    P+F T+IA+ +      Q G  + +   LGI + K  + +D
Sbjct: 83  HAGGQDIEIIYNLTGKTPHPLFDTQIAA-MALGQGEQIGYSNLVDSWLGIQVDKGARFTD 141

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           WS   L   Q+ YA  DV HL  +  +  E+L++ GR 
Sbjct: 142 WSRRPLDQRQVDYAIGDVTHLSDIFPRMLERLRKTGRG 179


>gi|149186862|ref|ZP_01865172.1| ribonuclease D [Erythrobacter sp. SD-21]
 gi|148829529|gb|EDL47970.1| ribonuclease D [Erythrobacter sp. SD-21]
          Length = 411

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 3/172 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD-EKREKIF 79
           D + VDTE +        LC+VQ++  +    I  +A G    P L  +L D E+  K+F
Sbjct: 25  DFVTVDTEFMRENTYWPELCLVQIANEEEAAAIDPLADGIDLQP-LWDLLCDNEEVLKVF 83

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H G  D+ +++   G    P+F T+IA  +  +   Q G  + ++  +GI + K  + +D
Sbjct: 84  HAGGQDVEIVYNFTGKTPHPIFDTQIAM-MAISQNEQIGYANLVESWMGITVDKGARFTD 142

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           W    L+D Q++YA  DV HL  +     +KL + GR     +  + L D A
Sbjct: 143 WGRRPLTDRQIEYAIGDVTHLSKIFPMILKKLIKTGRGVWLDAEMDKLADPA 194


>gi|163759179|ref|ZP_02166265.1| putative ribonuclease D [Hoeflea phototrophica DFL-43]
 gi|162283583|gb|EDQ33868.1| putative ribonuclease D [Hoeflea phototrophica DFL-43]
          Length = 383

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 82/173 (47%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L        LC++Q++  D    +  +A G    P    ++ D    K+FH  
Sbjct: 23  VTVDTEFLRETTYWPELCLIQMAGPDDEGIVDPLAEGIDLKP-FFELMADTSVVKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++ +   +   P+F T++A+ +   +         +  + G +I K+ + +DWS 
Sbjct: 82  RQDIEIMVHRGDLVPHPIFDTQVAAMVC-GFGESISYDQLVSRITGAHIDKSSRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             LSD+QL YA +DV HL  + L+   +L+  GRS         L  RA  ++
Sbjct: 141 RPLSDKQLDYALADVTHLRDVYLELLSRLKAEGRSHWVADEMAVLESRATYEI 193


>gi|159044436|ref|YP_001533230.1| putative ribonuclease D [Dinoroseobacter shibae DFL 12]
 gi|157912196|gb|ABV93629.1| putative ribonuclease D [Dinoroseobacter shibae DFL 12]
          Length = 385

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 85/173 (49%), Gaps = 6/173 (3%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLS-PGDG---TVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           D + VDTE L       +LC+VQL+ PG+G    V +  +A G   AP ++ +  +    
Sbjct: 21  DYVTVDTEFLRERTYYAKLCLVQLAYPGEGEETAVLVDPLAEGMSLAP-MLDLFRNPDVV 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ + F   GV   P+F T++A+ +   +  Q G +  ++++   ++ K  +
Sbjct: 80  KVFHAARQDLEIFFVEHGVFPEPLFDTQVAAMVC-GFGEQVGYETLVRKIARESLDKTSR 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            +DWS   LS  Q +YA +DV HL  +       + + GR          L+D
Sbjct: 139 FTDWSHRPLSKAQKKYALADVTHLRVIYEYLAAAIDKTGRRAWVEEELQGLLD 191


>gi|258541225|ref|YP_003186658.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256632303|dbj|BAH98278.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256635360|dbj|BAI01329.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-03]
 gi|256638415|dbj|BAI04377.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-07]
 gi|256641469|dbj|BAI07424.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-22]
 gi|256644524|dbj|BAI10472.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-26]
 gi|256647579|dbj|BAI13520.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-32]
 gi|256650632|dbj|BAI16566.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653623|dbj|BAI19550.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-12]
          Length = 402

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 80/169 (47%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC+VQ+   +  V I  +A G    P L  + VD    K+FH  
Sbjct: 34  VTVDTEFMREQTYWPELCLVQIGATNDVVLIDALADGIDLTP-LKNLFVDTAVLKVFHAA 92

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  + F     P+F T++A+ +   + +Q G    +  L G  I K+ + +DWS 
Sbjct: 93  RQDLEIFLHLFDALPTPLFDTQVAA-MVAGFGDQVGYDSLVGSLTGHMIDKSHRFTDWSV 151

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             LS  QL YAA DV  L  +  +  +KL++  R D   +    L D A
Sbjct: 152 RPLSPAQLTYAAGDVTWLRLVYERLVKKLEQEQRLDWVAAEMAELEDPA 200


>gi|227821514|ref|YP_002825484.1| ribonuclease D [Sinorhizobium fredii NGR234]
 gi|227340513|gb|ACP24731.1| ribonuclease D [Sinorhizobium fredii NGR234]
          Length = 383

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 82/173 (47%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC++Q++  D  V +  +A G   AP    ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPELCLIQMAGPDTAVIVDPMAPGIDLAP-FFALMANADVVKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++ +   +   P+F T++A+ +   + +       +  +  + I K+ + +DWS 
Sbjct: 80  RQDIEIIHHLGNLIPHPLFDTQVAAMVC-GFGDSVSYDQLVSRIKNVQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             L+D+QL YA +DV HL  +      +L+R GRS         L  R   DL
Sbjct: 139 RPLTDKQLDYALADVTHLRDVYHYLKAELEREGRSSWLAEEMAILESRETYDL 191


>gi|319408646|emb|CBI82301.1| Ribonuclease D [Bartonella schoenbuchensis R1]
          Length = 383

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 91/184 (49%), Gaps = 5/184 (2%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +       +LC++QL+  + T+ +I       +  +   ++VDEK  K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPQLCLIQLASPNVTM-LIDPMVPDIDLQSFFDLMVDEKIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI  +++  G+   P+F T+IA  +   + +       ++   G ++ K+ + +DW
Sbjct: 80  AARQDIETIYHLGGIIPYPLFDTQIAGSIC-GFGDSISYDQIVQRCTGHHLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL---G 197
           S   LS++QL YA +DV +L  + L   +KL++  R+         L+     D+     
Sbjct: 139 SHRPLSEKQLLYALADVTYLRDVYLSLKKKLEKNKRTHWMDDELEILLTPTTYDIPEEDA 198

Query: 198 WENV 201
           W+ V
Sbjct: 199 WKKV 202


>gi|315500006|ref|YP_004088809.1| ribonuclease d [Asticcacaulis excentricus CB 48]
 gi|315418018|gb|ADU14658.1| ribonuclease D [Asticcacaulis excentricus CB 48]
          Length = 382

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 78/154 (50%), Gaps = 3/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I VDTE +       +LC++Q +  +    II   +   +    + +L D    K+FH  
Sbjct: 23  ITVDTEFMRETTYWPKLCLIQAA-SEEHAGIIDPLSPDLDLKPFLDLLTDPAILKVFHAC 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ + F   G    PVF T++A+ +   + +Q      +++++ ++I K  + +DWS 
Sbjct: 82  RQDVEI-FNNLGAMPAPVFDTQVAA-MAAGFGDQVAYDSLVRQVIKVDIDKGSRFTDWSR 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS++QLQYA  DV HL  L  +  EKL+   R
Sbjct: 140 RPLSEQQLQYALGDVTHLARLYPKLVEKLKAQNR 173


>gi|163746426|ref|ZP_02153784.1| ribonuclease D [Oceanibulbus indolifex HEL-45]
 gi|161380311|gb|EDQ04722.1| ribonuclease D [Oceanibulbus indolifex HEL-45]
          Length = 385

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 83/168 (49%), Gaps = 7/168 (4%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDIIRIAAGQKNAPNLVGM 69
           E AARY D + VDTE L       +LC+VQL+ PG      V +  +A G    P L  +
Sbjct: 15  EEAARY-DYVTVDTEFLRERTYYSKLCLVQLAMPGTDDSNAVLVDPLAEGISLEP-LYTL 72

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
             D    K+FH  R D+ + F    V   P+F T++A+ +   +  Q G +  ++++   
Sbjct: 73  FRDTSVVKVFHAARQDLEIFFVDAEVFPEPLFDTQVAAMVC-GFGEQVGYETLVRKIAHQ 131

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            + K  + +DWS   L+D Q  YA +DV HL  +      KL+  GR+
Sbjct: 132 ALDKTSRFTDWSRRPLTDAQKTYALADVTHLRQIYEFLARKLEETGRA 179


>gi|170742646|ref|YP_001771301.1| ribonuclease D [Methylobacterium sp. 4-46]
 gi|168196920|gb|ACA18867.1| ribonuclease D [Methylobacterium sp. 4-46]
          Length = 394

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 75/139 (53%), Gaps = 3/139 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDII-RIAAGQKNAPNLVGMLVDEKREKIFHY 81
           + VDTE +       +LC++Q++  DGT  ++  +A G   AP    ++ DE   K+FH 
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQIAAPDGTTALVDPLAPGIDLAP-FFALMGDEGVLKVFHS 81

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            R D+ +++   G+  +P F T++A+ +   Y +    +  + ++    + K+ + +DWS
Sbjct: 82  ARQDLEIIWLQGGLLPQPFFDTQVAAMVC-GYGDSVSYEQLVNDVAKAKVDKSSRFTDWS 140

Query: 142 ADDLSDEQLQYAASDVVHL 160
              LS+ QL YA SDV HL
Sbjct: 141 RRPLSEAQLTYALSDVTHL 159


>gi|319898851|ref|YP_004158944.1| Ribonuclease D [Bartonella clarridgeiae 73]
 gi|319402815|emb|CBI76366.1| Ribonuclease D [Bartonella clarridgeiae 73]
          Length = 385

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 85/163 (52%), Gaps = 2/163 (1%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEK 74
            A R  + + VDTE +       +LC++Q++  D T  +I   A   N      +++D+K
Sbjct: 15  AALRNSNFVTVDTEFIRETTFWPQLCLIQVASPDITT-LIDPMAQDINLQPFFDLMIDKK 73

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+FH  R DI  +++  GV   P+F T++A  +   + +       ++   G ++ K+
Sbjct: 74  VVKVFHAARQDIETIYHLGGVIPSPLFDTQVAGSIC-GFGDSISYDQIVQRCTGHHLDKS 132

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            + +DWS   LS++QL YA +DV +L  + L   ++L++  R+
Sbjct: 133 SRFTDWSCRPLSEKQLLYALADVTYLRDVYLTLKKQLEKKKRT 175


>gi|261868337|ref|YP_003256259.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413669|gb|ACX83040.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 385

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 84/175 (48%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AAR   A+A+DTE + +     +L ++Q+  GD  V +I     Q  +P  + +L D   
Sbjct: 29  AARQQSAVALDTEFVRVRTLYPKLGLIQMYFGD-RVALIDPLPIQDFSP-FIKLLADTNL 86

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V  + F    RP+  T++ +     +    G    ++    I I K  
Sbjct: 87  VKILHACSEDLDVFQHYFQQLPRPMCDTQVMAHFL-GFAGSTGFATLVQHYFQIEIDKGA 145

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  LSD QLQYAA+DV +L  L  Q  ++L +     +  + C FL+++
Sbjct: 146 SRTDWLARPLSDTQLQYAAADVWYLLPLYEQMQQQLTQTEWQSVVENECEFLLNK 200


>gi|220924978|ref|YP_002500280.1| ribonuclease D [Methylobacterium nodulans ORS 2060]
 gi|219949585|gb|ACL59977.1| ribonuclease D [Methylobacterium nodulans ORS 2060]
          Length = 389

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 73/138 (52%), Gaps = 1/138 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DG+  ++   A   +      ++ DE+  K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQIAAPDGSTALVDPLAPAIDLTPFFALMGDERVLKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+  +P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLQGGLLPQPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKAKIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHL 160
             LS+ QL YA SDV HL
Sbjct: 142 RPLSEAQLSYALSDVTHL 159


>gi|307825065|ref|ZP_07655286.1| ribonuclease D [Methylobacter tundripaludum SV96]
 gi|307733813|gb|EFO04669.1| ribonuclease D [Methylobacter tundripaludum SV96]
          Length = 389

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 77/156 (49%), Gaps = 3/156 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE L       + C++Q++  +    I  IA    +   L   +      K+FH  
Sbjct: 27  LALDTEFLREKTYYPKFCLLQIATPEWVACIDPIALPSLDI--LFEAIYSPSIVKVFHSC 84

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ + +   G    P+F T+IA+ L   +    G    +  LL +N++KA   +DWS 
Sbjct: 85  RQDLEIFYQLTGKLPEPLFDTQIAAPLL-GFQENPGYAMLVSSLLNVNLNKAHTRADWSK 143

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             L D ++QYAA DV++L  +     +KL  LGR++
Sbjct: 144 RPLIDAEIQYAADDVIYLCKIYQMMLQKLAELGRAE 179


>gi|163735131|ref|ZP_02142567.1| ribonuclease D [Roseobacter litoralis Och 149]
 gi|161391589|gb|EDQ15922.1| ribonuclease D [Roseobacter litoralis Och 149]
          Length = 387

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 4/160 (2%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLS-PG--DGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           D + VDTE L       +LC++QL+ PG  D T  I+       +   L  +  D    K
Sbjct: 21  DYVTVDTEFLRERTYYSKLCLIQLAMPGEDDSTGCIVDPLVPGLSLEPLYALFRDTSVVK 80

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R D+ + +    V   P+F T++A+ +   +  Q G +  ++ +    + K  + 
Sbjct: 81  VFHAARQDLEIFYVDAEVFPEPLFDTQVAAMVC-GFGEQVGYETLVRRIAKQPLDKTSRF 139

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           +DWS   L+D Q++YA +DV HL  +     EKL+  GRS
Sbjct: 140 TDWSRRPLTDAQMKYALADVTHLRDVYEFLAEKLEETGRS 179


>gi|188533676|ref|YP_001907473.1| ribonuclease D [Erwinia tasmaniensis Et1/99]
 gi|188028718|emb|CAO96580.1| Ribonuclease D [Erwinia tasmaniensis Et1/99]
          Length = 373

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 85/174 (48%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+ T+ +I         P    +L D+K  
Sbjct: 19  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGE-TISLIDPLPITDWTP-FSELLQDQKVI 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +  +    +  G    ++   GI + K++ 
Sbjct: 77  KYLHAGSEDLEVFCHEFGVLPQPMIDTQILAAFSGRPLS-CGFATVVESFTGIALDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q QYAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 136 RTDWLARPLSEKQCQYAAADVFYLLPIAGKLVAEAESAGQMAAALDECRLLCQR 189


>gi|254443317|ref|ZP_05056793.1| 3'-5' exonuclease domain protein [Verrucomicrobiae bacterium
           DG1235]
 gi|198257625|gb|EDY81933.1| 3'-5' exonuclease domain protein [Verrucomicrobiae bacterium
           DG1235]
          Length = 370

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 84/166 (50%), Gaps = 12/166 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG---QKNAPNLVGMLVDEKREKIF 79
           IA+D+E   L     +LC++QL   DGT+ ++ + A     +    L G+ +      I 
Sbjct: 28  IALDSEADNLHHFETKLCLLQLR-FDGTIYLLDVTADLDLDRFWEILSGLHL------IM 80

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H   FD+ +     G   + +F + +AS+L      + GL   L+E  G+ I K  Q SD
Sbjct: 81  HGSDFDLRLFEEFCGFEAKSLFDSMLASQLLGI--KRIGLAALLEENFGVKIPKDSQKSD 138

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           WS   L+ + L+YAA+DV++LH LR +   ++  LGR +     C+
Sbjct: 139 WSQRPLTPKMLKYAATDVLYLHELRDKLMARIDELGRGEWLKQRCD 184


>gi|217976404|ref|YP_002360551.1| ribonuclease D [Methylocella silvestris BL2]
 gi|217501780|gb|ACK49189.1| ribonuclease D [Methylocella silvestris BL2]
          Length = 405

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 81/154 (52%), Gaps = 2/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L       +LC+VQL+  D  V +  +A+G   AP L  ++ D    K+FH  
Sbjct: 29  VTVDTEFLRETTFWPKLCVVQLASADEAVAVDALASGLDLAP-LFELMADPAVVKVFHAA 87

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++    +   P+F T++A+ +   + +Q    D ++ +  +++ K+ + +DWS 
Sbjct: 88  RQDLEIVWNLAKIIPAPLFDTQVAAMVC-GFGDQVSYGDLVQTVCKVSLDKSSRFTDWSR 146

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             L   Q+ YA +DV +L  +     +KL+  GR
Sbjct: 147 RPLLPAQVDYAIADVTYLRDIYAILQDKLKETGR 180


>gi|284006971|emb|CBA72245.1| ribonuclease D [Arsenophonus nasoniae]
          Length = 386

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 83/181 (45%), Gaps = 8/181 (4%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           AA     IA+DTE + +     +L ++QL  G+    +D I I     N      +L D 
Sbjct: 30  AASKASKIALDTEFVRVKTYYPQLSLIQLYDGEQLSLIDPIAIT----NMEPFKNLLTDG 85

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K  KI H G  DI V F+      +P+  T+I +     +    G    + + L I + K
Sbjct: 86  KVTKILHAGSEDIEVFFHHLACVPQPMLDTQIMAAFV-GHPISSGFASLVNKYLTIALDK 144

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT-SCCNFLMDRAE 192
           ++  +DW    LSD+Q QYAA+DV  L  L  +  + + +LG     T  C   L+ R E
Sbjct: 145 SESRTDWLVRPLSDKQCQYAAADVFFLLPLAEKLQQLVDKLGYLPAVTDECQRILLRRQE 204

Query: 193 L 193
           +
Sbjct: 205 I 205


>gi|158523201|ref|YP_001531071.1| 3'-5' exonuclease [Desulfococcus oleovorans Hxd3]
 gi|158512027|gb|ABW68994.1| 3'-5' exonuclease [Desulfococcus oleovorans Hxd3]
          Length = 382

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 83/170 (48%), Gaps = 8/170 (4%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLS-PGDG-TVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           V  +AVD E   L    +++C++Q+   GD   +D + ++    +  +L     D    K
Sbjct: 28  VPVVAVDLEADSLHHFTEKVCLIQIGVNGDAFLIDPLALS----DLSSLKPFFADPGVIK 83

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H   +D+  L+  FG+ +  +F ++IASR     +   GL D +    G+ + K  + 
Sbjct: 84  VLHGADYDVRSLYRDFGITITGLFDSEIASRFLGVQST--GLNDVVNRRFGVTMDKGCRK 141

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            DW+   L ++ L YAA DV +L  L  Q   +LQ++GR++     C  L
Sbjct: 142 QDWTQRPLPEKMLSYAALDVRYLVDLYHQLQNELQQMGRAEWVAEECELL 191


>gi|182412681|ref|YP_001817747.1| 3'-5' exonuclease [Opitutus terrae PB90-1]
 gi|177839895|gb|ACB74147.1| 3'-5' exonuclease [Opitutus terrae PB90-1]
          Length = 391

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 84/177 (47%), Gaps = 14/177 (7%)

Query: 12  PAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGM 69
           P   A   VD +A+DTE   +   R R+C++Q   G     VD++        AP     
Sbjct: 36  PLLAALDRVDEVALDTEADNMFHYRTRVCLLQFLVGREIFLVDVL--------APLPFEG 87

Query: 70  LVDEKREK--IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
           L     EK  I H   FD+ +L      R + +F T +A++L      + GL   L++  
Sbjct: 88  LWARLAEKNLIMHGSDFDLRLLHDFCRFRPKSIFDTMLAAQLINR--PRIGLASLLEDHF 145

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           G+ +SK  Q ++WS   L+ + L YAA DV HL ALR   T +L +LGR +     C
Sbjct: 146 GVKLSKESQKANWSKRPLTKKMLDYAALDVFHLPALRDILTRELTKLGRIEWLRQQC 202


>gi|229815608|ref|ZP_04445935.1| hypothetical protein COLINT_02659 [Collinsella intestinalis DSM
           13280]
 gi|229808838|gb|EEP44613.1| hypothetical protein COLINT_02659 [Collinsella intestinalis DSM
           13280]
          Length = 377

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 82/171 (47%), Gaps = 8/171 (4%)

Query: 10  DIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C  AR   AIA+DTE L       +LC+VQ++  D  V I  +A        L  
Sbjct: 8   DLTAFCNRARAFSAIAIDTEFLREKTYHAKLCLVQVATPDECVVIDPLAIDDLGP--LAE 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRL--TRTYTNQHGLKDNLKEL 126
           ++ D    K+FH    D+ VL +  G    P+F T++A+     R   + H L   +   
Sbjct: 66  LMTDVDTLKVFHACSQDMEVLCHALGSVPAPIFDTQVAAGFLGERAQCSYHNL---VSTF 122

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            G+++ K +  +DWS   LS +Q++YA  DV +L         KL  LGR+
Sbjct: 123 CGVSLPKTESLTDWSRRPLSPKQIEYALDDVRYLIDAYRVIESKLHSLGRT 173


>gi|148266297|ref|YP_001233003.1| 3'-5' exonuclease [Geobacter uraniireducens Rf4]
 gi|146399797|gb|ABQ28430.1| 3'-5' exonuclease [Geobacter uraniireducens Rf4]
          Length = 409

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 75/154 (48%), Gaps = 4/154 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A D E   L    +++C++Q+S    T  I  +A    +   L  +L +    K+FH  
Sbjct: 58  LAFDLEADSLHHYTEKVCLIQVSTNSETALIDPLAP--LDLSPLAPILANPAVRKVFHGA 115

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +D+  L+  FG  VR +F T IAS+       + GL   LK+  G+ + K  Q +DWS 
Sbjct: 116 DYDMRSLYRDFGFEVRNLFDTMIASQFLGE--KEVGLAAALKKRFGVELDKKYQKADWSK 173

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
              S + ++YA  D   L  L LQ  ++L+  GR
Sbjct: 174 RPFSPQMIEYAMKDTSLLIKLYLQLEDELRAKGR 207


>gi|83311936|ref|YP_422200.1| ribonuclease D [Magnetospirillum magneticum AMB-1]
 gi|82946777|dbj|BAE51641.1| Ribonuclease D [Magnetospirillum magneticum AMB-1]
          Length = 397

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 77/154 (50%), Gaps = 2/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC+VQ++  D    I  +A     AP L  ++ D    K+FH  
Sbjct: 23  VTVDTEFMREKTYWPQLCLVQVAGPDEARAIDPLAPDMDLAP-LFELMADTNVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  +       P+F T+IA+ +   + +  G +    +L    I K+ + +DWS 
Sbjct: 82  RQDVEIFLHLADAIPTPIFDTQIAAMVC-GFGDSVGYETLASQLAKARIDKSMRFTDWSI 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS++Q+QYA +DV HL     +   K+++ GR
Sbjct: 141 RPLSEKQIQYALADVTHLRVAYEKLVRKVEKNGR 174


>gi|85708161|ref|ZP_01039227.1| ribonuclease D [Erythrobacter sp. NAP1]
 gi|85689695|gb|EAQ29698.1| ribonuclease D [Erythrobacter sp. NAP1]
          Length = 400

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 78/154 (50%), Gaps = 1/154 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE +        LC+VQ++  +    I  +A G   +P L  +  +++  K+FH G
Sbjct: 26  VAVDTEFMRENTYWPELCLVQIANTEEAAAIDPLADGIDLSPLLELLTENDEVLKVFHAG 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ ++    G    P+F T+I S +  + + Q G  + +   L I + K  + +DWS 
Sbjct: 86  GQDVEIIVNMTGKTPFPIFDTQI-SMMAISQSEQIGYANLVDHWLNITVDKGARFTDWSR 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             L+D Q++YA  DV HL  +  +  +KL +  R
Sbjct: 145 RPLTDRQIEYAIGDVTHLSKIFPKILKKLMKTER 178


>gi|83942499|ref|ZP_00954960.1| ribonuclease D [Sulfitobacter sp. EE-36]
 gi|83846592|gb|EAP84468.1| ribonuclease D [Sulfitobacter sp. EE-36]
          Length = 385

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 81/161 (50%), Gaps = 6/161 (3%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           D + VDTE L       +LC++QL+ PG      V +  ++ G    P L  +  D    
Sbjct: 21  DYVTVDTEFLRERTYYSKLCLIQLAMPGTDDSNAVLVDPLSEGLSLDP-LYTLFRDTSVV 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ + +   GV   P+F T++A+ +   +  Q G +  ++++    + K  +
Sbjct: 80  KVFHAARQDLEIFYVDAGVFPEPLFDTQVAAMVC-GFGEQVGYETLVRKIAHQPLDKTSR 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            +DWS   LSD Q +YA +DV HL  +      KL++ GR+
Sbjct: 139 FTDWSRRPLSDAQAKYALADVTHLRQIYEFLARKLEQTGRA 179


>gi|294013278|ref|YP_003546738.1| ribonuclease D [Sphingobium japonicum UT26S]
 gi|292676608|dbj|BAI98126.1| ribonuclease D [Sphingobium japonicum UT26S]
          Length = 401

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 77/156 (49%), Gaps = 1/156 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTE +        LC+VQ++       I   A G   +P L  M+ +E   K+FH G
Sbjct: 39  IAVDTEFMRENSYWPDLCLVQVADEHEAAAIDPKAPGLDLSPLLDLMVDNEDVLKVFHAG 98

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ +++   G    P+F T+IA+ +      Q G  + +   LG+ + K  + +DW+ 
Sbjct: 99  GQDLEIIYNLTGKTPHPLFDTQIAA-MALGLGEQIGYGNLVDAWLGVQLDKGARFTDWAR 157

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             L   Q+ YA  DV +L  +  +  E+L+R GR D
Sbjct: 158 RPLDKRQIDYAIGDVTYLIQIFPKMLEELRRTGRGD 193


>gi|83953718|ref|ZP_00962439.1| ribonuclease D [Sulfitobacter sp. NAS-14.1]
 gi|83841663|gb|EAP80832.1| ribonuclease D [Sulfitobacter sp. NAS-14.1]
          Length = 385

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 92/183 (50%), Gaps = 10/183 (5%)

Query: 1   MTTIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDII 54
           M TI     ++ A C  AA++ D + VDTE L       +LC++QL+ PG      V + 
Sbjct: 1   MKTI-TTTAELEAYCTEAAKH-DYVTVDTEFLRERTYYSKLCLIQLAMPGTDDSNAVLVD 58

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
            ++ G    P L  +  D    K+FH  R D+ + +   GV   P+F T++A+ +   + 
Sbjct: 59  PLSEGLSLDP-LYTLFRDTSVVKVFHAARQDLEIFYVDAGVFPEPLFDTQVAAMVC-GFG 116

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            Q G +  ++++    + K  + +DWS   LSD Q +YA +DV HL  +      KL++ 
Sbjct: 117 EQVGYETLVRKIAHQPLDKTSRFTDWSRRPLSDAQAKYALADVTHLRQIYEFLARKLEQT 176

Query: 175 GRS 177
           GR+
Sbjct: 177 GRA 179


>gi|83593408|ref|YP_427160.1| ribonuclease D [Rhodospirillum rubrum ATCC 11170]
 gi|83576322|gb|ABC22873.1| Ribonuclease D [Rhodospirillum rubrum ATCC 11170]
          Length = 386

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 77/155 (49%), Gaps = 2/155 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++QL+ G      +   A   +   L  ++ +E   K+FH  
Sbjct: 23  VTVDTEFMREKTYWPKLCLIQLA-GTTEAHCVDPLAPDIDMAPLFALMANESVLKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  +  G   +P+F T++A+ +   + +  G +  + +L    I K+ + +DW+ 
Sbjct: 82  RQDLEIFLHESGHLPKPIFDTQVAAMVC-GFGDSVGYETLVAKLAKARIDKSMRFTDWAR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
             L+D QL YAA DV HL  +  +  E L   GR+
Sbjct: 141 RPLNDRQLVYAAGDVTHLRVVYERLAETLAANGRT 175


>gi|73667317|ref|YP_303333.1| 3'-5' exonuclease [Ehrlichia canis str. Jake]
 gi|72394458|gb|AAZ68735.1| 3'-5' exonuclease [Ehrlichia canis str. Jake]
          Length = 386

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 3/143 (2%)

Query: 23  IAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           IA+DTE +        RLC++Q++ G     +I + A   +   L  +L ++   K+FH 
Sbjct: 24  IAIDTEFIRNSSEYYPRLCLMQVAYGREQF-VIDVLASDMDLSPLNSILYNKNIVKVFHD 82

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK-AQQSSDW 140
            R DI  L   F     P+F T++A+     Y N  G    +++ LGI++ K + + S+W
Sbjct: 83  CRQDIDALLTKFPKIPNPIFDTQVAAMFCYCYENAVGYSRLVEQFLGISLDKLSLKRSNW 142

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
               LS +++QYA +DV++LH L
Sbjct: 143 MLRPLSPDKIQYALNDVIYLHEL 165


>gi|126735792|ref|ZP_01751537.1| ribonuclease D [Roseobacter sp. CCS2]
 gi|126714979|gb|EBA11845.1| ribonuclease D [Roseobacter sp. CCS2]
          Length = 385

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 92/196 (46%), Gaps = 8/196 (4%)

Query: 1   MTTIRVHEGDIPAECAARYVDA-IAVDTETLGLMPRRDRLCIVQLS----PGDGTVDIIR 55
           M TI   E D+ A C      A + VDTE L       +LC+VQL+     G   V +  
Sbjct: 1   MKTITTTE-DLAAFCQEAAKRAYVTVDTEFLRERTYYSKLCLVQLAYQDDSGADAVLLDP 59

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           +  G    P L  +  D    K+FH  R D+ + +   GV   P+F T++A+ +   +  
Sbjct: 60  LVDGLSLEP-LYDLFKDHGVVKVFHAARQDLEIFYVDAGVIPEPLFDTQVAAMVC-GFGE 117

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  ++++   ++ K+ + +DWS   L+D Q +YA +DV HL  +    + +L + G
Sbjct: 118 QVGYETLVRKITKSDLDKSSRFTDWSRRPLTDAQAKYALADVTHLRDIYEHLSARLAKSG 177

Query: 176 RSDLATSCCNFLMDRA 191
           RS         L D A
Sbjct: 178 RSKWVAEEMAVLEDPA 193


>gi|307317748|ref|ZP_07597186.1| ribonuclease D [Sinorhizobium meliloti AK83]
 gi|306896510|gb|EFN27258.1| ribonuclease D [Sinorhizobium meliloti AK83]
          Length = 383

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 82/173 (47%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC++Q++  +  V +  +A G   AP    ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPVLCLIQMASPEMAVIVDPMAPGIDLAP-FFALMSNPDVVKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++ +   +   P+F T++A+ +   + +       +  +    I K+ + +DWS 
Sbjct: 80  RQDIEIIHHLGNLIPHPIFDTQVAA-MVCGFGDSVSYDQLVNRIKNEQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             L+D+QL YA +DV HL  +    T++L R GRS         L  R   DL
Sbjct: 139 RPLTDKQLDYALADVTHLRDIYQYLTKELDREGRSSWLAEEMAILESRETYDL 191


>gi|254474856|ref|ZP_05088242.1| ribonuclease D [Ruegeria sp. R11]
 gi|214029099|gb|EEB69934.1| ribonuclease D [Ruegeria sp. R11]
          Length = 385

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 90/192 (46%), Gaps = 9/192 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           + VDTE L       +LC+VQL+ PG   +  V +  +A G    P L  +  +E   K+
Sbjct: 23  VTVDTEFLRERTYFSKLCLVQLAYPGKDNENAVLVDPLADGLSLEP-LYALFRNESVVKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ + +    V   P+F T++A+ +   +  Q G +  +++++   + K  + +
Sbjct: 82  FHAARQDLEIFWVDAQVFPTPLFDTQVAAMVC-GFGEQVGYETLVRKIVKQGLDKTSRFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL-- 196
           DWS   LSD Q  YA +DV HL  +      +L+R  RS         L D A  ++   
Sbjct: 141 DWSRRPLSDAQKTYALADVTHLRQIYEHLAAELKRTERSHWVAEELQVLTDPATYEINPR 200

Query: 197 -GWENVDIFSHS 207
             W  V   ++S
Sbjct: 201 DAWRRVKTRTNS 212


>gi|15964944|ref|NP_385297.1| ribonuclease D protein [Sinorhizobium meliloti 1021]
 gi|307301014|ref|ZP_07580783.1| ribonuclease D [Sinorhizobium meliloti BL225C]
 gi|15074123|emb|CAC45770.1| Probable ribonuclease D [Sinorhizobium meliloti 1021]
 gi|306903969|gb|EFN34555.1| ribonuclease D [Sinorhizobium meliloti BL225C]
          Length = 383

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 82/173 (47%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC++Q++  +  V +  +A G   AP    ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPVLCLIQMASPEMAVIVDPMAPGIDLAP-FFALMSNPDVVKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++ +   +   P+F T++A+ +   + +       +  +    I K+ + +DWS 
Sbjct: 80  RQDIEIIHHLGNLIPHPIFDTQVAA-MVCGFGDSVSYDQLVNRIKNEQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             L+D+QL YA +DV HL  +    T++L R GRS         L  R   DL
Sbjct: 139 RPLTDKQLDYALADVTHLRDIYQYLTKELDREGRSSWLAEEMAILESRETYDL 191


>gi|16125948|ref|NP_420512.1| ribonuclease D [Caulobacter crescentus CB15]
 gi|221234713|ref|YP_002517149.1| ribonuclease D [Caulobacter crescentus NA1000]
 gi|13423116|gb|AAK23680.1| ribonuclease D [Caulobacter crescentus CB15]
 gi|220963885|gb|ACL95241.1| ribonuclease D [Caulobacter crescentus NA1000]
          Length = 389

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 79/154 (51%), Gaps = 3/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE +       +LC++Q++       I  +A      P LV ++ DE+  K+FH  
Sbjct: 23  VAVDTEFMRETTYWPKLCLIQVASPTQEAVIDPLADNIDLEPLLV-VMRDERILKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ + F       +P+F T++A  +   +  Q      ++++L I I K+ + +DW+ 
Sbjct: 82  RQDVEI-FNNLKAMPKPLFDTQVAG-MAAGFGEQIAYDALVRQMLRIEIDKSSRFTDWAR 139

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             L+D QL YA +DV HL  L     E+L+  GR
Sbjct: 140 RPLTDAQLSYALADVTHLAKLFPILRERLETSGR 173


>gi|307295006|ref|ZP_07574848.1| ribonuclease D [Sphingobium chlorophenolicum L-1]
 gi|306879480|gb|EFN10698.1| ribonuclease D [Sphingobium chlorophenolicum L-1]
          Length = 388

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 77/156 (49%), Gaps = 1/156 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IA+DTE +        LC+VQ++       I   A G   +P L  M+ +E   K+FH G
Sbjct: 26  IAIDTEFMRENSYWPDLCLVQVADEHEAAAIDPKAPGLDLSPLLDLMVDNEDVLKVFHAG 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ +++   G    P+F T+IA+ +      Q G  + +   LG+ + K  + +DW+ 
Sbjct: 86  GQDLEIIYNLTGKTPHPLFDTQIAA-MALGLGEQIGYGNLVDAWLGVQLDKGARFTDWAR 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             L   Q+ YA  DV +L  +  +  E+L+R GR D
Sbjct: 145 RPLDKRQIDYAIGDVTYLIQIFPKMLEELRRTGRGD 180


>gi|84687040|ref|ZP_01014923.1| ribonuclease D [Maritimibacter alkaliphilus HTCC2654]
 gi|84665014|gb|EAQ11495.1| ribonuclease D [Rhodobacterales bacterium HTCC2654]
          Length = 387

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 7/172 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS--PGDGTVDIIRI---AAGQKNAPNLVGMLVDEKREK 77
           + VDTE L       +LC+VQL+    D  VD + +   A G    P L  +  DE   K
Sbjct: 23  VTVDTEFLRERTYYSKLCLVQLAVMGDDDEVDAVLVDPLADGLSLEP-LYELFRDEGVVK 81

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R D+ + +   G+   P+F T++A+ +   + +Q G +  ++++    + K+ + 
Sbjct: 82  VFHAARQDLEIFYVDAGLIPSPLFDTQVAAMVC-GFGDQAGYETLVRKIAKAQLDKSSRF 140

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           +DWS   L+D Q +YA  DV HL  +      +L+  GR+       + L D
Sbjct: 141 TDWSRRPLTDAQKKYAIGDVTHLRVIYEFLKAQLEETGRAKWVKEELSVLTD 192


>gi|301060312|ref|ZP_07201175.1| putative ribonuclease D [delta proteobacterium NaphS2]
 gi|300445508|gb|EFK09410.1| putative ribonuclease D [delta proteobacterium NaphS2]
          Length = 381

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 72/165 (43%), Gaps = 4/165 (2%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           AIAVD E   +   ++++C++Q S     + +  +A   K+   L  +       KIFH 
Sbjct: 29  AIAVDLEADSMFHYQEKVCLLQFSTPSKNILVDPLAV--KDLSPLAPIFKSFGICKIFHG 86

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
             +DI  L+  F + V  +F T+IA+R         GL   L+  L I + K  Q  DWS
Sbjct: 87  ADYDIRSLYRDFKIEVNALFDTQIAARFLGL--TDIGLASLLQGKLNITLKKKYQKKDWS 144

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
              L    LQYA  D  HL  L     E+L + GR       C  
Sbjct: 145 QRPLPAPMLQYAVHDTCHLIPLAQNLREELVKTGRLPFVEEECQL 189


>gi|94497624|ref|ZP_01304192.1| ribonuclease D [Sphingomonas sp. SKA58]
 gi|94422841|gb|EAT07874.1| ribonuclease D [Sphingomonas sp. SKA58]
          Length = 412

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 90/191 (47%), Gaps = 14/191 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD-EKREKIFHY 81
           +AVDTE +        LC+VQ++       I   A G    P L+ +LVD E   K+FH 
Sbjct: 50  VAVDTEFMRENSYWPDLCLVQVADSHEAAAIDPKAPGIDLTP-LLNLLVDNEDVLKVFHA 108

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
           G  DI ++    G    P+F T+IA+ +   +  Q G  + +   LG+ + K  + +DW+
Sbjct: 109 GGQDIEIVHNLTGKAPHPMFDTQIAA-MALGFGEQIGYGNLVDAWLGVQLDKGARFTDWA 167

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL-------ATSCCNFLMDRAELD 194
              L   Q+ YA  DV +L  +  +  E+L++ GR D         ++  N+  D A+  
Sbjct: 168 RRPLDKRQIDYAIGDVTYLIKIFPKMLEELKKTGRGDWLDQEMERISNPSNYENDPAD-- 225

Query: 195 LLGWENVDIFS 205
              W+ V I S
Sbjct: 226 --AWKRVRIAS 234


>gi|27379246|ref|NP_770775.1| ribonuclease D [Bradyrhizobium japonicum USDA 110]
 gi|27352397|dbj|BAC49400.1| ribonuclease D [Bradyrhizobium japonicum USDA 110]
          Length = 382

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 5/172 (2%)

Query: 9   GDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
            D+ A C+  A++   I VDTE L        LC+VQ++  +  + I  +A G    P  
Sbjct: 8   ADLAAACSRLAKH-PVITVDTEFLRETTYYPLLCVVQMASPEEAIVIDTLAVGIDLKP-F 65

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             ++ +E   K+FH  R DI ++++   +   PVF T++A+ +   Y +       ++++
Sbjct: 66  FELMGNEAVLKVFHAARQDIEIIWHQANIIPHPVFDTQVAA-MVLGYGDSIAYDQLVEKV 124

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            G    K  + +DWS   L+ EQ+ YA SDV HL  +       L++  RS+
Sbjct: 125 TGHRPDKTHRFTDWSRRPLTKEQMHYAVSDVTHLRDVFAALDADLKKRRRSE 176


>gi|218779802|ref|YP_002431120.1| 3'-5' exonuclease [Desulfatibacillum alkenivorans AK-01]
 gi|218761186|gb|ACL03652.1| 3'-5' exonuclease [Desulfatibacillum alkenivorans AK-01]
          Length = 388

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 77/151 (50%), Gaps = 8/151 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVD E   +   +++ C++Q++     ++ I       +   L  +L +++ +KIFH  
Sbjct: 37  IAVDLEADSMFHYQEKACLLQIT--SNGLNYIVDPLCDCDVKALAPILENDEIQKIFHGA 94

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +D+  LF  FG+ +  +F T++A+R       Q GL   L+   G+ + K  Q  +WS 
Sbjct: 95  DYDVRCLFRDFGIELHNLFDTQVAARFLGE--PQTGLAPLLESRFGVQLEKKYQKKNWSL 152

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQR 173
             L  E + YAA+D VHL    L+  E L++
Sbjct: 153 RPLPPEMMAYAANDTVHL----LELAEILKK 179


>gi|329114834|ref|ZP_08243590.1| Ribonuclease D [Acetobacter pomorum DM001]
 gi|326695731|gb|EGE47416.1| Ribonuclease D [Acetobacter pomorum DM001]
          Length = 406

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 2/169 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC+VQ+      V I  +A G    P L  +  D    K+FH  
Sbjct: 38  VTVDTEFMREQTYWPELCLVQIGATHDIVLIDALAEGIDLTP-LKNLFADTAVLKVFHAA 96

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +  + F     P+F T++A+ +   + +Q G    +  L G  I K+ + +DWS 
Sbjct: 97  RQDLEIFLHLFDALPTPLFDTQVAA-MVAGFGDQVGYDSLVGSLTGHMIDKSHRFTDWSV 155

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             LS  QL YAA DV  L  +  +  +KL++  R D   +    L D A
Sbjct: 156 RPLSPAQLTYAAGDVTWLRLVYERLVKKLEQEQRLDWVAAEMAELEDPA 204


>gi|254562078|ref|YP_003069173.1| ribonuclease D [Methylobacterium extorquens DM4]
 gi|254269356|emb|CAX25322.1| Ribonuclease D (RNase D) [Methylobacterium extorquens DM4]
          Length = 384

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 1/138 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+  +P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLLGGLLPQPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKARIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHL 160
             LS+ QL YA SDV HL
Sbjct: 142 RPLSEAQLAYALSDVTHL 159


>gi|320159696|ref|YP_004172920.1| putative ribonuclease D [Anaerolinea thermophila UNI-1]
 gi|319993549|dbj|BAJ62320.1| putative ribonuclease D [Anaerolinea thermophila UNI-1]
          Length = 380

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 80/162 (49%), Gaps = 8/162 (4%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLS-PG-DGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           + IAVDTE+ GL   ++++C++Q S PG D  VD +       N   L  +  +   EK+
Sbjct: 29  EQIAVDTESNGLHAYQEQICLIQFSVPGADYLVDPL----ASVNLSGLNEIFSNPGIEKV 84

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH   +DI  L   FG     +F T IA+R+     ++ GL   L+E  G+ + K  Q +
Sbjct: 85  FHAAEYDILCLKRDFGFTFTHLFDTMIAARILGR--SEVGLAALLEEHFGVTLDKRYQRA 142

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +W+   L    L YA  D  +L  LR    ++L   G + LA
Sbjct: 143 NWARRPLPPAMLNYARLDTHYLIDLRNHLAKELAERGLTALA 184


>gi|221194797|ref|ZP_03567854.1| ribonuclease D [Atopobium rimae ATCC 49626]
 gi|221185701|gb|EEE18091.1| ribonuclease D [Atopobium rimae ATCC 49626]
          Length = 376

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 77/162 (47%), Gaps = 7/162 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           A +V  +AVDTE L       +LC+VQ+S G+    +D + I     +   LV +  D+K
Sbjct: 16  AAHVPVLAVDTEFLREKTYYPKLCLVQVSTGEEIAAIDPLSI----DDLSPLVRLFEDQK 71

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+ H    D+ VL Y       PVF T++A+        Q      ++  +G+++ K 
Sbjct: 72  IVKVIHACSQDLEVLLYGMHCACAPVFDTQLAAAFL-GMRQQASYASVVEHYMGVHLPKT 130

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           +  +DWS   L  EQL YA  DV +L  +     E+L +  R
Sbjct: 131 ESLTDWSRRPLDPEQLVYAEDDVRYLPDIYRCMYERLMKTNR 172


>gi|163852332|ref|YP_001640375.1| ribonuclease D [Methylobacterium extorquens PA1]
 gi|163663937|gb|ABY31304.1| ribonuclease D [Methylobacterium extorquens PA1]
          Length = 384

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 1/138 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+  +P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLLGGLLPQPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKARIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHL 160
             LS+ QL YA SDV HL
Sbjct: 142 RPLSEAQLAYALSDVTHL 159


>gi|262276193|ref|ZP_06054002.1| ribonuclease D [Grimontia hollisae CIP 101886]
 gi|262220001|gb|EEY71317.1| ribonuclease D [Grimontia hollisae CIP 101886]
          Length = 405

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 86/178 (48%), Gaps = 11/178 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+ +DTE +       RL ++QL  G+ T+ +I        +P L G+L DE   
Sbjct: 50  ARQVPAVMLDTEFVRTRTLYPRLGLIQLYDGE-TLSLIDPIELDDLSP-LWGLLTDESVV 107

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGINIS 132
           K+ H    D+ V ++  G    P+  T+I +         HGL       ++E L + + 
Sbjct: 108 KVLHACSEDLEVFYHYAGAMPTPMVDTQIMAAFL-----GHGLSTGFASLVEEYLVVTLD 162

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           K +  +DW A  LS++QL+YAA+DV +L  L  + ++++   G  +     C  +  +
Sbjct: 163 KGEARTDWCARPLSEKQLEYAAADVYYLLPLYNELSKRVSAAGWDEAVKQECALMASK 220


>gi|240139668|ref|YP_002964145.1| Ribonuclease D (RNase D) [Methylobacterium extorquens AM1]
 gi|240009642|gb|ACS40868.1| Ribonuclease D (RNase D) [Methylobacterium extorquens AM1]
          Length = 384

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 1/138 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+  +P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLLGGLLPQPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKARIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHL 160
             LS+ QL YA SDV HL
Sbjct: 142 RPLSEAQLAYALSDVTHL 159


>gi|218531091|ref|YP_002421907.1| ribonuclease D [Methylobacterium chloromethanicum CM4]
 gi|218523394|gb|ACK83979.1| ribonuclease D [Methylobacterium chloromethanicum CM4]
          Length = 384

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 1/138 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+  +P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLLGGLLPQPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKARIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHL 160
             LS+ QL YA SDV HL
Sbjct: 142 RPLSEAQLAYALSDVTHL 159


>gi|260433597|ref|ZP_05787568.1| ribonuclease D [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417425|gb|EEX10684.1| ribonuclease D [Silicibacter lacuscaerulensis ITI-1157]
          Length = 424

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 81/159 (50%), Gaps = 6/159 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           + VDTE L       +LC++Q++ P    D  V +  +A G    P L  +  +E   K+
Sbjct: 62  VTVDTEFLRERTYYSKLCLIQMAVPSEDEDSAVLVDPLADGLSLDP-LYELFQNEDVVKV 120

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ + +   G+  +P+F T++A+ +   +  Q G +  ++++    + K  + +
Sbjct: 121 FHAARQDLEIFWVEAGIFPKPLFDTQVAA-MVCGFGEQVGYETLVRKICKQGLDKTSRFT 179

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           DWS   LSD Q  YA +DV HL  +      +L++ GRS
Sbjct: 180 DWSRRPLSDAQKTYALADVTHLRQIYEYLAAELEKTGRS 218


>gi|328543996|ref|YP_004304105.1| ribonuclease d protein [polymorphum gilvum SL003B-26A1]
 gi|326413740|gb|ADZ70803.1| Probable ribonuclease d protein [Polymorphum gilvum SL003B-26A1]
          Length = 394

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 77/141 (54%), Gaps = 2/141 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE L       +LC++Q++  D  V +  +A G   AP L  ++ +E+  K+FH
Sbjct: 21  DYVTVDTEFLRETTFWPKLCVIQMAGPDDAVIVDALADGLDLAPFL-DLMRNERVTKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++++  G+   P+F T++A+ +   + +       ++ + G  I K+ + +DW
Sbjct: 80  AARQDIEIVYHLGGLIPHPLFDTQVAAMVC-GFGDSISYDQLVQRITGARIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLH 161
           +   L+ +QL YA +DV +L 
Sbjct: 139 ARRPLTQKQLDYALADVTYLR 159


>gi|260426693|ref|ZP_05780672.1| ribonuclease D [Citreicella sp. SE45]
 gi|260421185|gb|EEX14436.1| ribonuclease D [Citreicella sp. SE45]
          Length = 385

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 81/159 (50%), Gaps = 6/159 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDG---TVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           + VDTE L       +LC++QL+ PG G    V +  +  G    P L+ +  +    K+
Sbjct: 23  VTVDTEFLRERTYYSKLCLIQLAFPGKGDENAVLVDPLVDGLDLEP-LLELFRNTAVVKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ + F   GV   P+F T++A+ +   +  Q G +  +K +    + K+ + +
Sbjct: 82  FHAARQDLEIFFIDHGVIPDPLFDTQVAAMVC-GFGEQVGYETLVKRIAKQALDKSSRFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           DWS   L++ Q +YA +DV HL  +      +L+R GR+
Sbjct: 141 DWSRRPLTEAQKKYALADVTHLRVIYEYLAAELERTGRA 179


>gi|310767817|gb|ADP12767.1| ribonuclease D [Erwinia sp. Ejp617]
          Length = 369

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 87/174 (50%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+ T+ +I         P    +L+D++  
Sbjct: 15  ARRVPALALDTEFVRTRTYYPRLGLIQLYDGE-TISLIDPLPITDWTP-FRDLLLDQQVI 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +  +    +  G    ++   GI + K++ 
Sbjct: 73  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAFSGRPLS-CGFATIVESFTGIALDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +  ++ +  G+   A   C  L  R
Sbjct: 132 RTDWLARPLSEKQCRYAAADVFYLLPIASKLVDETEAAGQMAAALDECRLLCQR 185


>gi|45659084|ref|YP_003170.1| ribonuclease D [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|294828464|ref|NP_714272.2| ribonuclease D [Leptospira interrogans serovar Lai str. 56601]
 gi|45602330|gb|AAS71807.1| ribonuclease D [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|293386317|gb|AAN51290.2| ribonuclease D [Leptospira interrogans serovar Lai str. 56601]
          Length = 388

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 75/151 (49%), Gaps = 4/151 (2%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D+I+VDTE+ G      ++C++Q+S   G   II     Q N  +L  +  D+K  KIFH
Sbjct: 27  DSISVDTESSGYYTYFSKVCLIQIS-AKGKNYIIDPLKLQ-NLESLGNLFEDKKILKIFH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI  L   FG + + +  T  +SRL      Q+ L   +     I +SK +Q S+W
Sbjct: 85  SAIDDIKALKKDFGFQFQNIADTGFSSRLLDH--EQYSLTYLVDYYHKIKLSKKEQKSNW 142

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
               L   QLQYAA D V+L  +  +  E+L
Sbjct: 143 EKRPLEKSQLQYAALDTVYLETIWEKMKEEL 173


>gi|295689658|ref|YP_003593351.1| ribonuclease D [Caulobacter segnis ATCC 21756]
 gi|295431561|gb|ADG10733.1| ribonuclease D [Caulobacter segnis ATCC 21756]
          Length = 389

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 86/174 (49%), Gaps = 5/174 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQL-SPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           +AVDTE +       +LC++Q+ SP    V  I   A   +   L+ ++ DE+  K+FH 
Sbjct: 23  VAVDTEFMRETTYWPKLCLIQVASPTHEAV--IDPLADDIDLEPLLAVMRDERILKVFHA 80

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            R D+ + F       +P+F T++A  +   +  Q      ++++L I + K+ + +DW+
Sbjct: 81  ARQDVEI-FNNLKAMPKPLFDTQVAG-MAAGFGEQIAYDALVRQMLRIELDKSSRFTDWA 138

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
              L++ QL YA +DV HL AL     E+L+  GR          + D A  D+
Sbjct: 139 RRPLTEAQLTYALADVTHLAALFPILRERLETSGRLAWVEEEMTAISDPAAYDV 192


>gi|259908266|ref|YP_002648622.1| ribonuclease D [Erwinia pyrifoliae Ep1/96]
 gi|224963888|emb|CAX55391.1| Ribonuclease D [Erwinia pyrifoliae Ep1/96]
 gi|283478197|emb|CAY74113.1| rnd [Erwinia pyrifoliae DSM 12163]
          Length = 369

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 87/174 (50%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+ T+ +I         P    +L+D++  
Sbjct: 15  ARRVPALALDTEFVRTRTYYPRLGLIQLYDGE-TISLIDPLPITDWTP-FRDLLLDQQVI 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +  +    +  G    ++   GI + K++ 
Sbjct: 73  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAFSGRPLS-CGFATIVESFTGIALDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +  ++ +  G+   A   C  L  R
Sbjct: 132 RTDWLARPLSEKQCRYAAADVFYLLPIASKLVDETEAAGQMAAALDECRLLCQR 185


>gi|293392299|ref|ZP_06636633.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952833|gb|EFE02952.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 385

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 82/175 (46%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AAR   A+A+DTE + +     +L ++Q+  GD  V +I     Q  +P  + +L D   
Sbjct: 29  AARQQSAVALDTEFVRVRTLYPKLGLIQMYFGD-QVALIDPLPIQDFSP-FIELLADTNL 86

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T++ +     +    G    ++    I I K  
Sbjct: 87  VKILHACSEDLDVFQRYFQQLPRPMCDTQVMAHFL-GFAGSTGFATLVQHYFQIEIDKGA 145

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  LSD QLQYAA+DV +L  L  Q  ++L +        + C FL+++
Sbjct: 146 SRTDWLARPLSDTQLQYAAADVWYLLPLYGQMQQQLTQTEWQSAVENECEFLLNK 200


>gi|291335358|gb|ADD94973.1| DNA polymerase I putative [uncultured phage MedDCM-OCT-S04-C148]
          Length = 640

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 76/152 (50%), Gaps = 17/152 (11%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGT----VDIIRIAAGQKNAPNLVGMLVDEKREK 77
           ++  DTETL L P R +L ++QL   D      +D  ++  G  +  +L        R  
Sbjct: 20  SLCFDTETLQLQPERGKLRLLQLGARDRDTIVLIDCFQLDKG--DWADLRWFFSTPDRFW 77

Query: 78  IFHYGRFDIAVL----FYTFGVRVRPVFCTKIASRL-TRTYTN-QHGLKDNLKELLGINI 131
           + H   FD+  L     Y  G     V C+ +ASRL T    N +HGL   +K  L   +
Sbjct: 78  LAHNAVFDLGWLQEHNIYPAGW----VRCSMLASRLLTNGLPNSKHGLDSVVKRYLKKEL 133

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
           SK QQ SDWS  DLS+EQL+YAA+DV  L  L
Sbjct: 134 SKEQQRSDWSG-DLSEEQLEYAANDVAALMEL 164


>gi|254461790|ref|ZP_05075206.1| ribonuclease D [Rhodobacterales bacterium HTCC2083]
 gi|206678379|gb|EDZ42866.1| ribonuclease D [Rhodobacteraceae bacterium HTCC2083]
          Length = 385

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (49%), Gaps = 6/159 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVD---IIRIAAGQKNAPNLVGMLVDEKREKI 78
           + VDTE L       +LC+VQL+ PG    +   +  +  G    P L  +  D    K+
Sbjct: 23  VTVDTEFLRERTYYSKLCLVQLAMPGTDDSNGCLVDPLVEGISLEP-LYDLFRDTSVVKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R DI +     GV   P+F T++AS +   +  Q G +  ++++    I K+ + +
Sbjct: 82  FHAARQDIEIFQVDAGVIPTPLFDTQVASMVC-GFGEQVGYETLVRKIAKQEIDKSSRFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           DWS   LSD Q +YA +DV HL  +     +KL+  GRS
Sbjct: 141 DWSRRPLSDAQAKYALADVTHLRQVYEFLAKKLKDQGRS 179


>gi|149202482|ref|ZP_01879454.1| ribonuclease D [Roseovarius sp. TM1035]
 gi|149143764|gb|EDM31798.1| ribonuclease D [Roseovarius sp. TM1035]
          Length = 386

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 91/196 (46%), Gaps = 7/196 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDIIR 55
           M TI   + D+ A CA AR    + +DTE L       +LC++Q++ PG   D  V +  
Sbjct: 1   MKTITTTD-DLAAFCAMARKHPYVTLDTEFLRERTYYSKLCLLQMAVPGADDDTAVLVDP 59

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           I   + +   L  +  D    K+FH  R D+ +     GV   P+F T++A+ +   +  
Sbjct: 60  IDGAEMSMEPLYELFRDTSVVKVFHAARQDLEIFHVDAGVIPDPLFDTQVAA-MVCGFGE 118

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  +K +    + K+ + +DWS   L++ Q  YA +DV HL  +     +KL   G
Sbjct: 119 QVGYETLVKRIAKQTVDKSSRFTDWSRRPLTEAQKVYALADVTHLRVIYEYLAKKLASSG 178

Query: 176 RSDLATSCCNFLMDRA 191
           R        + L D A
Sbjct: 179 RDKWVAEELSVLTDPA 194


>gi|256372386|ref|YP_003110210.1| 3'-5' exonuclease [Acidimicrobium ferrooxidans DSM 10331]
 gi|256008970|gb|ACU54537.1| 3'-5' exonuclease [Acidimicrobium ferrooxidans DSM 10331]
          Length = 396

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 64/129 (49%), Gaps = 5/129 (3%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E +FH    D+ ++    G R R +F T++A            L   L   LG++ISKA+
Sbjct: 91  ELVFHAADQDLEIIERAVGARPRRIFDTQVAGGFL--GAGHASLGALLDRYLGVSISKAE 148

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           ++SDW    L   QL YAA+DV +L AL  +  E+L   GR D A S    L++R   D+
Sbjct: 149 RTSDWLRRPLEPGQLAYAANDVRYLAALADRLLEELHARGREDWARSEMARLVERRRRDI 208

Query: 196 ---LGWENV 201
              L W  +
Sbjct: 209 EPELAWTRI 217


>gi|254473302|ref|ZP_05086699.1| ribonuclease D [Pseudovibrio sp. JE062]
 gi|211957418|gb|EEA92621.1| ribonuclease D [Pseudovibrio sp. JE062]
          Length = 405

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 82/157 (52%), Gaps = 2/157 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE L       +LC++Q++  D  V +  +A      P    ++ +    K+FH
Sbjct: 21  DFVTVDTEFLRETTFWPKLCVIQIANPDHAVLVDALAEDLDLEP-FFALMRNTDIVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++++  G    P+F +++A+ +   + +       + ++ G  I K+ + +DW
Sbjct: 80  AARQDIEIIYHLGGFVPSPLFDSQVAAMVC-GFGDSVSYDQLVSKVTGERIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           S   L+++QL YA +DV HL  + L   ++L++ GRS
Sbjct: 139 SRRPLTNKQLAYALADVTHLREVYLFLKKQLEQKGRS 175


>gi|99034557|ref|ZP_01314528.1| hypothetical protein Wendoof_01000660 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 409

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 84/165 (50%), Gaps = 3/165 (1%)

Query: 14  ECAARYVDAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD 72
           E  A+    IAVDTE +   +    +L ++Q+S G+ +  I+     + +   +  ++++
Sbjct: 32  ELIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKSF-IVDTLVPEIDLSFIKKIMLN 90

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           +   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  GI + 
Sbjct: 91  QGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGIALD 150

Query: 133 KAQ-QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           K + ++SDW    LS++QL YA +DVVHL+ L      KL+   R
Sbjct: 151 KIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNR 195


>gi|156086202|ref|XP_001610510.1| DNA polymerase I [Babesia bovis T2Bo]
 gi|154797763|gb|EDO06942.1| DNA polymerase I, putative [Babesia bovis]
          Length = 1613

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 80/154 (51%), Gaps = 7/154 (4%)

Query: 25   VDTETLGLMPRRDRLCIVQLSPGDG---TVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
            +D ET GL  R DR+ ++Q+S  D     +D+ ++          +  L+  +  K+ H 
Sbjct: 1061 LDIETTGLNHREDRIRLLQISTPDQPSVVIDVFKVPVPTLKECTWLVKLLGSQAVKVLHN 1120

Query: 82   GRFDIAVLFYTFGVRVR-PVFCTKIASRL-TRTYTNQHGLKDNLKE-LLGINISKAQQSS 138
            G+FDI  L +  G  V+ P+F T IA++L + T  N      ++ E  L I + K+QQ S
Sbjct: 1121 GKFDINFLSHN-GFNVKGPIFDTMIAAKLLSATRFNWSCKLGHVAERYLNIVLDKSQQFS 1179

Query: 139  DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
            DW+ D L +EQ+ YA+ D   L  L     EKL+
Sbjct: 1180 DWTLDPLFEEQVIYASRDTAVLLPLYFILQEKLK 1213


>gi|188582284|ref|YP_001925729.1| ribonuclease D [Methylobacterium populi BJ001]
 gi|179345782|gb|ACB81194.1| ribonuclease D [Methylobacterium populi BJ001]
          Length = 384

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (50%), Gaps = 1/138 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+FH  
Sbjct: 23  VTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFELMADESTVKVFHSA 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++   G+   P F T++A+ +   Y +    +  + ++    I K+ + +DWS 
Sbjct: 83  RQDLEIIWLLGGLLPHPFFDTQVAA-MVCGYGDSVSYEQLVNDVAKARIDKSSRFTDWSR 141

Query: 143 DDLSDEQLQYAASDVVHL 160
             LS+ QL YA SDV HL
Sbjct: 142 RPLSEAQLAYALSDVTHL 159


>gi|148552971|ref|YP_001260553.1| ribonuclease D [Sphingomonas wittichii RW1]
 gi|148498161|gb|ABQ66415.1| ribonuclease D [Sphingomonas wittichii RW1]
          Length = 395

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 87/187 (46%), Gaps = 4/187 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC++Q++  +    I   A      P L  ++ +E+  K+FH G
Sbjct: 30  VVVDTEFMRESTYWPDLCLIQIANSEEAAAIDPKAKDIDLTPLLDLLVENEEVLKVFHAG 89

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ ++    G    P+F T++A+ +      Q G  + ++ +LGI + K  + +DW+ 
Sbjct: 90  GQDLEIVHNLTGKTPYPLFDTQVAA-MAMGLGEQIGYSNLVETMLGIKLDKGARFTDWAR 148

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE---LDLLGWE 199
             L   Q+ YA  DV HL A+  +  E+L++ GR     +    L D A    L  L W 
Sbjct: 149 RPLDKRQIDYAIGDVTHLSAIFPRMLERLRKSGRGGWLDNEMERLGDPASYANLPELAWT 208

Query: 200 NVDIFSH 206
            + + S 
Sbjct: 209 RIRLPSR 215


>gi|150396023|ref|YP_001326490.1| ribonuclease D [Sinorhizobium medicae WSM419]
 gi|150027538|gb|ABR59655.1| ribonuclease D [Sinorhizobium medicae WSM419]
          Length = 383

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 83/173 (47%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE L        LC++Q++  D  V +  +A G   A +   ++ +    K+FH  
Sbjct: 21  ITIDTEFLRETTFWPELCLIQMASPDMAVIVDPMAPGIDLA-SFFALMGNADVVKVFHAA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI ++ +   +   P+F T++A+ +   + +       +  +    I K+ + +DWS 
Sbjct: 80  RQDIEIIHHLGNLIPHPLFDTQVAAMVC-GFGDSVSYDQLVSRIKNEQIDKSSRFTDWSR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             L+D+QL YA +DV HL  +     ++L+R GRS         L +R   DL
Sbjct: 139 RPLTDKQLDYALADVTHLRDIYHYLVQELEREGRSSWLAEEMAILENRETYDL 191


>gi|42520085|ref|NP_966000.1| ribonuclease D, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409822|gb|AAS13934.1| ribonuclease D, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 392

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 84/165 (50%), Gaps = 3/165 (1%)

Query: 14  ECAARYVDAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD 72
           E  A+    IAVDTE +   +    +L ++Q+S G+ +  I+     + +   +  ++++
Sbjct: 15  ELIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKSF-IVDALVPEIDLSFIKKIMLN 73

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           +   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  GI + 
Sbjct: 74  QGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGIALD 133

Query: 133 KAQ-QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           K + ++SDW    LS++QL YA +DVVHL+ L      KL+   R
Sbjct: 134 KIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNR 178


>gi|182678372|ref|YP_001832518.1| ribonuclease D [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634255|gb|ACB95029.1| ribonuclease D [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 388

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 81/154 (52%), Gaps = 2/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L       +LC+VQL+  +  V +  +A G   +P L  ++ +E   K+FH  
Sbjct: 23  VTVDTEFLRETTFWPKLCVVQLASTEEAVAVDALAEGLDLSP-LFELMANEATVKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++    +   P+F T++A+ +   + +Q    D ++ +  +++ K+ + +DWS 
Sbjct: 82  RQDLEIIWNLAKLIPTPLFDTQVAAMVC-GFGDQISYGDLVQTVTRVSLDKSSRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS  Q+ YA +DV +L  + L    KL+   R
Sbjct: 141 RPLSPAQVDYAIADVTYLRDIYLYLRRKLETSSR 174


>gi|116329422|ref|YP_799142.1| ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116329974|ref|YP_799692.1| ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116122166|gb|ABJ80209.1| Ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116123663|gb|ABJ74934.1| Ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 388

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 4/153 (2%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D+I++DTE+ G      ++C++Q+S   G   II     Q N   L  +  D+K  KIFH
Sbjct: 27  DSISIDTESSGYYTYFSKVCLIQIS-AKGKNYIIDPLKLQ-NLDGLGNLFEDKKILKIFH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI  L   FG +   +  T  +SRL      Q+ L   +     I +SK +Q S+W
Sbjct: 85  SAIDDIKALKKDFGFKFHNIADTGFSSRLLDH--EQYSLTYLVDYYHKIKLSKKEQKSNW 142

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQR 173
               L   QLQYAA D V+L  +  +  E+L +
Sbjct: 143 EKRPLEKSQLQYAALDTVYLETIWEKMKEELTK 175


>gi|58697529|ref|ZP_00372780.1| ribonuclease D [Wolbachia endosymbiont of Drosophila simulans]
 gi|58535998|gb|EAL59702.1| ribonuclease D [Wolbachia endosymbiont of Drosophila simulans]
          Length = 284

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 85/169 (50%), Gaps = 3/169 (1%)

Query: 10  DIPAECAARYVDAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           DI     A+    IAVDTE +   +    +L ++Q+S G+ +  I+     + +   +  
Sbjct: 11  DICEGLIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKSF-IVDALVPEIDLSFIKK 69

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +++++   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  G
Sbjct: 70  IMLNQGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQG 129

Query: 129 INISKAQ-QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           I + K + ++SDW    LS++QL YA +DVVHL+ L      KL+   R
Sbjct: 130 IALDKIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNR 178


>gi|312113633|ref|YP_004011229.1| ribonuclease D [Rhodomicrobium vannielii ATCC 17100]
 gi|311218762|gb|ADP70130.1| ribonuclease D [Rhodomicrobium vannielii ATCC 17100]
          Length = 404

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 83/174 (47%), Gaps = 17/174 (9%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PG-DGTVDIIRIAAGQKNAPNL-----VGMLVDEKR 75
           + VDTE +     R +LC++Q++ PG +  VD +         PNL       ++ +   
Sbjct: 48  VTVDTEFMRQTTYRPKLCLIQMAAPGIEAVVDPL---------PNLDLSPFYALMANTAV 98

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI +++   GV   P+F T+IA+ +   + +       +K+LL  N  K  
Sbjct: 99  VKVFHAARQDIEIVWQEAGVIPMPLFDTQIAA-MALGHGDAISYGALVKKLLKKNHDKTY 157

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           Q+ DW    L  +QL+YA  DV +L  +  +  ++L++ GR          L D
Sbjct: 158 QAIDWCQRPLGPKQLEYALGDVTYLRDVYAKLKQRLEQTGREPWLEEEVAVLTD 211


>gi|84517066|ref|ZP_01004422.1| ribonuclease D [Loktanella vestfoldensis SKA53]
 gi|84508961|gb|EAQ05422.1| ribonuclease D [Loktanella vestfoldensis SKA53]
          Length = 385

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 82/173 (47%), Gaps = 6/173 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS----PGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           + VDTE L       +LC+VQ++     G+  V +  +A G    P L  +  D    K+
Sbjct: 23  VTVDTEFLRERTYYSKLCLVQMAYRDAAGEDAVLVDPLAEGISLDP-LYDLFRDPGVVKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ +     GV   P+F T++A+ +   +  Q G +  ++++    + K+ + +
Sbjct: 82  FHAARQDLEIFHVDAGVIPAPLFDTQVAAMVC-GFGEQAGYETLVRKIAKAEVDKSSRFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           DWS   L+D Q +YA +DV HL  +      +L + GR+         L D A
Sbjct: 141 DWSRRPLTDAQAEYALADVTHLRDVYEYLANRLAKSGRTKWVAEEMAVLNDPA 193


>gi|225156183|ref|ZP_03724663.1| 3'-5' exonuclease [Opitutaceae bacterium TAV2]
 gi|224803073|gb|EEG21316.1| 3'-5' exonuclease [Opitutaceae bacterium TAV2]
          Length = 389

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 81/173 (46%), Gaps = 6/173 (3%)

Query: 12  PAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
           P   A   V  +A+DTE   +   + R+C++Q    DG V ++ +       P    +  
Sbjct: 40  PFLAALDRVKEVALDTEADNMYHYQTRVCLLQFL-IDGEVWLVDLMTPLPLKPLWEKLAT 98

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
              +  + H   FD+ +L    G R + +F T +A++L      + GL   L E  G+ +
Sbjct: 99  ---KHLVMHGSDFDLRLLHDLCGFRPKSLFDTMLAAQLLNR--QRIGLAALLSEHFGVTL 153

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            K  Q ++WS   L+ + L YA+ DV HL ALR   T +L RLGR +     C
Sbjct: 154 DKGGQKANWSKRPLTPKLLDYASLDVWHLPALRDILTRELSRLGRMEWMEQQC 206


>gi|58698273|ref|ZP_00373191.1| ribonuclease D [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630014|ref|YP_002726805.1| Ribonuclease D [Wolbachia sp. wRi]
 gi|225677056|ref|ZP_03788062.1| Ribonuclease D [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|58535197|gb|EAL59278.1| ribonuclease D [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225590902|gb|EEH12123.1| Ribonuclease D [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225591995|gb|ACN95014.1| Ribonuclease D [Wolbachia sp. wRi]
          Length = 392

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 85/169 (50%), Gaps = 3/169 (1%)

Query: 10  DIPAECAARYVDAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           DI     A+    IAVDTE +   +    +L ++Q+S G+ +  I+     + +   +  
Sbjct: 11  DICEGLIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKSF-IVDALVPEIDLSFIKK 69

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +++++   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  G
Sbjct: 70  IMLNQGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQG 129

Query: 129 INISKAQ-QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           I + K + ++SDW    LS++QL YA +DVVHL+ L      KL+   R
Sbjct: 130 IALDKIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNR 178


>gi|88658362|ref|YP_507121.1| putative ribonuclease D [Ehrlichia chaffeensis str. Arkansas]
 gi|88599819|gb|ABD45288.1| putative ribonuclease D [Ehrlichia chaffeensis str. Arkansas]
          Length = 387

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 3/143 (2%)

Query: 23  IAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           IAVDTE +        +LC++Q++ G     +I + A   +   L  +  +E   K+FH 
Sbjct: 24  IAVDTEFVRSSSEYYPKLCLIQIAYGKEQF-VIDVLAKDMDLSVLGHIFYNESIIKVFHD 82

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK-AQQSSDW 140
            R DI  L   F     P+F T+IA+     Y N  G    +++ LGI++ K + + S+W
Sbjct: 83  CRQDIDALLTKFPEIPSPIFDTQIAAMFCCCYDNAVGYSKLVEQFLGISLDKLSLKRSNW 142

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
           +   LS +++QYA +DV++L+ L
Sbjct: 143 ALRPLSADKIQYALNDVIYLYEL 165


>gi|261253420|ref|ZP_05945993.1| ribonuclease D [Vibrio orientalis CIP 102891]
 gi|260936811|gb|EEX92800.1| ribonuclease D [Vibrio orientalis CIP 102891]
          Length = 371

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 85/180 (47%), Gaps = 22/180 (12%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           +AR VD + +DTE +       +L ++QL  G+    +D   I    ++    V +L D 
Sbjct: 18  SARNVDVVMLDTEFVRTRTYYPQLGLIQLFDGEKLSLIDPTVI----EDMTAFVELLKDT 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL----LGI 129
              K+ H    D+ V   +FG    P+  T++ +         HGL      L    LG+
Sbjct: 74  SVLKVLHACGEDLEVFHNSFGCLPYPMVDTQLMAAFL-----GHGLSTGFAALVENYLGV 128

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG-------RSDLATS 182
            + K++  +DW A  LSD+QL+YAA+DV +L  L  Q  EK+ + G        SDLA S
Sbjct: 129 ELDKSESRTDWLARPLSDKQLEYAAADVYYLQPLYEQLFEKITQAGWWEAAQQESDLAAS 188


>gi|50121299|ref|YP_050466.1| ribonuclease D [Pectobacterium atrosepticum SCRI1043]
 gi|49611825|emb|CAG75274.1| ribonuclease D [Pectobacterium atrosepticum SCRI1043]
          Length = 374

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 85/177 (48%), Gaps = 5/177 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +L ++QL  G+  + +I        AP    +L DE+  
Sbjct: 19  ARRFPQVALDTEFVRTRTYYPQLGLIQLYDGE-QLSLIDPLTITDWAP-FQALLRDEEVT 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           K  H G  D+ V   TFG    P   T+I A+ L +  +  +G    + + +G+++ K++
Sbjct: 77  KFLHAGSEDLEVFLNTFGTLPTPFIDTQILAAFLGKPLS--YGFAALVADYMGVSLDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
             +DW A  LS++Q  YAA+DV +L  + +Q     +  G  + A   C  L  R +
Sbjct: 135 SRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVADTETAGWMNAALDECLLLCQRKQ 191


>gi|68171541|ref|ZP_00544920.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999046|gb|EAM85718.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
          Length = 387

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 3/143 (2%)

Query: 23  IAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           IAVDTE +        +LC++Q++ G     +I + A   +   L  +  +E   K+FH 
Sbjct: 24  IAVDTEFVRSSSEYYPKLCLIQIAYGKEQF-VIDVLAKDMDLSVLGHIFYNESIIKVFHD 82

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK-AQQSSDW 140
            R DI  L   F     P+F T+IA+     Y N  G    +++ LGI++ K + + S+W
Sbjct: 83  CRQDIDALLTKFPEIPSPIFDTQIAAMFCCCYDNAVGYSKLVEQFLGISLDKLSLKRSNW 142

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
           +   LS +++QYA +DV++L+ L
Sbjct: 143 ALRPLSADKIQYALNDVIYLYEL 165


>gi|254294269|ref|YP_003060292.1| ribonuclease D [Hirschia baltica ATCC 49814]
 gi|254042800|gb|ACT59595.1| ribonuclease D [Hirschia baltica ATCC 49814]
          Length = 390

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 77/154 (50%), Gaps = 2/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTE         +LC++Q +  +    I  ++     AP  + ++ D  R K+FH  
Sbjct: 31  IAVDTEFHRESTFWPKLCLIQAATLEFDCLIDPLSPNIDLAP-FLDLMADTSRVKVFHAA 89

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +     G    P+F +++A+ +     +    ++ + +LL   + K+ Q +DW  
Sbjct: 90  RQDMEIFTKLIGTPPAPIFDSQVAA-MACGLGDSVSYENLVSQLLKARVDKSSQFTDWQR 148

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             L+++QL YA  DV HL    ++   KL++LGR
Sbjct: 149 RPLTEKQLDYARGDVTHLRHCYVKLKAKLEKLGR 182


>gi|153005072|ref|YP_001379397.1| 3'-5' exonuclease [Anaeromyxobacter sp. Fw109-5]
 gi|152028645|gb|ABS26413.1| 3'-5' exonuclease [Anaeromyxobacter sp. Fw109-5]
          Length = 296

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 10/160 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS--PGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+DTE+      R+R+C++Q+S    D  VD + +       P+ +G ++ + RE + H
Sbjct: 32  VALDTESNSFHVYRERICLLQVSTRAADYIVDPLAVD------PSPLGEVLCDGRETVLH 85

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+  L   +G  +  +F T  A+R  R      GL   ++   G+ +SK  Q SDW
Sbjct: 86  GADYDVRCLRREYGWHLPRLFDTMAAAR--RLGRQGLGLSALVEAHFGVRLSKTFQRSDW 143

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
               L+  QL YAA D  +L ALR     +L  LG S+ A
Sbjct: 144 GQRPLTAAQLAYAALDTHYLLALRDMLAGELDTLGASEQA 183


>gi|222053523|ref|YP_002535885.1| 3'-5' exonuclease [Geobacter sp. FRC-32]
 gi|221562812|gb|ACM18784.1| 3'-5' exonuclease [Geobacter sp. FRC-32]
          Length = 390

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 75/154 (48%), Gaps = 4/154 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A D E   L    +++C++Q+S    T  I  +A    +   L  +L D    K+FH  
Sbjct: 42  LAFDLEADSLHHYTEKVCLIQVSNLSQTALIDPLAPV--DLSPLAPVLADRGIRKVFHGA 99

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +D+  L+  FG+ V  +F T IA +       + GL   LK+  G+ ++K  Q +DWS 
Sbjct: 100 DYDMRSLYRDFGLEVCNMFDTMIACQFL--GEKEVGLAAALKKRFGVELNKKYQKADWSK 157

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
              S E ++YA  D   L  L LQ  E+L+  GR
Sbjct: 158 RPFSAEMIEYAKMDTALLIRLYLQLEEELRAKGR 191


>gi|119384625|ref|YP_915681.1| ribonuclease D [Paracoccus denitrificans PD1222]
 gi|119374392|gb|ABL69985.1| ribonuclease D [Paracoccus denitrificans PD1222]
          Length = 401

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 80/164 (48%), Gaps = 11/164 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQ--LSPGDGT-------VDIIRIAAGQKNAPNLVGMLVDE 73
           + +DTE L       +LC++Q  L P   T       V I  +  G    P L  +   +
Sbjct: 35  VTLDTEFLRERTYYSKLCLIQAALPPASATKAAGGLSVLIDPLVEGLSLEP-LYDLFRHK 93

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + F+  GV   P+F T+IA+ +   +  Q G +  +K++    + K
Sbjct: 94  PTVKVFHAARQDLEIFFHDAGVMPDPLFDTQIAAMVC-GFGEQVGYETLVKKIARQPLDK 152

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           + + +DWS   LSD Q  YA +DV HL A+    + +L + GR+
Sbjct: 153 SSRFTDWSHRPLSDAQAAYALADVTHLRAIYEFLSAQLDKTGRA 196


>gi|300717019|ref|YP_003741822.1| ribonuclease D [Erwinia billingiae Eb661]
 gi|299062855|emb|CAX59975.1| Ribonuclease D [Erwinia billingiae Eb661]
          Length = 373

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 88/177 (49%), Gaps = 3/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE +        L ++Q+  G+  + +I      + AP    +L+DEK  
Sbjct: 19  ARQFPALALDTEFVRTRTYYPGLGLIQMYDGE-NIALIDPLPITEWAP-FRDLLLDEKVI 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + + V   P+  T+I +  T    +  G    ++   GI + K++ 
Sbjct: 77  KFLHAGSEDLEVFLHEYDVLPVPMIDTQILAAFTGRPLS-CGFATIVESFTGIALDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DW A  L+++Q QYAA+DV +L  +  +   + +  GR + A + C+ L  R ++
Sbjct: 136 RTDWLARPLTEKQCQYAAADVFYLLPIAHKLLAEAEESGRINAALNECSLLCQRRQM 192


>gi|56551610|ref|YP_162449.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761264|ref|ZP_04759352.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752797|ref|YP_003225690.1| ribonuclease D [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56543184|gb|AAV89338.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374171|gb|EER63668.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552160|gb|ACV75106.1| ribonuclease D [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 390

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 3/159 (1%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV-DEKREKI 78
            D IA+DTE +        LC++Q++       I  +A G    P L  +LV +E   K+
Sbjct: 23  ADFIAIDTEFIRENSYWPELCLIQIADDKEAAAIDPLAPGLDMTP-LTDLLVNNEDILKV 81

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH G  D+ ++ +  G    P+F T+IA+ +      Q G  + ++  L I + K  + +
Sbjct: 82  FHAGGQDLEIILHHTGKMPFPLFDTQIAA-MALGVGEQVGYSNLVERYLSIKLDKGARFT 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           DWS   L   QL YA +DV HL  L     ++L+  GR 
Sbjct: 141 DWSHRPLDRRQLDYAIADVTHLATLFPMLLKELRDKGRG 179


>gi|85373619|ref|YP_457681.1| ribonuclease D [Erythrobacter litoralis HTCC2594]
 gi|84786702|gb|ABC62884.1| ribonuclease D [Erythrobacter litoralis HTCC2594]
          Length = 401

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 1/169 (0%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTE +        LC++Q+   +    +  +A G    P L  M  +E   K+FH G
Sbjct: 26  VCIDTEFMRENTYWPELCLIQIGNEEEAAAVDPLADGIDLQPLLDLMCENEDILKVFHAG 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ +++   G    P+F T+IA  +  + + Q G  + ++  L   I K  + +DWS 
Sbjct: 86  GQDVEIVYNLTGKTPFPIFDTQIAM-MAISQSEQIGYANLVESWLNKTIDKGARFTDWSR 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             L+D Q++YA  DV +L  +  +   KL + GR     +  + L D A
Sbjct: 145 RPLTDRQIEYAIGDVTYLAKIFPKILNKLVKTGRGAWLNAEMDKLADPA 193


>gi|308234516|ref|ZP_07665253.1| ribonuclease D [Atopobium vaginae DSM 15829]
 gi|328944110|ref|ZP_08241575.1| ribonuclease D [Atopobium vaginae DSM 15829]
 gi|327492079|gb|EGF23853.1| ribonuclease D [Atopobium vaginae DSM 15829]
          Length = 376

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 3/140 (2%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D +A+DTE +       +LC++QL+     V +  ++    +  +L  + +D+K  KIFH
Sbjct: 20  DVLAIDTEFMREKTFYPKLCLIQLATRSEIVLVDPLSIP--DLTDLCKLFLDKKITKIFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+ +++  F    +PVF T++A+     +  Q G    +  L  +++ KA+  +DW
Sbjct: 78  ACSQDLELIYDIFSCLPKPVFDTQVAAAFL-GHRFQIGYGPLVDALCHVHLPKAESLTDW 136

Query: 141 SADDLSDEQLQYAASDVVHL 160
           +   L++EQL+YAA DV +L
Sbjct: 137 TRRPLAEEQLEYAADDVRYL 156


>gi|57340046|gb|AAW50010.1| hypothetical protein FTT0776 [synthetic construct]
          Length = 399

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 48  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 103

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 104 SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 162

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 163 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 197


>gi|320163487|gb|EFW40386.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 467

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 83/175 (47%), Gaps = 14/175 (8%)

Query: 8   EGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPN 65
           E  +P   AA   + I +DTE L       +LC++QLS     G VD + I+      P 
Sbjct: 149 EAFLPILAAA---ETIGLDTEFLSFPRYTPQLCVLQLSTETDLGIVDALSIS------PE 199

Query: 66  LVGMLVDEKREK--IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           ++  L     EK  I H    D A+L+   G     VF T+IA+          G    +
Sbjct: 200 MLKKLCLRICEKPVIVHSCSSDCAILYDIAGTLPAKVFDTQIAAAFCYPIM-MMGYGQLV 258

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           + L  + + K+   +DWS   L  +++ YA SDVVHLHA+R +   ++  LGR++
Sbjct: 259 ETLFEVQVDKSLTLTDWSLRPLKKDEVAYAISDVVHLHAIRDKLNARIAELGRTE 313


>gi|94500848|ref|ZP_01307374.1| ribonuclease D [Oceanobacter sp. RED65]
 gi|94426967|gb|EAT11949.1| ribonuclease D [Oceanobacter sp. RED65]
          Length = 382

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 82/175 (46%), Gaps = 9/175 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPN------LVGMLVDEK 74
           IA+D+E + +     +L ++Q++ G  T  VD +RI    +  P       L+ +L ++ 
Sbjct: 23  IALDSEFMRVDTFYPKLALIQINDGSETYLVDPVRINRAHRGEPREEVWGPLIEVLSNQN 82

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+ H    D    +   GV   P+  T+ A+ +  +     G +  +K+LL I++ K 
Sbjct: 83  VVKVLHSPSEDFDAFYSNLGVVPSPIIDTQWAAAMA-SIDGIMGYQKLVKQLLDIDLEKG 141

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
              SDW    L+DEQ+ YAA DV HL  +  +   +L   GR       C  +++
Sbjct: 142 ATRSDWLQRPLTDEQIHYAADDVEHLLEITKRLETQLVTQGRWTWLLEDCERMVE 196


>gi|156502902|ref|YP_001428967.1| ribonuclease D [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|290953633|ref|ZP_06558254.1| ribonuclease D [Francisella tularensis subsp. holarctica URFT1]
 gi|295313032|ref|ZP_06803730.1| ribonuclease D [Francisella tularensis subsp. holarctica URFT1]
 gi|156253505|gb|ABU62011.1| ribonuclease D [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 363

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|56707887|ref|YP_169783.1| ribonuclease D [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110670358|ref|YP_666915.1| ribonuclease D [Francisella tularensis subsp. tularensis FSC198]
 gi|224456967|ref|ZP_03665440.1| ribonuclease D [Francisella tularensis subsp. tularensis MA00-2987]
 gi|254370381|ref|ZP_04986386.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874700|ref|ZP_05247410.1| ribonuclease D [Francisella tularensis subsp. tularensis MA00-2987]
 gi|56604379|emb|CAG45409.1| Ribonuclease D [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110320691|emb|CAL08792.1| Ribonuclease D [Francisella tularensis subsp. tularensis FSC198]
 gi|151568624|gb|EDN34278.1| hypothetical protein FTBG_00144 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840699|gb|EET19135.1| ribonuclease D [Francisella tularensis subsp. tularensis MA00-2987]
 gi|282159071|gb|ADA78462.1| Ribonuclease D [Francisella tularensis subsp. tularensis NE061598]
          Length = 364

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|315634066|ref|ZP_07889355.1| ribonuclease D [Aggregatibacter segnis ATCC 33393]
 gi|315477316|gb|EFU68059.1| ribonuclease D [Aggregatibacter segnis ATCC 33393]
          Length = 385

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 82/174 (47%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE + +     +L ++QL  GD  V +I     Q  +P  + +L DE   
Sbjct: 30  ARTQSAVALDTEFVRVRTLHPKLGLIQLYAGD-EVALIDPTMIQDFSP-FIALLADESVL 87

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + F    +P+  T++ +     +    G    ++    I I K   
Sbjct: 88  KVLHACGEDLEVFQHYFQQLPQPMCDTQVMANFL-GFAGSAGFATLVQHYFHIEIDKGAS 146

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS+ QL+YAA+DV +L  L +Q   +L +        + C FL+ +
Sbjct: 147 RTDWLARPLSEIQLRYAAADVWYLLPLYVQMQTQLAQTEWQSAVKNECEFLLHK 200


>gi|187931952|ref|YP_001891937.1| ribonuclease D [Francisella tularensis subsp. mediasiatica FSC147]
 gi|187712861|gb|ACD31158.1| ribonuclease D [Francisella tularensis subsp. mediasiatica FSC147]
          Length = 364

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|134302344|ref|YP_001122313.1| putative ribonuclease D [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134050121|gb|ABO47192.1| putative ribonuclease D [Francisella tularensis subsp. tularensis
           WY96-3418]
          Length = 364

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|296284765|ref|ZP_06862763.1| ribonuclease D [Citromicrobium bathyomarinum JL354]
          Length = 391

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 74/157 (47%), Gaps = 1/157 (0%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC+VQ+        I  +A G    P L  +  +E   KIFH
Sbjct: 24  DFVCVDTEFMRENTYWPELCLVQIGDEHEAAAIDPLADGIDLKPLLDLLTENEDVLKIFH 83

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ + +   G    P+F T+IA  +  + + Q G  + ++  L   I K  + +DW
Sbjct: 84  AGSQDVEIFYNLTGKTPHPIFDTQIAM-MAISQSEQIGYANLVEHWLDKTIDKGARFTDW 142

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           S   L+D QL+YA  DV +L  +  +  +KL +  R 
Sbjct: 143 SRRPLTDRQLEYAIGDVTYLAKIFPRILKKLMKTDRG 179


>gi|89256742|ref|YP_514104.1| ribonuclease D [Francisella tularensis subsp. holarctica LVS]
 gi|115315142|ref|YP_763865.1| ribonuclease III [Francisella tularensis subsp. holarctica OSU18]
 gi|167009819|ref|ZP_02274750.1| ribonuclease III [Francisella tularensis subsp. holarctica FSC200]
 gi|254368041|ref|ZP_04984061.1| ribonuclease D [Francisella tularensis subsp. holarctica 257]
 gi|89144573|emb|CAJ79888.1| Ribonuclease D [Francisella tularensis subsp. holarctica LVS]
 gi|115130041|gb|ABI83228.1| ribonuclease III [Francisella tularensis subsp. holarctica OSU18]
 gi|134253851|gb|EBA52945.1| ribonuclease D [Francisella tularensis subsp. holarctica 257]
          Length = 364

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|254374109|ref|ZP_04989591.1| ribonuclease D [Francisella novicida GA99-3548]
 gi|151571829|gb|EDN37483.1| ribonuclease D [Francisella novicida GA99-3548]
          Length = 364

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDIIKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|255261512|ref|ZP_05340854.1| ribonuclease D [Thalassiobium sp. R2A62]
 gi|255103847|gb|EET46521.1| ribonuclease D [Thalassiobium sp. R2A62]
          Length = 385

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 81/158 (51%), Gaps = 4/158 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQK--NAPNLVGMLVDEKREKIF 79
           + VDTE L       +LC++QL+ PG+G  + + +   +   +  +L  +  D    K+F
Sbjct: 23  VTVDTEFLRERTYYSKLCLIQLAYPGEGDENAVLVDPLEDGLSLASLYDLFRDPNVVKVF 82

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H  R D+ + F   G+   P+F T++A+ +   +  Q G +  ++++    + K+ + +D
Sbjct: 83  HAARQDLEIFFVDEGIIPAPLFDTQVAAMVC-GFGEQVGYETLVRKIAKAPLDKSSRFTD 141

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           WS   LSD Q +YA  DV +L  +     +KL +  R+
Sbjct: 142 WSRRPLSDAQKKYALGDVTYLREIYEFLADKLAKNNRA 179


>gi|308049432|ref|YP_003912998.1| ribonuclease D [Ferrimonas balearica DSM 9799]
 gi|307631622|gb|ADN75924.1| ribonuclease D [Ferrimonas balearica DSM 9799]
          Length = 374

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 85/173 (49%), Gaps = 4/173 (2%)

Query: 7   HEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           ++ D+ A C   R  DA+A+DTE +       +L ++QL  G+ T+ +I     Q   P 
Sbjct: 12  NDDDLAALCRQCRQKDAVALDTEFVRTRTLHAQLGLIQLYDGE-TLALIDPLEIQDLGP- 69

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  ++ D+   K+ H    D+ +  Y  GV  +P+F T++A  L        G    +  
Sbjct: 70  LWQLIADKNVVKVLHSASEDLEIFAYRGGVIPQPLFDTQVAGVLL-NLGGAMGYGKLIHH 128

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            LG+ + K +  +DW    LS++QL YAA+DV +L  +       ++ +GR D
Sbjct: 129 YLGLELDKGEARTDWLKRPLSEKQLTYAAADVYYLLQVYRMMRPAIEEMGRLD 181


>gi|254372648|ref|ZP_04988137.1| ribonuclease III [Francisella tularensis subsp. novicida GA99-3549]
 gi|151570375|gb|EDN36029.1| ribonuclease III [Francisella novicida GA99-3549]
          Length = 364

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDIIKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|190570587|ref|YP_001974945.1| Putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190356859|emb|CAQ54230.1| Putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 394

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 83/165 (50%), Gaps = 3/165 (1%)

Query: 14  ECAARYVDAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD 72
           E  A+    IAVDTE +   +    RL ++Q+S G+ +  I+ +     +   +  ++++
Sbjct: 15  ELMAKDPKFIAVDTEFIRNNLTYYPRLSLIQISYGEKSF-IVDVLVPGIDLSLIKKIMLN 73

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
            +  K+FH  R DI  L         P+F T++A+     Y +  G    +++  G+ + 
Sbjct: 74  REITKVFHSCRQDIESLLTVLKCVPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGVALD 133

Query: 133 KAQ-QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           K + ++SDW    LS++QL YA +DV+HL+ L      KL+   R
Sbjct: 134 KIKAKNSDWLKRPLSEDQLDYAVNDVIHLYDLHQILCNKLEENNR 178


>gi|294677027|ref|YP_003577642.1| ribonuclease D [Rhodobacter capsulatus SB 1003]
 gi|294475847|gb|ADE85235.1| ribonuclease D-2 [Rhodobacter capsulatus SB 1003]
          Length = 384

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 82/162 (50%), Gaps = 3/162 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PG-DGTVDIIRIAAGQKNAPNLVGMLVDEK 74
           A+    + VDTE L       +LC+VQ++ PG +G   ++       +   L  +   + 
Sbjct: 17  AKAAPYVTVDTEFLRERTYWSKLCLVQMALPGKEGEAVLVDPLVEGLSLEPLYDLFRHQA 76

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+FH  R D+ + F   GV   P+F T++A+ +   +  Q G +  +K++   ++ K 
Sbjct: 77  TVKVFHAARQDLEIFFTEAGVFPLPLFDTQVAAMVC-GFGEQVGYETLVKKIAKQSLDKT 135

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            + +DWS   L+D Q  YA +DV HL  +    +++L++ GR
Sbjct: 136 SRFTDWSRRPLTDAQKAYALADVTHLRVIYEFLSKELRKSGR 177


>gi|312172621|emb|CBX80877.1| Ribonuclease D [Erwinia amylovora ATCC BAA-2158]
          Length = 369

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+ T+ +I         P    +L+D++  
Sbjct: 15  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGE-TICLIDPLPITDWTP-FRDLLLDQQVI 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +  +    +  G    ++   GI + K++ 
Sbjct: 73  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAFSGRPLS-CGFATIVESFTGIVLDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 132 RTDWLARPLSEKQCRYAAADVFYLLPIAEKLVAETEAAGQMAAALDECRLLCQR 185


>gi|260576346|ref|ZP_05844337.1| ribonuclease D [Rhodobacter sp. SW2]
 gi|259021417|gb|EEW24722.1| ribonuclease D [Rhodobacter sp. SW2]
          Length = 385

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 4/179 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDG--TVDIIRIAAGQKNAPNLVGMLVD 72
           AA+    + +DTE L       +LC++Q++ PG     V +  I   + +   L  +   
Sbjct: 16  AAKREPYVTIDTEFLRERTYWSKLCLIQMALPGKTGRAVLVDPIEGPEMSLEPLYDLFRH 75

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           +   K+FH  R D+ + F        P+F T++A+ +   Y  Q G +  +K++   N+ 
Sbjct: 76  QATVKVFHAARQDLEIFFVEGNSFPEPLFDTQVAA-MVCGYGEQVGYETLVKKIAKENLD 134

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           K  + +DWS   LS+ Q  YA +DV HL  +      ++ + GR        + L D A
Sbjct: 135 KTSRFTDWSRRPLSEAQSDYALADVTHLRVVYESLAAQIAKSGRQKWVEEELSILTDPA 193


>gi|292488477|ref|YP_003531361.1| ribonuclease D [Erwinia amylovora CFBP1430]
 gi|291553908|emb|CBA20953.1| Ribonuclease D [Erwinia amylovora CFBP1430]
          Length = 369

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+ T+ +I         P    +L+D++  
Sbjct: 15  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGE-TICLIDPLPITDWTP-FRDLLLDQQVI 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +  +    +  G    ++   GI + K++ 
Sbjct: 73  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAFSGRPLS-CGFATIVESFTGIVLDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 132 RTDWLARPLSEKQCRYAAADVFYLLPIAEKLVAETEAAGQMAAALDECRLLCQR 185


>gi|291617685|ref|YP_003520427.1| Rnd [Pantoea ananatis LMG 20103]
 gi|291152715|gb|ADD77299.1| Rnd [Pantoea ananatis LMG 20103]
          Length = 373

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 88/184 (47%), Gaps = 4/184 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE +       +L ++QL  G+  V I  +    ++    + +L D +  
Sbjct: 19  ARQHTAVALDTEFVRTRTYYPQLGLIQLFDGEQLVLIDPLPV--RDWSPFIELLTDTRVT 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + F V  +P+  T+I +  +    +  G    +     + + K++ 
Sbjct: 77  KFLHAGGEDLEVFLHRFAVLPQPMIDTQILAAFSGQPLS-WGFASMVAHFTQVELDKSEA 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DW A  L++ Q QYAA+DV +L  +  Q  +++++ G    A S C  L  R  LD L
Sbjct: 136 RTDWLARPLTERQCQYAAADVHYLLPIAHQLMQQVEQAGNMAAALSECENLCQR-RLDSL 194

Query: 197 GWEN 200
             E+
Sbjct: 195 APED 198


>gi|292899665|ref|YP_003539034.1| ribonuclease D [Erwinia amylovora ATCC 49946]
 gi|291199513|emb|CBJ46630.1| ribonuclease D [Erwinia amylovora ATCC 49946]
          Length = 373

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+ T+ +I         P    +L+D++  
Sbjct: 19  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGE-TICLIDPLPITDWTP-FRDLLLDQQVI 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +  +    +  G    ++   GI + K++ 
Sbjct: 77  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAFSGRPLS-CGFATIVESFTGIVLDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 136 RTDWLARPLSEKQCRYAAADVFYLLPIAEKLVAETEAAGQMAAALDECRLLCQR 189


>gi|261821503|ref|YP_003259609.1| ribonuclease D [Pectobacterium wasabiae WPP163]
 gi|261605516|gb|ACX88002.1| ribonuclease D [Pectobacterium wasabiae WPP163]
          Length = 374

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 86/180 (47%), Gaps = 6/180 (3%)

Query: 15  CA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CA A+    +A+DTE +       +L ++QL  G+  + +I        AP    +L DE
Sbjct: 16  CAQAQRFPQVALDTEFVRTRTYYPQLGLIQLYDGE-QLSLIDPLTITDWAP-FQALLRDE 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINIS 132
           +  K  H G  D+ V   TFG    P   T+I A+ L +  +  +G    + + +G+ + 
Sbjct: 74  QVTKFLHAGSEDLEVFLNTFGTLPTPFIDTQILAAFLGKPLS--YGFAALVADYMGVTLD 131

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           K++  +DW A  LS++Q  YAA+DV +L  + +Q     +  G  + A   C  L  R +
Sbjct: 132 KSESRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVTDTEAAGWMNAALDECLLLCQRKQ 191


>gi|329898076|ref|ZP_08272286.1| Ribonuclease D [gamma proteobacterium IMCC3088]
 gi|328920975|gb|EGG28399.1| Ribonuclease D [gamma proteobacterium IMCC3088]
          Length = 373

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 79/155 (50%), Gaps = 3/155 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+ +DTE +       +  +VQL+ G G + ++   A   +A  L  +L  E+  K+ H 
Sbjct: 27  AVVLDTEFVRERTYYPKPALVQLA-GAGHISLVDPVA-VTDASALSSLLESERTLKVVHS 84

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
           G  D+ V     G  ++  F T++A+ L   Y    G ++ ++  LG  + K +  SDW 
Sbjct: 85  GSEDLEVFQAWLGCPIKGWFDTQVAAALL-GYGYAIGYRNIVETFLGEELDKGETRSDWL 143

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
              LSD QLQYA +DV++L  +  +  ++ + LGR
Sbjct: 144 QRPLSDSQLQYAIADVLYLEPVFERLYQEAEALGR 178


>gi|257784443|ref|YP_003179660.1| ribonuclease D [Atopobium parvulum DSM 20469]
 gi|257472950|gb|ACV51069.1| ribonuclease D [Atopobium parvulum DSM 20469]
          Length = 379

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 78/164 (47%), Gaps = 11/164 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           A+    +AVDTE L       +LC+VQ+S G     +D + I     +   L  +L + +
Sbjct: 19  AKTSHILAVDTEFLREKTYFPKLCLVQVSTGSEIAAIDPLLI----DDLTPLKELLENPE 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRL--TRTYTNQHGLKDNLKELLGINIS 132
             KI H    D+ VL         PVF T++A+     R   +  GL +N      + ++
Sbjct: 75  IVKILHACSQDLEVLLEKMDCACAPVFDTQVAAAFLGMRQQVSYAGLVENFA---NVKLA 131

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           KA+  +DWS   L  EQL YA  DV +L A+  Q  EKL +L R
Sbjct: 132 KAESLTDWSKRPLDKEQLVYAEDDVRYLPAIYNQMVEKLIKLDR 175


>gi|303232226|ref|ZP_07318925.1| ribonuclease D [Atopobium vaginae PB189-T1-4]
 gi|302481636|gb|EFL44697.1| ribonuclease D [Atopobium vaginae PB189-T1-4]
          Length = 437

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 79/154 (51%), Gaps = 3/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +       +LC++Q++    +  +  +A    +  +L  +L D+   K+F   
Sbjct: 83  VAIDTEFIREKTYYPQLCLIQMATHTQSAVVDPLACS--SLCDLACLLEDKSIIKVFFAC 140

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             DI VL+   GV  + VF  ++A+     Y  Q G    ++ ++G+++ K Q  +DWS 
Sbjct: 141 SQDIEVLYDALGVVPKNVFDAQLAAAFL-GYRYQLGYGALVEAMVGVHLPKTQALTDWSL 199

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             L++EQL+YAA DV++   +      +L R  R
Sbjct: 200 RPLTEEQLKYAADDVIYQPQMYTLLVRELTRTNR 233


>gi|328676764|gb|AEB27634.1| Ribonuclease D [Francisella cf. novicida Fx1]
          Length = 364

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 73/153 (47%), Gaps = 11/153 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQR 173
               L+  QL YA  DV +L    +Q  E LQ+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQ 165


>gi|28199772|ref|NP_780086.1| ribonuclease D [Xylella fastidiosa Temecula1]
 gi|182682522|ref|YP_001830682.1| ribonuclease D [Xylella fastidiosa M23]
 gi|28057893|gb|AAO29735.1| ribonuclease D [Xylella fastidiosa Temecula1]
 gi|182632632|gb|ACB93408.1| ribonuclease D [Xylella fastidiosa M23]
          Length = 362

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 81/187 (43%), Gaps = 3/187 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +   D  A    R    I +DTE +        L +VQ++ GD  + +  +  G  +A  
Sbjct: 5   IQHPDTLATWWDRKPTRIGMDTEFIREGTFWPELALVQIAIGDEILLVDPLVPGMTDALG 64

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      KI H    D+    Y  GV  RP+F T+I + LT       G +  + +
Sbjct: 65  L--WLAAPNVIKIMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGM-GYQKLVAK 121

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +  + + K +  SDW    L+  QL YAA+DV +L AL    TE+L  + RS      C 
Sbjct: 122 VTNVELGKGETRSDWMHRPLTPAQLDYAANDVRYLFALHDTLTERLAEMSRSAWLEEDCT 181

Query: 186 FLMDRAE 192
            L D  E
Sbjct: 182 RLTDNIE 188


>gi|213019164|ref|ZP_03334971.1| putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995273|gb|EEB55914.1| putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 378

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 80/159 (50%), Gaps = 9/159 (5%)

Query: 23  IAVDTE----TLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           IAVDTE     L   PR   L ++Q+S G+ +  I+ +     +   +  ++++ +  K+
Sbjct: 8   IAVDTEFIRNNLTYYPR---LSLIQISYGEKSF-IVDVLVPGIDLSLIKKIMLNREITKV 63

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QS 137
           FH  R DI  L         P+F T++A+     Y +  G    +++  G+ + K + ++
Sbjct: 64  FHSCRQDIESLLTVLKCVPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGVALDKIKAKN 123

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           SDW    LS++QL YA +DV+HL+ L      KL+   R
Sbjct: 124 SDWLKRPLSEDQLDYAVNDVIHLYDLHQILCNKLEENNR 162


>gi|322832720|ref|YP_004212747.1| ribonuclease D [Rahnella sp. Y9602]
 gi|321167921|gb|ADW73620.1| ribonuclease D [Rahnella sp. Y9602]
          Length = 373

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 79/170 (46%), Gaps = 7/170 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IA+DTE +       +L ++QL  G+    +D + I A Q      + +LVD    K  H
Sbjct: 25  IALDTEFVRTRTYYPQLGLIQLFDGERLTLIDPLPITAWQP----FIDLLVDPDVIKFLH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FGV   P+  T+I +  +    +  G    + E  G+ + K++  +DW
Sbjct: 81  AGSEDLEVFLNAFGVMPSPLIDTQILAAFSGRPLS-CGFARLVAETTGVELDKSESRTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  LS++Q  YAA+DV +L  L  Q   + Q  G  D A   C  L  R
Sbjct: 140 IARPLSEKQCVYAAADVWYLLPLADQLMRETQDAGWMDAALDECLALCRR 189


>gi|311279296|ref|YP_003941527.1| ribonuclease D [Enterobacter cloacae SCF1]
 gi|308748491|gb|ADO48243.1| ribonuclease D [Enterobacter cloacae SCF1]
          Length = 386

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 85/182 (46%), Gaps = 6/182 (3%)

Query: 11  IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           + A C AAR   AIA+DTE +       +L ++Q+  GD  V I  ++    +      +
Sbjct: 21  LKAACDAARGAPAIALDTEFVRTRTYYPQLGLIQMYDGDSVVLIDPLSI--TDWTPFRDL 78

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLG 128
           L+D    K  H G  D+ V   TFGV   P+  T+I A+   R  +   G    ++E  G
Sbjct: 79  LLDGAVTKYLHAGSEDLEVFLNTFGVLPEPLIDTQILAAFCGRPMS--WGFAAMVEEYTG 136

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           I + K++  +DW A  L++ Q  YAA+DV +L  +  +   + +  G    A   C  + 
Sbjct: 137 IALDKSESRTDWLARPLTERQCDYAAADVWYLLPIAHKLMAETEASGWLPAALDECRLMQ 196

Query: 189 DR 190
            R
Sbjct: 197 QR 198


>gi|118497275|ref|YP_898325.1| ribonuclease D [Francisella tularensis subsp. novicida U112]
 gi|194323578|ref|ZP_03057355.1| ribonuclease D [Francisella tularensis subsp. novicida FTE]
 gi|208779068|ref|ZP_03246414.1| ribonuclease D [Francisella novicida FTG]
 gi|118423181|gb|ABK89571.1| ribonuclease D [Francisella novicida U112]
 gi|194322433|gb|EDX19914.1| ribonuclease D [Francisella tularensis subsp. novicida FTE]
 gi|208744868|gb|EDZ91166.1| ribonuclease D [Francisella novicida FTG]
          Length = 364

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 76/159 (47%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D +     +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLEDLEFKK----LKEIFEDKDIIKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL YA  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYAIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|254369642|ref|ZP_04985652.1| hypothetical protein FTAG_00956 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122601|gb|EDO66730.1| hypothetical protein FTAG_00956 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 364

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 77/159 (48%), Gaps = 12/159 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQL+  +    +D ++    +K    L  +  D+   KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKK----LKEIFEDKDILKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAATFL-GFQTQSSLKTLLKEILDIEIEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSD 178
               L+  QL Y+  DV +L    +Q  E L Q+L +S+
Sbjct: 137 RNRPLTQNQLNYSIKDVEYL----IQLKEYLQQQLAKSE 171


>gi|222825102|dbj|BAH22259.1| putative ribonuclease D [Wolbachia endosymbiont of Cadra cautella]
          Length = 394

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 81/156 (51%), Gaps = 3/156 (1%)

Query: 23  IAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           IA+DTE +   +    +L ++Q+S G+ +  I+     + +   +  M++++   K+FH 
Sbjct: 24  IAIDTEFIRNNLTYYPKLSLIQISYGEKSF-IVDALVPEIDLSFIKKMMLNQGIIKVFHS 82

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSSDW 140
            R DI  L   F     P+F T++A+     Y +  G    +++  GI + K + ++SDW
Sbjct: 83  CRQDIESLLTVFKCVPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGIALDKIKAKNSDW 142

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
               LS++QL YA +DVV+L+ L      KL+   R
Sbjct: 143 LRRPLSEDQLDYAINDVVYLYDLYQILCNKLEESNR 178


>gi|114704849|ref|ZP_01437757.1| probable ribonuclease d protein [Fulvimarina pelagi HTCC2506]
 gi|114539634|gb|EAU42754.1| probable ribonuclease d protein [Fulvimarina pelagi HTCC2506]
          Length = 383

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 77/173 (44%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC++Q++  D  V +  +A G    P    ++ DE   K+FH  
Sbjct: 23  VTVDTEFIRETTFWPELCLIQMASDDTEVLVDPLAKGLSLDP-FFALMADESVVKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++    V  +P+F T+IA+ +   +         +  L    I K+ + +DW  
Sbjct: 82  RQDLEIVYKLGAVIPKPLFDTQIAAMVC-GFGESIAYDQLVARLTDGRIDKSSRFTDWRH 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             LSD+QL YA +DV HL  +      +L+   R          L D    DL
Sbjct: 141 RPLSDKQLTYALADVTHLRDVYKALKAQLEETSRHSWLDEEMAILADPQTYDL 193


>gi|331005546|ref|ZP_08328920.1| Ribonuclease D [gamma proteobacterium IMCC1989]
 gi|330420648|gb|EGG94940.1| Ribonuclease D [gamma proteobacterium IMCC1989]
          Length = 383

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 85/171 (49%), Gaps = 7/171 (4%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           AIA+DTE +        + ++Q++  +G   +D + I+  Q  A     +L +    K+ 
Sbjct: 39  AIALDTEFVRTRTYYPHIGLLQIADENGVYLIDPLAISDTQPMA----DVLQNPAIVKVV 94

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H    D+ V  Y FGV    +F T++A+     Y +  G  + L+E+  I+I K +  SD
Sbjct: 95  HACSEDLEVFQYAFGVLPESLFDTQVAAGFA-GYGSSIGYANLLREIKRIDIPKQETRSD 153

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           W    LSD QL+YAA DV +L  +     EKLQ+  R     + C  ++++
Sbjct: 154 WLQRPLSDAQLRYAALDVEYLLEIYRGLVEKLQQQQRLLWVEADCQRMIEK 204


>gi|39995551|ref|NP_951502.1| ribonuclease D [Geobacter sulfurreducens PCA]
 gi|39982314|gb|AAR33775.1| ribonuclease D, putative [Geobacter sulfurreducens PCA]
          Length = 381

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 74/165 (44%), Gaps = 4/165 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A D E   +   ++++C++Q +   G   I+   A    +P L  +  +    K+FH  
Sbjct: 30  VACDLEADSMHHYQEKVCLIQFA-VPGYAAIVDPLAAPDISP-LAPLFANAAIRKVFHGA 87

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +DI  L   FG+ V  +F T IA +L      + GL   L++  G+ + K  Q +DWS 
Sbjct: 88  DYDIRSLHRDFGIEVNNLFDTMIACQLL--GEREFGLAAQLRKRFGVELDKQYQRADWSR 145

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             L+   ++YA  D   L  L  Q   +L+  GR       C  L
Sbjct: 146 RPLTVGMIEYAVKDTTLLIELYRQLVAELEEKGRRGWVEEECELL 190


>gi|15606966|ref|NP_214348.1| DNA polymerase I (PolI) [Aquifex aeolicus VF5]
 gi|6015000|sp|O67779|DPO1_AQUAE RecName: Full=DNA polymerase I; Short=POL I
 gi|2984205|gb|AAC07735.1| DNA polymerase I (PolI) [Aquifex aeolicus VF5]
          Length = 574

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 80/152 (52%), Gaps = 12/152 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTET G     DR+ +VQ+   + T  +I +   Q   P  +  L++E R  + H  
Sbjct: 25  LYLDTETTG-----DRIRLVQIGDEENTY-VIDLYEIQDIEP--LRKLINE-RGIVGHNL 75

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           +FD+  L Y +G+     F T IAS L      +H L   +  LLG ++ K+ Q+SDW A
Sbjct: 76  KFDLKYL-YRYGIFPSATFDTMIASYLLGY--ERHSLNHIVSNLLGYSMDKSYQTSDWGA 132

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
             LSD QL+YAA+DV+ L  L  +  + L  L
Sbjct: 133 SVLSDAQLKYAANDVIVLRELFPKMRDMLNEL 164


>gi|227111497|ref|ZP_03825153.1| ribonuclease D [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 374

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 83/177 (46%), Gaps = 5/177 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +L ++QL  G+  + +I        AP    +L DE+  
Sbjct: 19  ARRFPQVALDTEFVRTRTYYPQLGLIQLYDGE-QLSLIDPLTITDWAP-FQALLRDEQVT 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           K  H G  D+ V    FG    P   T+I A+ L +  +  +G    + + +G+ + K++
Sbjct: 77  KFLHAGSEDLEVFLNAFGTLPVPFIDTQILAAFLGKPLS--YGFAALVADYMGVTLDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
             +DW A  LS++Q  YAA+DV +L  + +Q     +  G  + A   C  L  R +
Sbjct: 135 SRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVADTEAAGWMNAALDECLLLCQRKQ 191


>gi|52425412|ref|YP_088549.1| ribonuclease D [Mannheimia succiniciproducens MBEL55E]
 gi|52307464|gb|AAU37964.1| Rnd protein [Mannheimia succiniciproducens MBEL55E]
          Length = 380

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 81/177 (45%), Gaps = 4/177 (2%)

Query: 15  CA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CA A    AIA+DTE + +     +L ++QL  G+  V +I     Q  +P    +L D 
Sbjct: 27  CARASTKSAIALDTEFVRIRSYYPKLGLIQLYDGE-QVSLIDPQEIQDFSP-FKQLLADP 84

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K  K+ H    D+ V  + +     P+  T+I +     + N  GL   +K    + I K
Sbjct: 85  KILKVLHACHEDLEVFQHYYQQLPAPMLDTQIMANFL-GFQNSMGLASLIKHYFNLEIDK 143

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
               +DW A  LS+ QL YAA+DV +L  L  +    L++          CN L+++
Sbjct: 144 GASRTDWLARPLSNRQLAYAAADVWYLLPLYCKMQNALEQTRWQSAVEFDCNLLLEK 200


>gi|296446899|ref|ZP_06888835.1| ribonuclease D [Methylosinus trichosporium OB3b]
 gi|296255574|gb|EFH02665.1| ribonuclease D [Methylosinus trichosporium OB3b]
          Length = 388

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 87/171 (50%), Gaps = 5/171 (2%)

Query: 10  DIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           D+ A CA  +R+   + VDTE L       ++C++QL+  +    +  +A G   +P   
Sbjct: 9   DLAAACARLSRH-PFVTVDTEFLRETTFWPKVCVIQLASPEEAFAVDTLAEGLDLSP-FF 66

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ D    K+FH  R D+ +++    +   P+F T++A+ +   + +Q    + +K + 
Sbjct: 67  ELMADASVVKVFHAARQDLEIIWRLARLIPTPLFDTQVAA-MVCGFGDQASYVELVKAIA 125

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             ++ K+ + +DWS   LS  Q+ YA +DV HL  +     ++L+R  R D
Sbjct: 126 KESLDKSSRFTDWSKRPLSVAQIDYAIADVTHLRQIYTHLRQRLERSNRLD 176


>gi|254512186|ref|ZP_05124253.1| ribonuclease D [Rhodobacteraceae bacterium KLH11]
 gi|221535897|gb|EEE38885.1| ribonuclease D [Rhodobacteraceae bacterium KLH11]
          Length = 385

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 83/165 (50%), Gaps = 7/165 (4%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDG---TVDIIRIAAGQKNAPNLVGMLV 71
           AA+Y   + VDTE L       +LC+VQL+ P +G    V +  +A G    P L  +  
Sbjct: 17  AAQY-PYVTVDTEFLRERTYYSKLCLVQLAVPAEGDDSAVLVDPLAEGMSLDP-LYELFR 74

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           +E   K+FH  R D+ + +   GV   P+F T++A+ +   +  Q G +  ++++    +
Sbjct: 75  NESVVKVFHAARQDLEIFWVDAGVFPTPLFDTQVAAMVC-GFGEQVGYETLVRKICKEGV 133

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            K  + +DWS   L++ Q  YA +DV HL  +      +L++  R
Sbjct: 134 DKTSRFTDWSRRPLTEAQKSYALADVTHLRKIYEYLAGELKKTKR 178


>gi|146312020|ref|YP_001177094.1| ribonuclease D [Enterobacter sp. 638]
 gi|145318896|gb|ABP61043.1| ribonuclease D [Enterobacter sp. 638]
          Length = 384

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 81/173 (46%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++Q+  G     I  +  G  +   +  +L++    K
Sbjct: 29  RDFPAIALDTEFVRTRTYYPQLGLIQMYDGKNVSLIDPL--GITDWSPMRELLLNTAITK 86

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V   TFG+   P+  T+I +  +    +  G    ++E  GI + K++  
Sbjct: 87  YLHAGSEDLEVFLNTFGIMPEPLIDTQILAAFSGRPLS-WGFAAMVEEYTGIALDKSESR 145

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  L++ QL YAA+DV +L  +  Q  ++ +  G  D A + C     R
Sbjct: 146 TDWLARPLTERQLDYAAADVFYLLPIAGQLMKEAEAAGWLDAALNECRMTQQR 198


>gi|89054329|ref|YP_509780.1| ribonuclease D [Jannaschia sp. CCS1]
 gi|88863878|gb|ABD54755.1| ribonuclease D [Jannaschia sp. CCS1]
          Length = 386

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 86/173 (49%), Gaps = 7/173 (4%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRI---AAGQKNAP 64
           ++ A CA A     + VDTE L       +LC+VQ++ PG    D + I   A G    P
Sbjct: 10  ELAAYCARAATQPYVTVDTEFLRERTYFAQLCLVQVAMPGTDDTDAVLIDPLAEGLSLEP 69

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +  +    K+FH  R D+ + F   G+   P+F T++A+ +   + +Q G +  ++
Sbjct: 70  -LYELFRNVNVVKVFHAARQDLEIFFVEGGLVPTPLFDTQVAA-MVCGFGDQVGYETLVR 127

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            +   N+ K+ + +DWS   LSD Q  YA +DV +L  +    + +L R  R+
Sbjct: 128 RIAKANLDKSSRFTDWSRRPLSDAQKVYALADVTYLREIYEYLSAELARTDRT 180


>gi|220933694|ref|YP_002512593.1| ribonuclease D [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995004|gb|ACL71606.1| ribonuclease D [Thioalkalivibrio sp. HL-EbGR7]
          Length = 396

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 73/156 (46%), Gaps = 3/156 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IA+DTE +       RLC+VQ++  D    I  IA    +   L  +L D    K+ H  
Sbjct: 36  IALDTEFVREKTYYPRLCLVQVATPDALACIDPIAL--PDLGPLAALLHDPAVTKVVHAA 93

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ +L  + G    PVF T++A  L   + +Q G    ++  L + + K    +DWS 
Sbjct: 94  HQDMEILLQSTGRVPTPVFDTQVAVSLL-GHGDQIGYARMVQIYLDLELDKGHTRTDWSQ 152

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             L   QL+YAA DV HL  +     + L+  GR D
Sbjct: 153 RPLETAQLRYAADDVRHLARVYPMILKDLEEKGRLD 188


>gi|88607542|ref|YP_504762.1| putative ribonuclease D [Anaplasma phagocytophilum HZ]
 gi|88598605|gb|ABD44075.1| putative ribonuclease D [Anaplasma phagocytophilum HZ]
          Length = 381

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 77/145 (53%), Gaps = 3/145 (2%)

Query: 21  DAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           +++A+DTE L        +LC++Q++  +    I  +A G    P L  +  + +  K+F
Sbjct: 22  ESVAIDTEFLRSFNDYYPKLCLLQIAYENKQCVIDALAEGIDLTP-LQEIFDNTQIFKVF 80

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSS 138
           H  R D+  L   F    RP+F T+IA+ L   + N  G    +++ LG+ ++K   +  
Sbjct: 81  HDCRQDLDALSLLFESLPRPIFDTQIAAMLCEYHENSVGYSKLVEQFLGVKLNKMPFKRV 140

Query: 139 DWSADDLSDEQLQYAASDVVHLHAL 163
           DWS   L++ +++YA  DV++L+ L
Sbjct: 141 DWSKRPLTESEVRYALDDVIYLYKL 165


>gi|84393455|ref|ZP_00992211.1| ribonuclease D [Vibrio splendidus 12B01]
 gi|84375883|gb|EAP92774.1| ribonuclease D [Vibrio splendidus 12B01]
          Length = 313

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 11/163 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+ T+ +I   A  +  P  VG+L D    
Sbjct: 44  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGE-TLSLIDPIALDEMTP-FVGLLKDTSVL 101

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGINIS 132
           K+ H    D+ V    FG    P+  T+I +         HGL       + E +G+++ 
Sbjct: 102 KVLHACGEDLEVFQNAFGCTPTPMVDTQIMAAFL-----GHGLSTGFAALVSEFVGVDLD 156

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           K++  +DW A  LS +QL YAA+DV +L  +  +  EK+   G
Sbjct: 157 KSESRTDWLARPLSQKQLDYAAADVHYLMPMYNKLLEKVMEAG 199


>gi|218710187|ref|YP_002417808.1| Ribonuclease D [Vibrio splendidus LGP32]
 gi|218323206|emb|CAV19383.1| Ribonuclease D [Vibrio splendidus LGP32]
          Length = 397

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+ T+ +I   A  +  P  VG+L D    
Sbjct: 44  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGE-TLSLIDPIALDEMTP-FVGLLKDTSVL 101

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGINIS 132
           K+ H    D+ V    FG    P+  T+I +         HGL       + E +G+++ 
Sbjct: 102 KVLHACGEDLEVFQNAFGCTPTPMVDTQIMAAFL-----GHGLSTGFAALVSEFVGVDLD 156

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           K++  +DW A  LS +QL YAA+DV +L  +  +  EK+   G  + A
Sbjct: 157 KSESRTDWLARPLSQKQLDYAAADVHYLMPMYNKLLEKVMEAGWWEAA 204


>gi|241668633|ref|ZP_04756211.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254877166|ref|ZP_05249876.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254843187|gb|EET21601.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 364

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 82/180 (45%), Gaps = 8/180 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK-NAPNLVGMLVDEKREKIFHY 81
           IAVDTE   +      LC+VQ++  +   +I  I   +  +   L  +  D   +KI H 
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQIATEN---EIFLIDTLEDLDFSKLKDIFEDTNIQKIIHS 78

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              DI ++   F   V  +F T++A+    T + Q  LK  LK++L I + K  Q SDW 
Sbjct: 79  ATNDIPIIKRFFDCEVNNIFDTQLAASFLGTQS-QISLKALLKDILDIEMEKESQFSDWR 137

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWENV 201
              LS +Q  YA  DV HL  ++     K   L ++D        L+D  + +    EN+
Sbjct: 138 KRPLSQKQFDYALKDVEHLIEIKYHLESK---LNQTDYKQYFYEELLDIQKTEFNTVENI 194


>gi|114797633|ref|YP_760953.1| ribonuclease D [Hyphomonas neptunium ATCC 15444]
 gi|114737807|gb|ABI75932.1| ribonuclease D [Hyphomonas neptunium ATCC 15444]
          Length = 388

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 81/174 (46%), Gaps = 2/174 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE          LC++Q S   G   +I   A   +    + ++  +++ K+FH
Sbjct: 26  DFVCVDTEFHRETTYWPELCLIQAS-APGVEGLIDPRAEDLDIRPFLDLIASDRQLKVFH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI +     G    P+F T++A+ +   + +     + ++ +L  +I K+ Q +DW
Sbjct: 85  AARQDIEIFNRLIGHPPGPIFDTQVAA-MALGFGDSISYDNLIQRVLRKHIDKSSQFTDW 143

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
               LS +QL YA  DV HL    L+  ++L++ GR +        L D A  D
Sbjct: 144 MRRPLSQKQLVYALGDVTHLRDAYLKMRDELEKAGRMNWVREEMAELEDPATYD 197


>gi|167628093|ref|YP_001678593.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25017]
 gi|167598094|gb|ABZ88092.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 366

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 72/152 (47%), Gaps = 5/152 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK-NAPNLVGMLVDEKREKIFHY 81
           IAVDTE   +      LC+VQ++  +   +I  I   +  +   L  +  D   +KI H 
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQIATEN---EIFLIDTLEDLDFSKLKDIFEDTNIQKIIHS 78

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              DI ++   F   V  +F T++A+    T + Q  LK  LK++L I + K  Q SDW 
Sbjct: 79  ATNDIPIIKRFFDCEVNNIFDTQLAASFLGTQS-QISLKALLKDILDIEMEKESQFSDWR 137

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQR 173
              LS +Q  YA  DV HL  ++     KL +
Sbjct: 138 KRPLSQKQFDYALKDVKHLIEIKYHLESKLNQ 169


>gi|253688324|ref|YP_003017514.1| ribonuclease D [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754902|gb|ACT12978.1| ribonuclease D [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 374

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 6/180 (3%)

Query: 15  CA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CA AR    +A+DTE +       +L ++QL  G+  + +I        AP    +L DE
Sbjct: 16  CAQARRFPQVALDTEFVRTRTYYPQLGLIQLYDGE-QLSLIDPLTITDWAP-FQALLRDE 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINIS 132
           +  K  H G  D+ V    FG    P   T+I A+ L +  +  +G    + + +G+ + 
Sbjct: 74  QVTKFLHAGSEDLEVFLNAFGTLPVPFIDTQILAAFLGKPLS--YGFAALVADYMGVTLD 131

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           K++  +DW A  LS++Q  YAA+DV +L  +  Q     +  G  + A   C  L  R +
Sbjct: 132 KSESRTDWLARPLSEKQCDYAAADVFYLLPMAAQLVADTEAAGWMNAALDECLLLCQRKQ 191


>gi|329296338|ref|ZP_08253674.1| ribonuclease D [Plautia stali symbiont]
          Length = 373

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 86/191 (45%), Gaps = 5/191 (2%)

Query: 7   HEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           H   + A C  AR   A+A+DTE +       +L ++QL  G+  V I  +      AP 
Sbjct: 8   HNDQLAAVCQQARQHRAVALDTEFVRTRTYYPQLGLIQLFDGEQLVLIDPLTISDW-AP- 65

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
            + +L D +  K  H G  D+ V  + FG    P+  T+I +       +  G    +  
Sbjct: 66  FIALLQDRQLTKFLHAGGEDLEVFLHRFGCLPEPMIDTQILAAFAGQPLS-WGFAAMVNH 124

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
              I + K++  +DW A  L++ Q QYAA+DV +L  +  Q   + +  G    A S C 
Sbjct: 125 FNQIELDKSEARTDWLARPLTERQCQYAAADVAYLLPIAHQLVAQTEAAGNMAAALSECA 184

Query: 186 FLMDRAELDLL 196
            L  R  LD+L
Sbjct: 185 TLCQR-RLDVL 194


>gi|86147639|ref|ZP_01065948.1| ribonuclease D [Vibrio sp. MED222]
 gi|85834550|gb|EAQ52699.1| ribonuclease D [Vibrio sp. MED222]
          Length = 397

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 81/168 (48%), Gaps = 11/168 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+ T+ +I   A  +  P  VG+L D    
Sbjct: 44  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGE-TLSLIDPIALDEMTP-FVGLLKDTSVL 101

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGINIS 132
           K+ H    D+ V    FG    P+  T+I +         HGL       + E +G+++ 
Sbjct: 102 KVLHACGEDLEVFQNAFGCTPTPMVDTQIMAAFL-----GHGLSTGFAALVSEFVGVDLD 156

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           K++  +DW A  LS +QL YAA+DV +L  +  +  EK+   G  + A
Sbjct: 157 KSESRTDWLARPLSQKQLDYAAADVHYLMPMYNKILEKVMEAGWWEAA 204


>gi|307578800|gb|ADN62769.1| ribonuclease D [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 339

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 71/154 (46%), Gaps = 3/154 (1%)

Query: 39  LCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVR 98
           L +VQ++ GD  + +  +  G  +A  L   L      KI H    D+    Y  GV  R
Sbjct: 15  LALVQIAIGDEILLVDPLVPGMTDALGL--WLAAPNVIKIMHSASEDLIAFKYACGVLPR 72

Query: 99  PVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVV 158
           P+F T+I + LT       G +  + ++  + + K +  SDW    L+  QL YAA+DV 
Sbjct: 73  PLFDTQIGAALTGLGGGM-GYQKLVAKVTNVELGKGETRSDWMHRPLTPAQLDYAANDVR 131

Query: 159 HLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           +L AL    TE+L  + RS      C  L D  E
Sbjct: 132 YLFALHDTLTERLAEMSRSAWLEEDCTRLTDNIE 165


>gi|86158027|ref|YP_464812.1| 3'-5' exonuclease [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774538|gb|ABC81375.1| 3'-5' exonuclease [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 294

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 72/143 (50%), Gaps = 10/143 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSP--GDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+DTE+      R+R+C++QLS    D  VD I +          +G ++ + RE + H
Sbjct: 35  LALDTESNSFHVYRERVCLLQLSTRTQDFVVDPISVDV------RPLGEILCDGREVVLH 88

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+  L   +G R+  +F T IA+R  R      GL   ++   G+ +SKA Q SDW
Sbjct: 89  GADYDVRCLHREYGWRIPRLFDTMIAAR--RLGRPGLGLSALVESHFGVRLSKAFQRSDW 146

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
               L+ +QL YAA D   L  L
Sbjct: 147 GRRPLTPDQLAYAALDTHFLLPL 169


>gi|253698875|ref|YP_003020064.1| 3'-5' exonuclease [Geobacter sp. M21]
 gi|251773725|gb|ACT16306.1| 3'-5' exonuclease [Geobacter sp. M21]
          Length = 377

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 8/156 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPG--DGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A D E   L    +++C++Q+S    D  +D +     +  AP    +  +   +KIFH
Sbjct: 35  LAFDLEADSLHHYTEKVCLIQVSSASEDRLIDPLAPIDVKVLAP----IFANPAIKKIFH 90

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+  L+  FG+ V  +F T IAS+      ++ GL   LK+  G+ + K  Q +DW
Sbjct: 91  GADYDMRSLYRDFGIEVVNLFDTMIASQFL--GESEFGLAALLKKRFGVELDKRYQKADW 148

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           S    S E L YA  D   L  L  Q   +L++ GR
Sbjct: 149 SKRPFSQEMLDYAMKDTSLLIELYRQLEAELKQKGR 184


>gi|146279098|ref|YP_001169257.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17025]
 gi|145557339|gb|ABP71952.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17025]
          Length = 385

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 79/170 (46%), Gaps = 4/170 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDG--TVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           + +DTE L       +LC++Q++ PG     V +  + A   +   L  +   E   K+F
Sbjct: 23  VTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPVEAPDMSLEPLYDLFRHEPTVKVF 82

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H  R D+ + F    V   P+F T++A+ +   +  Q G +  +K++    + K  + +D
Sbjct: 83  HAARQDLEIFFVEGRVFPTPLFDTQVAAMVC-GFGEQVGYETLVKKIAREQLDKTSRFTD 141

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           WS   LSD Q  YA +DV HL  +    + ++++ GR          L D
Sbjct: 142 WSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGRQRWVEEELAILTD 191


>gi|295095587|emb|CBK84677.1| ribonuclease D [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 384

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 81/173 (46%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++Q+  G   V +I        AP +  +L+D    K
Sbjct: 29  REFPAIALDTEFVRTRTYYPQLGLIQMYDGK-HVSLIDPLGITDWAP-MRELLLDTAVTK 86

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V   TFG+  +P+  T+I +  +    +  G    ++E  G+ + K++  
Sbjct: 87  YLHAGSEDLEVFLNTFGIMPQPLIDTQILAAFSGRPLS-WGFAAMVEEYTGLTLDKSESR 145

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  L+  QL+YAA+DV +L  +  Q  ++ +  G    A   C     R
Sbjct: 146 TDWLARPLTARQLEYAAADVFYLLPIAGQLMKEAEASGWLSAALDECRMTQQR 198


>gi|298504558|gb|ADI83281.1| ribonuclease D, putative [Geobacter sulfurreducens KN400]
          Length = 381

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 73/165 (44%), Gaps = 4/165 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A D E   +   ++++C++Q +   G   I+   A    +P L  +  +    K+FH  
Sbjct: 30  VACDLEADSMHHYQEKVCLIQFA-VPGYAAIVDPLAAPDISP-LAPLFANAAIRKVFHGA 87

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +DI  L   FG+ V  +F T IA +L      + GL   L++  G+ + K  Q +DWS 
Sbjct: 88  DYDIRSLHRDFGMEVNNLFDTMIACQLL--GEREFGLAAQLRKRFGVELDKQYQRADWSR 145

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             L+   ++YA  D   L  L  Q    L+  GR       C  L
Sbjct: 146 RPLTPGMIEYAVKDTTLLIELCWQLATDLEAKGRRGWVEEECELL 190


>gi|13476899|ref|NP_108468.1| ribonuclease D [Mesorhizobium loti MAFF303099]
 gi|14027660|dbj|BAB53929.1| ribonuclease D [Mesorhizobium loti MAFF303099]
          Length = 383

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (45%), Gaps = 2/174 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++   G   +I   +   N      ++ +E   K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPILCLIQMA-APGVTALIDPLSPDINLAPFFRLMANEAVVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++ +   +   PVF T++A+ +   + +       ++ + G  + K+ + +DW
Sbjct: 80  AARQDIEIIVHLGDLVPHPVFDTQVAA-MVCGFGDSVSYDQLVQRITGARLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
               LSD+QL YA +DV HL  +    + +L R  R+       + L  R   D
Sbjct: 139 RHRPLSDKQLDYALADVTHLIEVYQHLSAELARENRAHWLNEEMDVLTSRETYD 192


>gi|197122666|ref|YP_002134617.1| 3'-5' exonuclease [Anaeromyxobacter sp. K]
 gi|196172515|gb|ACG73488.1| 3'-5' exonuclease [Anaeromyxobacter sp. K]
          Length = 288

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 72/143 (50%), Gaps = 10/143 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS--PGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+DTE+      R+R+C++QLS    D  VD I +          +G ++ + RE + H
Sbjct: 31  LALDTESNSFHVYRERVCLLQLSTRAQDFVVDPISVDV------RPLGEILCDGREVVLH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+  L   +G R+  +F T IA+R  R      GL   ++   G+ +SKA Q SDW
Sbjct: 85  GADYDVRCLHREYGWRIPRLFDTMIAAR--RLGRPGLGLSALVEAHFGVRLSKAFQRSDW 142

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
               L+ +QL YAA D   L  L
Sbjct: 143 GRRPLTPDQLAYAALDTHFLLPL 165


>gi|238762951|ref|ZP_04623918.1| Ribonuclease D [Yersinia kristensenii ATCC 33638]
 gi|238698709|gb|EEP91459.1| Ribonuclease D [Yersinia kristensenii ATCC 33638]
          Length = 373

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 80/177 (45%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 19  ARTYAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITQWQP----FRELLQDLN 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F +   P+  T++ +  + RT +   G    + E  G+ + K
Sbjct: 75  VVKYLHAGSEDLEVFLNAFDIMPTPMIDTQVLAAFSGRTLSC--GFAMLVNEFEGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 133 SESRTDWIARPLSEKQCDYAAADVFYLLPLATKLVEATEAAGRMDAAKDECELLCRR 189


>gi|319784197|ref|YP_004143673.1| ribonuclease D [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170085|gb|ADV13623.1| ribonuclease D [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 383

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (45%), Gaps = 2/174 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++   G   +I   A   +      ++ +E   K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPILCLIQMA-APGVTALIDPLAPDIDLKPFFRLMANEAVVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++ +   +   PVF T++A+ +   + +       ++ + G  + K+ + +DW
Sbjct: 80  AARQDIEIIVHLGDLVPHPVFDTQVAAMVC-GFGDSVSYDQLVQRITGARLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
               LSD+QL YA +DV HL  +    + +L+R  R+         L  R   D
Sbjct: 139 RHRPLSDKQLDYALADVTHLIEVYQHLSAELERENRAHWLNEEMEVLTSRETYD 192


>gi|56416471|ref|YP_153545.1| ribonuclease D [Anaplasma marginale str. St. Maries]
 gi|56387703|gb|AAV86290.1| ribonuclease D [Anaplasma marginale str. St. Maries]
          Length = 401

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 21  DAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           +++A+DTE +        RLC++Q++   G   ++ +   + +   L  +  DE   K+F
Sbjct: 26  ESLAIDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFDDEGIYKVF 84

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSS 138
           H  R D+  L   F    RP+F T+ AS L   + N  G    +++ LG+ ++K   +  
Sbjct: 85  HDCRQDLDALSQRFTRLPRPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKLNKLLFKRV 144

Query: 139 DWSADDLSDEQLQYAASDVVHLHAL 163
           DWS   LS+ +++YA  DV +LH L
Sbjct: 145 DWSHRPLSEGKVRYALDDVTYLHEL 169


>gi|332557401|ref|ZP_08411723.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
 gi|332275113|gb|EGJ20428.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
          Length = 385

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 87/193 (45%), Gaps = 6/193 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDG--TVDIIRI 56
           M TI   E  + A C AA+    + +DTE L       +LC++Q++ PG     V +  I
Sbjct: 1   MQTITTTEA-LAAFCEAAKAEPYVTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPI 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +   E   K+FH  R D+ + F        P+F T++A+ +   +  Q
Sbjct: 60  EGPDMSLEPLYDLFRHEATVKVFHAARQDLEIFFVEGRAFPVPLFDTQVAAMVC-GFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K++    + K  + +DWS   LSD Q  YA +DV HL  +    + ++++ GR
Sbjct: 119 VGYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGR 178

Query: 177 SDLATSCCNFLMD 189
                     L D
Sbjct: 179 QKWVEEELAILTD 191


>gi|260913969|ref|ZP_05920443.1| ribonuclease D [Pasteurella dagmatis ATCC 43325]
 gi|260632056|gb|EEX50233.1| ribonuclease D [Pasteurella dagmatis ATCC 43325]
          Length = 383

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 84/176 (47%), Gaps = 3/176 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+    +A+DTE + +     +L ++QL  G+  V +I   + Q  +P  + +L ++   
Sbjct: 30  AQQKSVVALDTEFVRIRTLYPQLGLIQLYDGE-RVSLIDPLSIQDFSP-FIALLANQNVL 87

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + +     P+  T+I +    ++ N  GL   ++    + I K   
Sbjct: 88  KVLHACSEDLEVFQHYYQQMPTPMIDTQIMASFL-SFPNSTGLATLIQHYFQLEIDKGAS 146

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            +DW A  LSD+QL YAA+DV +L  L  +  + LQ+        + C  L+ + E
Sbjct: 147 RTDWLARPLSDKQLVYAAADVWYLLPLYQRMQQDLQQTPWQSAVENDCEMLLAKRE 202


>gi|162452521|ref|YP_001614888.1| hypothetical protein sce4245 [Sorangium cellulosum 'So ce 56']
 gi|161163103|emb|CAN94408.1| rnd [Sorangium cellulosum 'So ce 56']
          Length = 403

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 76/173 (43%), Gaps = 14/173 (8%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLS--PGDGT----VDIIRIAAGQKNAPNLVGMLVDE 73
            DA+AVD E  GL   R RLC VQL+   GDG     VD +R+      AP L  +L   
Sbjct: 25  ADALAVDVEANGLFVYRPRLCTVQLAFREGDGIAVGIVDALRVPV----AP-LARLLGAA 79

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+ H   FD A +    G  +     T +A+R+        GL   L   L + + K
Sbjct: 80  GPPKVLHDLTFD-ARMLAEAGAPLGGAHDTSVAARMLGCAAT--GLGALLLSELDVKVDK 136

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
             Q  DW    + D +L+Y A DV HL  LR +  E+   LG  +     C +
Sbjct: 137 QLQQHDWGRRPIEDAELRYLADDVRHLLPLRARLAERSGALGIDEEIEEECAY 189


>gi|221638369|ref|YP_002524631.1| Ribonuclease D [Rhodobacter sphaeroides KD131]
 gi|221159150|gb|ACM00130.1| Ribonuclease D [Rhodobacter sphaeroides KD131]
          Length = 385

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 87/193 (45%), Gaps = 6/193 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDG--TVDIIRI 56
           M TI   E  + A C AA+    + +DTE L       +LC++Q++ PG     V +  I
Sbjct: 1   MQTITTTEA-LAAFCEAAKAEPYVTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPI 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +   E   K+FH  R D+ + F        P+F T++A+ +   +  Q
Sbjct: 60  EGPDMSLEPLYDLFRHEATVKVFHAARQDLEIFFVEGRAFPVPLFDTQVAAMVC-GFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K++    + K  + +DWS   LSD Q  YA +DV HL  +    + ++++ GR
Sbjct: 119 VGYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGR 178

Query: 177 SDLATSCCNFLMD 189
                     L D
Sbjct: 179 QKWVEEELAILTD 191


>gi|77462516|ref|YP_352020.1| ribonuclease D [Rhodobacter sphaeroides 2.4.1]
 gi|126461450|ref|YP_001042564.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17029]
 gi|77386934|gb|ABA78119.1| Ribonuclease D [Rhodobacter sphaeroides 2.4.1]
 gi|126103114|gb|ABN75792.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17029]
          Length = 385

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 87/193 (45%), Gaps = 6/193 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDG--TVDIIRI 56
           M TI   E  + A C AA+    + +DTE L       +LC++Q++ PG     V +  I
Sbjct: 1   MQTITTTEA-LAAFCEAAKAEPYVTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPI 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +   E   K+FH  R D+ + F        P+F T++A+ +   +  Q
Sbjct: 60  EGPDMSLEPLYDLFRHEATVKVFHAARQDLEIFFVEGRAFPVPLFDTQVAAMVC-GFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K++    + K  + +DWS   LSD Q  YA +DV HL  +    + ++++ GR
Sbjct: 119 VGYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGR 178

Query: 177 SDLATSCCNFLMD 189
                     L D
Sbjct: 179 QKWVEEELAILTD 191


>gi|254492081|ref|ZP_05105256.1| ribonuclease D [Methylophaga thiooxidans DMS010]
 gi|224462633|gb|EEF78907.1| ribonuclease D [Methylophaga thiooxydans DMS010]
          Length = 379

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 77/156 (49%), Gaps = 7/156 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+DTE         +LC++Q++  D    VD ++I     +   L+ +        +FH
Sbjct: 25  LAIDTEFHREKTYYPQLCLIQVANDDVIACVDPLKI----DDLSPLMDVFYRTDMTLVFH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R D+ +LF       + VF T++A+ +   Y +Q G  + +K+ L +++ KA   +DW
Sbjct: 81  AARQDLELLFLLRDALPQQVFDTQLAATVL-GYGDQIGYGNLVKQCLNVDLDKAHARTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
               LS EQ+ YAA DV +L  L  Q   KL   GR
Sbjct: 140 RQRPLSPEQIDYAADDVRYLRELYHQLEAKLVDTGR 175


>gi|197116637|ref|YP_002137064.1| ribonuclease D [Geobacter bemidjiensis Bem]
 gi|197085997|gb|ACH37268.1| ribonuclease D, putative [Geobacter bemidjiensis Bem]
          Length = 377

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 8/156 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPG--DGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A D E   L    +++C++Q+S    D  +D +     +  AP    +  +   +KIFH
Sbjct: 35  LAFDLEADSLHHYTEKVCLIQVSSTSEDRLIDPLAPIDVKVLAP----IFANPAIKKIFH 90

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+  L+  FG+ V  +F T IAS+      ++ GL   LK+  G+ + K  Q +DW
Sbjct: 91  GADYDMRSLYRDFGIEVVNLFDTMIASQFL--GESEFGLAALLKKRFGVELDKRYQKADW 148

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           S    S E L YA  D   L  L  Q   +L++ GR
Sbjct: 149 SKRPFSQEMLDYAMKDTSLLIELYRQLEAELKQKGR 184


>gi|222474840|ref|YP_002563255.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
 gi|222418976|gb|ACM48999.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
          Length = 386

 Score = 61.6 bits (148), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 21  DAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           +++A+DTE +        RLC++Q++   G   ++ +   + +   L  +  DE   K+F
Sbjct: 26  ESLAIDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFDDEGIYKVF 84

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSS 138
           H  R D+  L   F    RP+F T+ AS L   + N  G    +++ LG+ ++K   +  
Sbjct: 85  HDCRQDLDALSQRFTRLPRPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKLNKLLFKRV 144

Query: 139 DWSADDLSDEQLQYAASDVVHLHAL 163
           DWS   LS+ +++YA  DV +LH L
Sbjct: 145 DWSHRPLSEGKVRYALDDVTYLHEL 169


>gi|296101862|ref|YP_003612008.1| ribonuclease D [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295056321|gb|ADF61059.1| ribonuclease D [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 384

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++Q+  G     I  +  G  +   +  +L+D    K
Sbjct: 29  RDFPAIALDTEFVRTRTYYPQLGLIQMYDGKHVSLIDPL--GITDWTPMRDLLLDTAVTK 86

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V   TFG+  +P+  T+I +  +    +  G    ++E  G+ + K++  
Sbjct: 87  YLHAGSEDLEVFLNTFGIMPQPLIDTQILAAFSNRPLS-WGFAAMVEEYTGLTLDKSESR 145

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  L++ QL YAA+DV +L  +  Q  ++ +  G    A   C     R
Sbjct: 146 TDWLARPLTERQLDYAAADVFYLLPIAGQLMKEAEASGWLPAALDECRMTQQR 198


>gi|254994696|ref|ZP_05276886.1| ribonuclease D (rnd) [Anaplasma marginale str. Mississippi]
          Length = 386

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 21  DAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           +++A+DTE +        RLC++Q++   G   ++ +   + +   L  +  DE   K+F
Sbjct: 26  ESLAIDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFDDEGIYKVF 84

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSS 138
           H  R D+  L   F    RP+F T+ AS L   + N  G    +++ LG+ ++K   +  
Sbjct: 85  HDCRQDLDALSQRFTRLPRPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKLNKLLFKRV 144

Query: 139 DWSADDLSDEQLQYAASDVVHLHAL 163
           DWS   LS+ +++YA  DV +LH L
Sbjct: 145 DWSHRPLSEGKVRYALDDVTYLHEL 169


>gi|149191139|ref|ZP_01869398.1| ribonuclease D [Vibrio shilonii AK1]
 gi|148835067|gb|EDL52045.1| ribonuclease D [Vibrio shilonii AK1]
          Length = 289

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 83/180 (46%), Gaps = 15/180 (8%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR  D + +DTE + +     +L ++QL  G+    +D + I+    +    + +L D  
Sbjct: 19  ARESDVVMLDTEFVRIRTFYPKLGLIQLYDGEQLSLIDPLTIS----DFTPFIELLQDAS 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK----ELLGIN 130
             K+ H    D+ V   +FG    P+  T+I +         HGL         E LG+ 
Sbjct: 75  VLKVLHACGEDLEVFVNSFGCMPFPMVDTQIMAAFL-----GHGLSTGFAALVDEYLGVE 129

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           + K++  +DW A  L+D+QL YAA+DV +L  L  +   +++     D A    + LM +
Sbjct: 130 LDKSESRADWVARPLTDKQLDYAAADVYYLWPLYFKLFAQVEAKDWWDAAQQESDLLMQK 189


>gi|71032543|ref|XP_765913.1| hypothetical protein [Theileria parva strain Muguga]
 gi|68352870|gb|EAN33630.1| hypothetical protein TP01_0386 [Theileria parva]
          Length = 1786

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 56/196 (28%), Positives = 96/196 (48%), Gaps = 23/196 (11%)

Query: 22   AIAVDTETLGLMPRRDRLCIVQLS-PGDGT--VDIIRIAAGQKNAPNLV----------- 67
            A+ VD ET GL    +++ +VQLS P   +  +D+ +++    +A ++V           
Sbjct: 1221 AVGVDIETTGLDHNTNQIRLVQLSVPNQPSLIIDLFKLSTNNPDAESVVPGRNELIKCEW 1280

Query: 68   --GMLVDEKREKIFHYGRFDIAVLFYTFGVRVR-PVFCTKIASRL---TRTYTNQHGLKD 121
               +   ++  K+FH G+FDI  L   +G     P+F T +AS+L   +R  + +  L  
Sbjct: 1281 LKKLFKSKETVKVFHNGKFDINFL-RVYGFEFEGPIFDTMVASKLLVASRYISCK--LTH 1337

Query: 122  NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              +  L I + K QQ SDWS   L +EQL Y+A D   L  L +     L+    SD+A+
Sbjct: 1338 VSERYLNIVLDKTQQYSDWSTLQLFEEQLLYSARDSFVLLPLYVILEHLLKINNLSDIAS 1397

Query: 182  SCCNFLMDRAELDLLG 197
                 ++  ++++L G
Sbjct: 1398 VENKCILATSDMELNG 1413


>gi|328675812|gb|AEB28487.1| Ribonuclease D [Francisella cf. novicida 3523]
          Length = 364

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 11/153 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IAVDTE   +      LC+VQ++  +    +D ++     K    L  +  ++  +KI H
Sbjct: 22  IAVDTEFYWMRTYYPELCLVQIATENEIFLIDTLKDLDFSK----LKDIFENKDIQKIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I + K  Q SDW
Sbjct: 78  SATNDIPIIKRFFNCEVNNIFDTQLAAAFL-GFQTQSSLKTLLKEILDIEMEKESQFSDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQR 173
               L+ +QL YA  DV +L    +Q  E LQ+
Sbjct: 137 RNRPLTQKQLNYAIKDVEYL----IQLKEYLQQ 165


>gi|242239440|ref|YP_002987621.1| ribonuclease D [Dickeya dadantii Ech703]
 gi|242131497|gb|ACS85799.1| ribonuclease D [Dickeya dadantii Ech703]
          Length = 403

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 84/179 (46%), Gaps = 9/179 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR +  +A+DTE +       +L ++QL  G+    +D + I   Q        +L+D  
Sbjct: 48  ARRMPQVALDTEFVRTRTYYPQLGLIQLFDGERLSLIDPLSITVWQP----FCDLLLDPA 103

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    FG+   P   T+I  + L +  +  +G    + + + + + K
Sbjct: 104 VTKYLHAGSEDLEVFLNAFGLLPTPFVDTQILVAFLGKPLS--YGFAALVADYMQVTLDK 161

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           ++  +DW A  LS++Q QYAA+DV +L  + ++  E+    G  + A   C  L  R +
Sbjct: 162 SESRTDWLARPLSEKQCQYAAADVYYLLPMAIRLVEETTSAGWWEAALDECRQLCQRKQ 220


>gi|323137715|ref|ZP_08072791.1| ribonuclease D [Methylocystis sp. ATCC 49242]
 gi|322397012|gb|EFX99537.1| ribonuclease D [Methylocystis sp. ATCC 49242]
          Length = 393

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 77/154 (50%), Gaps = 2/154 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE L       ++C++Q++  +  V I  ++ G    P    ++ +    K+FH  
Sbjct: 23  VTVDTEFLRETTFWPKVCVIQIASPEEAVAIDALSEGIDLTP-FFSLMANADVVKVFHAA 81

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ +++    +   P+F T++A+ +   +  Q    + +K +   N+ K+ + +DWS 
Sbjct: 82  RQDLEIIWRLARLIPAPLFDTQVAAMVC-GFGEQASYLELVKAITRANLDKSSRFTDWSR 140

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS  Q+ YA +DV HL  +     ++L+R  R
Sbjct: 141 RPLSAAQIDYAIADVTHLRDIYTTLRQRLERSNR 174


>gi|283781120|ref|YP_003371875.1| 3'-5' exonuclease [Pirellula staleyi DSM 6068]
 gi|283439573|gb|ADB18015.1| 3'-5' exonuclease [Pirellula staleyi DSM 6068]
          Length = 399

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 76/158 (48%), Gaps = 5/158 (3%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
            + IA DTE +     +  LC++Q++  DG + II     Q  +P    +L +  RE + 
Sbjct: 22  AEIIAFDTEFVSEDSYQPELCLIQVA-ADGNLAIIDPLEVQDLSP-FWNLLTEPGRETLV 79

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISKAQQSS 138
           H GR +    F   G R    F  +IA+ L    +   +G     + L+G ++ K +  +
Sbjct: 80  HAGREEFRFCFKGAGRRPHKWFDVQIAAGLIGMEFPASYGTL--AQRLIGKSLPKDETRT 137

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           DW    LS  QL+YA  DV+ L  +R     KL++LGR
Sbjct: 138 DWRRRPLSQRQLEYALLDVLDLEQIRDVLVGKLEKLGR 175


>gi|304391965|ref|ZP_07373907.1| ribonuclease D [Ahrensia sp. R2A130]
 gi|303296194|gb|EFL90552.1| ribonuclease D [Ahrensia sp. R2A130]
          Length = 383

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 81/175 (46%), Gaps = 2/175 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE L        LC++Q++  D    +  +A G    P    ++ D    K+FH
Sbjct: 21  DYVTVDTEFLRETTFWPILCLIQIAGPDDECIVDPMADGIDLQP-FFELMADTSVVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R D+ ++++  G+  +P+F T++A+ +   Y +       +  + G  I K+ + +DW
Sbjct: 80  AARQDVEIVYHLGGLVPKPLFDTQVAAMVC-GYGDSVAYNALVSRITGGVIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           +   L+ +QL YA +DV HL  +       L++  R        + L +    DL
Sbjct: 139 ARRPLTTKQLDYALADVTHLRDVYQSLKADLEKKNRKHWVDEEMDVLTNPETYDL 193


>gi|71901132|ref|ZP_00683238.1| Ribonuclease D [Xylella fastidiosa Ann-1]
 gi|71729096|gb|EAO31221.1| Ribonuclease D [Xylella fastidiosa Ann-1]
          Length = 362

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 80/187 (42%), Gaps = 3/187 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +   D  A    R    I +DTE +        L +VQ++  D  + +  +  G  +A  
Sbjct: 5   IQHPDTLATWWDRKPTRIGMDTEFIREGTFWPELALVQIAIEDEILLVDPLVPGMTDALG 64

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      KI H    D+    Y  GV  RP+F T+I + LT       G +  + +
Sbjct: 65  L--WLAAPNVIKIMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGM-GYQKLVTK 121

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +  + + K +  SDW    L+  QL YAA+DV +L AL    TE+L  + RS      C 
Sbjct: 122 VTNVELGKGETRSDWMHRPLTPAQLDYAANDVRYLFALHDTLTERLAEMSRSAWLEEDCT 181

Query: 186 FLMDRAE 192
            L D  E
Sbjct: 182 RLTDNIE 188


>gi|220917449|ref|YP_002492753.1| 3'-5' exonuclease [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955303|gb|ACL65687.1| 3'-5' exonuclease [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 288

 Score = 61.2 bits (147), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 10/143 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS--PGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+DTE+      R+R+C++QLS    D  VD I +          +G ++ + RE + H
Sbjct: 31  LALDTESNSFHVYRERVCLLQLSTRAQDFVVDPISVDV------RPLGEILCDGREVVLH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+  L   +G R+  +F T IA+R  R      GL   ++   G+ +SKA Q SDW
Sbjct: 85  GADYDVRCLHREYGWRIPRLFDTMIAAR--RLGRPGLGLSALVEAHFGVRLSKAFQRSDW 142

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
               L+ +QL YA+ D   L  L
Sbjct: 143 GRRPLTPDQLAYASLDTHFLLPL 165


>gi|115372643|ref|ZP_01459950.1| 3'-5' exonuclease, putative [Stigmatella aurantiaca DW4/3-1]
 gi|115370364|gb|EAU69292.1| 3'-5' exonuclease, putative [Stigmatella aurantiaca DW4/3-1]
          Length = 379

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 6/154 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQL-SPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           +AVD E   +   R RLC +Q+ +P D  + +    A   +A  L  ++ D +R K FH 
Sbjct: 20  LAVDLEADSMHAFRARLCFLQVATPTD--IFLFDTLAPGVDASLLAPLMADPERTKYFHA 77

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            + D+  L    G+RVR +F T  A+ L      + GL D  +E LG+ + K  Q SD+S
Sbjct: 78  AQGDLQFLAEA-GIRVRGLFDTHRAATLL--GWPKVGLADIARERLGVELPKEHQQSDFS 134

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
              L  E  +Y A+DV +L  L  Q  E  +  G
Sbjct: 135 LRPLPPEMREYIANDVRYLCELGRQVREACRTAG 168


>gi|121601718|ref|YP_989156.1| ribonuclease D [Bartonella bacilliformis KC583]
 gi|120613895|gb|ABM44496.1| ribonuclease D [Bartonella bacilliformis KC583]
          Length = 391

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 80/165 (48%), Gaps = 14/165 (8%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R  D + VDTE +       +LC++QL+  + T  I  +       P    +++D+   K
Sbjct: 18  RNSDFVTVDTEFIRETTFWPQLCLIQLASPNSTALIDPMVPDIDLQP-FFDLMIDKNIVK 76

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK------ELLGINI 131
           +FH  R DI ++++   +   P+F T+IA  +        G  D++          G ++
Sbjct: 77  VFHAARQDIEIIYHLGRIIPFPLFDTQIAGAIC-------GFGDSISYDQIVYHCTGQHL 129

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            K+ + +DWS   LS++Q+ YA +DV +L  + L   ++L+   R
Sbjct: 130 DKSSRFTDWSCRPLSEKQILYALADVTYLRDVYLSLKKQLEESKR 174


>gi|254502050|ref|ZP_05114201.1| ribonuclease D [Labrenzia alexandrii DFL-11]
 gi|222438121|gb|EEE44800.1| ribonuclease D [Labrenzia alexandrii DFL-11]
          Length = 392

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 73/141 (51%), Gaps = 2/141 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE L       +LC++Q++  +    +  +A G    P    ++ D+   K+FH
Sbjct: 21  DYVTVDTEFLRETTFWPKLCVIQMAGTEMAFIVDALAEGLDLEP-FFDLMRDDSVTKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++++  G+   P+F T++A+ +   + +       + ++ G  I K+ + +DW
Sbjct: 80  AARQDIEIIYHLGGLIPAPLFDTQVAA-MVCGFGDSISYDQLVYKVTGARIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLH 161
           +   L+ +QL YA +DV HL 
Sbjct: 139 ARRPLTAKQLDYALADVTHLR 159


>gi|310823888|ref|YP_003956246.1| ribonuclease d [Stigmatella aurantiaca DW4/3-1]
 gi|309396960|gb|ADO74419.1| ribonuclease D [Stigmatella aurantiaca DW4/3-1]
          Length = 389

 Score = 60.8 bits (146), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 6/154 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQL-SPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           +AVD E   +   R RLC +Q+ +P D  + +    A   +A  L  ++ D +R K FH 
Sbjct: 30  LAVDLEADSMHAFRARLCFLQVATPTD--IFLFDTLAPGVDASLLAPLMADPERTKYFHA 87

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            + D+  L    G+RVR +F T  A+ L      + GL D  +E LG+ + K  Q SD+S
Sbjct: 88  AQGDLQFLAEA-GIRVRGLFDTHRAATLL--GWPKVGLADIARERLGVELPKEHQQSDFS 144

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
              L  E  +Y A+DV +L  L  Q  E  +  G
Sbjct: 145 LRPLPPEMREYIANDVRYLCELGRQVREACRTAG 178


>gi|288549752|ref|ZP_05968046.2| ribonuclease D [Enterobacter cancerogenus ATCC 35316]
 gi|288317705|gb|EFC56643.1| ribonuclease D [Enterobacter cancerogenus ATCC 35316]
          Length = 384

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 81/173 (46%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++Q+  G   V +I    G  +   +  +L+D    K
Sbjct: 29  RDFPAIALDTEFVRTRTYYPQLGLIQMYDGK-RVSLID-PLGITDWTPMRDLLLDTAVTK 86

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V   TFG+  +P+  T+I +  +    +  G    ++E  G+ + K++  
Sbjct: 87  YLHAGSEDLEVFLNTFGIMPQPLIDTQILAAFSNRPLS-WGFAAMVEEYTGLTLDKSESR 145

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  L+  QL+YAA+DV +L  +  Q  ++ +  G    A   C     R
Sbjct: 146 TDWLARPLTARQLEYAAADVFYLLPIAGQLMKESEASGWLSAALDECRMAQQR 198


>gi|315180685|gb|ADT87599.1| ribonuclease D [Vibrio furnissii NCTC 11218]
          Length = 371

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 77/159 (48%), Gaps = 3/159 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+  + +I   A  +  P  V +L D    
Sbjct: 19  ARDADVVMLDTEFVRTRTFYPQLGLIQLFDGEN-LSLIDPLAMDEMTP-FVELLQDTSVL 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI V   +FG    P+  T+I +     Y    G      +LL + + K++ 
Sbjct: 77  KVLHACGEDIEVFKTSFGCVPFPMVDTQIMAAFL-GYGLSTGFAALAHDLLNVELDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            +DW A  LS +QL+YAA+DV +L  +  Q  EK+ + G
Sbjct: 136 RTDWLARPLSQKQLEYAAADVFYLMPMYEQLLEKVTQAG 174


>gi|153823321|ref|ZP_01975988.1| ribonuclease D [Vibrio cholerae B33]
 gi|126519155|gb|EAZ76378.1| ribonuclease D [Vibrio cholerae B33]
          Length = 246

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 10  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 67

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 68  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 126

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 127 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWDAA 179


>gi|260768989|ref|ZP_05877923.1| ribonuclease D [Vibrio furnissii CIP 102972]
 gi|260617019|gb|EEX42204.1| ribonuclease D [Vibrio furnissii CIP 102972]
          Length = 397

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+  + +I   A  +  P  V +L D    
Sbjct: 45  ARDADVVMLDTEFVRTRTFYPQLGLIQLFDGEN-LSLIDPLAMDEMTP-FVELLQDTSVL 102

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI V   +FG    P+  T+I +     Y    G      +LL + + K++ 
Sbjct: 103 KVLHACGEDIEVFKTSFGCVPFPMVDTQIMAAFL-GYGLSTGFAALAHDLLNVELDKSES 161

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            +DW A  LS +QL+YAA+DV +L  +  Q  EK+ + G  + A
Sbjct: 162 RTDWLARPLSQKQLEYAAADVFYLMPMYEQLLEKVTQAGWWEAA 205


>gi|15837353|ref|NP_298041.1| ribonuclease D [Xylella fastidiosa 9a5c]
 gi|9105641|gb|AAF83561.1|AE003916_15 ribonuclease D [Xylella fastidiosa 9a5c]
          Length = 362

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 79/187 (42%), Gaps = 3/187 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +   D  A    R    I +DTE +        L +VQ++  D  + +  +  G  +A  
Sbjct: 5   IQHPDTLATWWDRKPTRIGMDTEFIRERTFWPELALVQIAIEDEILLVDPLVPGMTDALG 64

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      KI H    D+    Y  GV  RP+F T+I + LT       G +  +  
Sbjct: 65  L--WLAAPNVIKIMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGM-GYQKLVAT 121

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +  + + K +  SDW    L+  QL YAA+DV +L AL    TE+L  + RS      C 
Sbjct: 122 VTNVALEKGETRSDWMHRPLTPAQLDYAANDVRYLFALHDTLTERLAEMSRSAWLEEDCT 181

Query: 186 FLMDRAE 192
            L D  E
Sbjct: 182 RLTDNIE 188


>gi|227327782|ref|ZP_03831806.1| ribonuclease D [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 374

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 82/177 (46%), Gaps = 5/177 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +L ++QL  G+  + +I        AP    +L DE+  
Sbjct: 19  ARRFPQVALDTEFVRTRTYYPQLGLIQLYDGE-QLSLIDPLTITDWAP-FQALLRDEQVT 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           K  H G  D+ V    F     P   T+I A+ L +  +  +G    + + +G+ + K++
Sbjct: 77  KFLHAGSEDLEVFLNAFETLPTPFIDTQILAAFLGKPLS--YGFAALVADYMGVTLDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
             +DW A  LS++Q  YAA+DV +L  + +Q     +  G  + A   C  L  R +
Sbjct: 135 SRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVADTEAAGWMNAALDECLLLCQRKQ 191


>gi|15602571|ref|NP_245643.1| ribonuclease D [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720994|gb|AAK02790.1| Rnd [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 383

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 82/177 (46%), Gaps = 3/177 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           +A+    IA+DTE + +     +L ++QL  G+  V +I     Q  +P  + +L +   
Sbjct: 29  SAQQKAVIALDTEFVRIKTLYPQLGLIQLYDGE-RVSLIDPTTIQDFSP-FIALLANTAV 86

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V  ++F     P+  T+I +     + N  GL   ++    + I K  
Sbjct: 87  LKVLHACSEDLEVFQHSFNQLPTPMLDTQIMANFL-GFPNSTGLATLVQHYFQLEIDKGA 145

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
             +DW A  LSD QL YAA+DV +L  L  +  E L +    + A   C  L+ + E
Sbjct: 146 SRTDWLARPLSDNQLIYAAADVWYLLPLYQRMQEALAQTRWQEAAQQDCEALLLKRE 202


>gi|238794476|ref|ZP_04638085.1| Ribonuclease D [Yersinia intermedia ATCC 29909]
 gi|238726159|gb|EEQ17704.1| Ribonuclease D [Yersinia intermedia ATCC 29909]
          Length = 373

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 19  ARTHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITEWQP----FSELLQDLN 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T+I +  + RT +   G    + E  G+ + K
Sbjct: 75  VVKYLHAGSEDLEVFLNAFSRMPTPMIDTQILAAFSGRTLSC--GFAMLVNEFEGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 133 SESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAIDECQLLCRR 189


>gi|317048442|ref|YP_004116090.1| ribonuclease D [Pantoea sp. At-9b]
 gi|316950059|gb|ADU69534.1| ribonuclease D [Pantoea sp. At-9b]
          Length = 373

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 86/186 (46%), Gaps = 8/186 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV--DIIRIAAGQKNAPNLVGMLVDEK 74
           AR   A+A+DTE +       +L ++QL  G+  V  D + I+     AP  V +L D +
Sbjct: 19  ARQHSAVALDTEFVRTRTYYPQLGLIQLFDGEQLVLIDPLNIS---DWAP-FVALLRDTQ 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K  H G  D+ V  + FG    P+  T+I +       +  G    +     I + K+
Sbjct: 75  VTKFLHAGGEDLEVFLHRFGCLPDPMVDTQILAAFAGQPLSW-GFAAMVMHFNQIELDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
           +  +DW A  L+  Q +YAA+DV +L  +  Q   + +  G    A S C+ L  R  LD
Sbjct: 134 EARTDWLARPLTARQCEYAAADVAYLLPIAHQLVAQTEAAGHMAAALSECDILCQR-RLD 192

Query: 195 LLGWEN 200
           +L  E+
Sbjct: 193 VLAPED 198


>gi|153217090|ref|ZP_01950854.1| ribonuclease D [Vibrio cholerae 1587]
 gi|124113892|gb|EAY32712.1| ribonuclease D [Vibrio cholerae 1587]
          Length = 381

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDAA 187


>gi|153801848|ref|ZP_01956434.1| ribonuclease D [Vibrio cholerae MZO-3]
 gi|153829828|ref|ZP_01982495.1| ribonuclease D [Vibrio cholerae 623-39]
 gi|229515363|ref|ZP_04404823.1| ribonuclease D [Vibrio cholerae TMA 21]
 gi|229528995|ref|ZP_04418385.1| ribonuclease D [Vibrio cholerae 12129(1)]
 gi|124122620|gb|EAY41363.1| ribonuclease D [Vibrio cholerae MZO-3]
 gi|148874687|gb|EDL72822.1| ribonuclease D [Vibrio cholerae 623-39]
 gi|229332769|gb|EEN98255.1| ribonuclease D [Vibrio cholerae 12129(1)]
 gi|229348068|gb|EEO13027.1| ribonuclease D [Vibrio cholerae TMA 21]
          Length = 381

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDAA 187


>gi|238756989|ref|ZP_04618177.1| Ribonuclease D [Yersinia aldovae ATCC 35236]
 gi|238704819|gb|EEP97348.1| Ribonuclease D [Yersinia aldovae ATCC 35236]
          Length = 373

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 19  ARTHTHVALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPLPITQWQP----FRALLQDLS 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  + RT +   G    + E  GI + K
Sbjct: 75  VVKYLHAGSEDLEVFLNAFEQMPTPMIDTQVLAAFSGRTLSC--GFAMLVNEFEGIELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 133 SESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAIDECELLCRR 189


>gi|183599025|ref|ZP_02960518.1| hypothetical protein PROSTU_02469 [Providencia stuartii ATCC 25827]
 gi|188021240|gb|EDU59280.1| hypothetical protein PROSTU_02469 [Providencia stuartii ATCC 25827]
          Length = 374

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 80/174 (45%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A   D +A+DTE +       +L ++QL  G   V +I   +    +P    +L ++   
Sbjct: 19  ASEADWLALDTEFVRTRTYYPQLGLLQLYDGK-QVSLIDPLSISDFSP-FKALLTNKSLT 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + F     P+  T++ +     Y    G    + E LGI + K++ 
Sbjct: 77  KFLHAGSEDLEVFLHDFECVPEPMVDTQVIAAFL-GYPISCGFASLVSEYLGIELDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q QYA +DV++L  L     +K++  G    A   C   ++R
Sbjct: 136 RTDWLARPLSEKQCQYATADVLYLLPLAKILMQKVEESGYLSAALEECQRTVER 189


>gi|153826834|ref|ZP_01979501.1| ribonuclease D [Vibrio cholerae MZO-2]
 gi|149739355|gb|EDM53601.1| ribonuclease D [Vibrio cholerae MZO-2]
          Length = 381

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDAA 187


>gi|229521896|ref|ZP_04411313.1| ribonuclease D [Vibrio cholerae TM 11079-80]
 gi|229340821|gb|EEO05826.1| ribonuclease D [Vibrio cholerae TM 11079-80]
          Length = 381

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDAA 187


>gi|119775068|ref|YP_927808.1| ribonuclease D [Shewanella amazonensis SB2B]
 gi|119767568|gb|ABM00139.1| ribonuclease D [Shewanella amazonensis SB2B]
          Length = 371

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 80/160 (50%), Gaps = 11/160 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           + +DTE +       +L ++Q+  G+    +D + I    ++      +L +    K+ H
Sbjct: 26  LVLDTEFVRTRTYYAKLGLIQVYDGNTLALIDPLDI----QDLSGFWALLTNPNILKLVH 81

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL--KDNLKELLGINISKAQQSS 138
               D+ V      V+  P+F ++IA+ L+      HGL     ++E LG  + K +  +
Sbjct: 82  SCSEDLEVFARYGKVQPTPLFDSQIAAALSGM---GHGLGYAKLVEECLGQTLDKGESRT 138

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           DW    L+D QLQYAA+DV +L+ L  Q  +KL+ LGR D
Sbjct: 139 DWIKRPLTDAQLQYAANDVFYLYQLYPQLEQKLKTLGRFD 178


>gi|297579488|ref|ZP_06941416.1| ribonuclease D [Vibrio cholerae RC385]
 gi|297537082|gb|EFH75915.1| ribonuclease D [Vibrio cholerae RC385]
          Length = 381

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDAA 187


>gi|332161539|ref|YP_004298116.1| ribonuclease D [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318605521|emb|CBY27019.1| ribonuclease D [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325665769|gb|ADZ42413.1| ribonuclease D [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 373

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 81/177 (45%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 19  ARTHAHVALDTEFVRTRTYYPQLGLIQLYDGEKLSLIDPLPITQWQP----FRELLQDVS 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F +   P+  T++ +  + R+ +   G    + EL G+ + K
Sbjct: 75  VVKYLHAGSEDLEVFLNAFELMPTPMIDTQVLAAFSGRSLSC--GFAMLVNELEGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 133 SESRTDWIARPLSEKQCDYAAADVFYLLPLASKLVEATEAAGRMDAAKDECELLCRR 189


>gi|114768885|ref|ZP_01446511.1| ribonuclease D [alpha proteobacterium HTCC2255]
 gi|114549802|gb|EAU52683.1| ribonuclease D [alpha proteobacterium HTCC2255]
          Length = 386

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (46%), Gaps = 8/184 (4%)

Query: 10  DIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PG---DGTVDIIRIAAGQKNAPN 65
           D   +C+A   + + +DTE L       +LC+VQ++ PG   D  V I  ++      P 
Sbjct: 12  DFCKKCSA--YEYVTLDTEFLRERTYYSKLCLVQMAHPGNTEDSAVLIDPLSPDLSLDP- 68

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +  +    K+FH  R D+ + F    +   P F T++A+ +   +  Q G +  ++ 
Sbjct: 69  LYELFKNPNVVKVFHAARQDLEIFFIDKKIIPFPFFDTQVAAMVC-GFGEQVGYEKLVRS 127

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +    + K+ + +DWSA  LS++Q+ YA  DV +L  +    + K++   R         
Sbjct: 128 ICNEGLDKSSRFTDWSARPLSNKQMHYAIGDVTYLREIYEFLSNKIKNNKRQAWVEEELK 187

Query: 186 FLMD 189
            LMD
Sbjct: 188 ILMD 191


>gi|319948476|ref|ZP_08022610.1| 3'-5' exonuclease [Dietzia cinnamea P4]
 gi|319437843|gb|EFV92829.1| 3'-5' exonuclease [Dietzia cinnamea P4]
          Length = 412

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 80/170 (47%), Gaps = 7/170 (4%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           + IAVD E    +   +R  ++QL  PG+  + +     G+   P L  +L   +R  +F
Sbjct: 41  EPIAVDVERASGIRYSERAFLLQLRVPGEPALLVDPETPGRTVGP-LATVL--SQRPLLF 97

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H    D+  L    G+R   +  T++A R       +  L   + E LGI ++KA  ++D
Sbjct: 98  HAASQDLPSL-RELGIRPTALVDTELAGRFL--GIERVNLGAMISEHLGIGLAKAHSAAD 154

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           WS   L    L YAA DV+ LH L  +   +L  LGR +   + C  L+D
Sbjct: 155 WSRRPLPAAWLDYAAYDVLFLHELADEVLPRLDALGRREWFEAECRHLVD 204


>gi|329122266|ref|ZP_08250854.1| ribonuclease D [Haemophilus aegyptius ATCC 11116]
 gi|327473827|gb|EGF19244.1| ribonuclease D [Haemophilus aegyptius ATCC 11116]
          Length = 399

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 46  AQMKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLSNPKVL 103

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 104 KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSA-GLAKLAQQYLNIEIDKGAT 162

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 163 RTNWIKRPLSDIQLQYAAGDVWYLLPL 189


>gi|319898087|ref|YP_004136284.1| ribonuclease d [Haemophilus influenzae F3031]
 gi|317433593|emb|CBY81977.1| ribonuclease D [Haemophilus influenzae F3031]
          Length = 380

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 27  AQMKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLSNPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 85  KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSA-GLAKLAQQYLNIEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|293395838|ref|ZP_06640120.1| ribonuclease D [Serratia odorifera DSM 4582]
 gi|291421775|gb|EFE95022.1| ribonuclease D [Serratia odorifera DSM 4582]
          Length = 373

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 7/176 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    IA+DTE +       +L ++QL  G+    +D + I   Q      V +L D  
Sbjct: 19  ARKHAQIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPIKQWQP----FVDLLADSA 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K  H G  D+ V    F     P+  T+I +  T    +  G    + + + + + K+
Sbjct: 75  VVKFLHAGSEDLEVFLNAFNTLPTPLVDTQILAAFTGKPLS-CGFATLVAQYMQVELDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q  YAA+DV +L  +  Q  ++ ++ G +  A+S C  L  R
Sbjct: 134 ESRTDWLARPLTERQCVYAAADVFYLLPMARQLVQETEQAGWTAAASSECLLLCQR 189


>gi|15641986|ref|NP_231618.1| ribonuclease D [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591319|ref|ZP_01678609.1| ribonuclease D [Vibrio cholerae 2740-80]
 gi|147675516|ref|YP_001217510.1| ribonuclease D [Vibrio cholerae O395]
 gi|153819311|ref|ZP_01971978.1| ribonuclease D [Vibrio cholerae NCTC 8457]
 gi|227082111|ref|YP_002810662.1| ribonuclease D [Vibrio cholerae M66-2]
 gi|229507927|ref|ZP_04397432.1| ribonuclease D [Vibrio cholerae BX 330286]
 gi|229511838|ref|ZP_04401317.1| ribonuclease D [Vibrio cholerae B33]
 gi|229518974|ref|ZP_04408417.1| ribonuclease D [Vibrio cholerae RC9]
 gi|229607472|ref|YP_002878120.1| ribonuclease D [Vibrio cholerae MJ-1236]
 gi|254849070|ref|ZP_05238420.1| ribonuclease D [Vibrio cholerae MO10]
 gi|298497984|ref|ZP_07007791.1| ribonuclease D [Vibrio cholerae MAK 757]
 gi|9656525|gb|AAF95132.1| ribonuclease D [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121546819|gb|EAX56983.1| ribonuclease D [Vibrio cholerae 2740-80]
 gi|126510131|gb|EAZ72725.1| ribonuclease D [Vibrio cholerae NCTC 8457]
 gi|146317399|gb|ABQ21938.1| ribonuclease D [Vibrio cholerae O395]
 gi|227009999|gb|ACP06211.1| ribonuclease D [Vibrio cholerae M66-2]
 gi|227013881|gb|ACP10091.1| ribonuclease D [Vibrio cholerae O395]
 gi|229343663|gb|EEO08638.1| ribonuclease D [Vibrio cholerae RC9]
 gi|229351803|gb|EEO16744.1| ribonuclease D [Vibrio cholerae B33]
 gi|229355432|gb|EEO20353.1| ribonuclease D [Vibrio cholerae BX 330286]
 gi|229370127|gb|ACQ60550.1| ribonuclease D [Vibrio cholerae MJ-1236]
 gi|254844775|gb|EET23189.1| ribonuclease D [Vibrio cholerae MO10]
 gi|297542317|gb|EFH78367.1| ribonuclease D [Vibrio cholerae MAK 757]
          Length = 381

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWDAA 187


>gi|229523996|ref|ZP_04413401.1| ribonuclease D [Vibrio cholerae bv. albensis VL426]
 gi|229337577|gb|EEO02594.1| ribonuclease D [Vibrio cholerae bv. albensis VL426]
          Length = 381

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMLDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDAA 187


>gi|108805947|ref|YP_645884.1| DNA-directed DNA polymerase [Rubrobacter xylanophilus DSM 9941]
 gi|108767190|gb|ABG06072.1| DNA-directed DNA polymerase [Rubrobacter xylanophilus DSM 9941]
          Length = 582

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (46%), Gaps = 14/181 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           + +D E  GL P   R+ ++QL+ G  T  VD+  +         L G  +     K+ H
Sbjct: 30  VGLDIEATGLSPLDARMRLLQLAAGGETFVVDVFEVKDLSPLREALEGGPL-----KVLH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI----NISKAQQ 136
             ++D + L    G+R+ P+F T +A++L      + G   +L+ + G      + K  +
Sbjct: 85  NAKYDYSFLLAQHGIRLSPLFDTMLAAQLLD--GGEQGPSYSLEAVAGRYLQETVDKTAR 142

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
             DWS  +LS EQL+YAA D   L  L  +  E L+R G   ++      +   AE++L 
Sbjct: 143 REDWS-KELSREQLEYAARDAAILLPLHERLQELLEREGLGPVSRIEFGAVPAIAEMELA 201

Query: 197 G 197
           G
Sbjct: 202 G 202


>gi|148978262|ref|ZP_01814780.1| ribonuclease D [Vibrionales bacterium SWAT-3]
 gi|145962563|gb|EDK27840.1| ribonuclease D [Vibrionales bacterium SWAT-3]
          Length = 372

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 11/178 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+ T+ +I   A  +  P  VG+L D    
Sbjct: 19  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGE-TLSLIDPIALDEMTP-FVGLLKDASVL 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGINIS 132
           K+ H    D+ V    F     P+  T+I +         HGL       + E +G+++ 
Sbjct: 77  KVLHACGEDLEVFQNAFDCTPTPMVDTQIMAAFL-----GHGLSTGFAALVSEFVGVDLD 131

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           K++  +DW A  LS +QL YAA+DV +L  +  +  EK+   G  + A    +  + R
Sbjct: 132 KSESRTDWLARPLSQKQLDYAAADVHYLMPMYNKLLEKVMEAGWWEAAQQESDLQVAR 189


>gi|77457615|ref|YP_347120.1| ribonuclease D [Pseudomonas fluorescens Pf0-1]
 gi|77381618|gb|ABA73131.1| putative ribonuclease [Pseudomonas fluorescens Pf0-1]
          Length = 377

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 73/158 (46%), Gaps = 21/158 (13%)

Query: 23  IAVDTETLGLMPRRDRLCIVQ--LSPGDGT----VDIIRIAAGQKNAPNLVGMLVDEKRE 76
           +A+DTE +    R D    +   L  GDG     +D + I A Q     L  +L +    
Sbjct: 27  VALDTEFM----RVDTFYPIAGLLQVGDGKRAYLIDPLTINAWQP----LAALLENPAVL 78

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+LGI + K
Sbjct: 79  KVLHACSEDLEVLLRLTGSLPAPLFDTQLAA----AYLNLGFSMGYSRLVQEVLGIELPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
            +  SDW    LSD Q+ YAA D VHL  + +Q   KL
Sbjct: 135 GETRSDWLQRPLSDTQISYAAEDAVHLAEVFVQLRPKL 172


>gi|57239422|ref|YP_180558.1| ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|58579394|ref|YP_197606.1| ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|57161501|emb|CAH58427.1| putative exonuclease [Ehrlichia ruminantium str. Welgevonden]
 gi|58418020|emb|CAI27224.1| Ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
          Length = 389

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 73/143 (51%), Gaps = 3/143 (2%)

Query: 23  IAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           IAVDTE +        RL ++Q++  +G   +I + A   +   L  +  +++  KIFH 
Sbjct: 27  IAVDTEFIRNCNEYYPRLSLIQIAWSEGKC-VIDVLADDIDLSVLESIFYNKEIVKIFHD 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSSDW 140
            + DI  L   F     P+F ++IA+     Y N  G    + + L +++ K   + S+W
Sbjct: 86  CKQDIDALLTKFPRIPYPIFDSQIAAMFCAYYDNAVGYSKLVAQFLDVSLDKLTLKRSNW 145

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
               LSD+++QYA  DVV+L+ L
Sbjct: 146 LMRPLSDDKIQYALDDVVYLYEL 168


>gi|84999262|ref|XP_954352.1| DNA polymerase i [Theileria annulata]
 gi|65305350|emb|CAI73675.1| DNA polymerase i, putative [Theileria annulata]
          Length = 1786

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 56/196 (28%), Positives = 93/196 (47%), Gaps = 23/196 (11%)

Query: 22   AIAVDTETLGLMPRRDRLCIVQLS-PGDGTV--DIIRIAAGQKNAPNLV----------- 67
            A+ VD ET GL    +++ +VQLS P   +V  D+ ++      + N+V           
Sbjct: 1221 AVGVDIETTGLDHNTNQIRLVQLSVPNQPSVIIDLFKLNTNNPESDNVVPGRNELIKCEW 1280

Query: 68   --GMLVDEKREKIFHYGRFDIAVLFYTFGVRVR-PVFCTKIASRL---TRTYTNQHGLKD 121
               +   +   K+FH G+FDI  L   +G     P+F T +AS+L   +R  + +  L  
Sbjct: 1281 LKNLFKSKDTVKVFHNGKFDINFL-RVYGFEFEGPIFDTMVASKLLVASRYISCK--LTH 1337

Query: 122  NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              +  L I + K QQ SDWS   L +EQL Y+A D   L  L +     L+    +D+A+
Sbjct: 1338 VSERYLNIVLDKTQQYSDWSTLQLFEEQLLYSARDSFVLLPLYVILEHLLKINNLADIAS 1397

Query: 182  SCCNFLMDRAELDLLG 197
                 ++  ++++L G
Sbjct: 1398 VENKCILATSDMELNG 1413


>gi|260466883|ref|ZP_05813067.1| ribonuclease D [Mesorhizobium opportunistum WSM2075]
 gi|259029385|gb|EEW30677.1| ribonuclease D [Mesorhizobium opportunistum WSM2075]
          Length = 383

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 2/174 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE +        LC++Q++   G   +I   +   +      ++ +E   K+FH
Sbjct: 21  DFVTVDTEFIRETTFWPILCLIQMA-APGVTALIDPLSSDIDLRPFFKLMANEAVVKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++ +   +   PVF T++A+ +   + +       ++ + G  + K+ + +DW
Sbjct: 80  AARQDIEIIVHLGDLVPHPVFDTQVAAMVC-GFGDSVSYDQLVQRITGARLDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
               LSD+QL YA +DV HL  +      +L R  R+       + L  R   D
Sbjct: 139 RHRPLSDKQLDYALADVTHLIEVYQHLNAELARENRAHWLNEEMDVLTSRETYD 192


>gi|16272339|ref|NP_438552.1| ribonuclease D [Haemophilus influenzae Rd KW20]
 gi|1173094|sp|P44442|RND_HAEIN RecName: Full=Ribonuclease D; Short=RNase D
 gi|1573361|gb|AAC22048.1| ribonuclease D (rnd) [Haemophilus influenzae Rd KW20]
          Length = 399

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 46  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGEH-VSLIDPLAITDFSP-FVALLANPKVL 103

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L + I K   
Sbjct: 104 KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSA-GLAKLAQQYLNVEIDKGAT 162

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 163 RTNWIKRPLSDIQLQYAAGDVWYLLPL 189


>gi|168698136|ref|ZP_02730413.1| ribonuclease D [Gemmata obscuriglobus UQM 2246]
          Length = 435

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 77/172 (44%), Gaps = 3/172 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +  DTE +G    R  LC+VQ+S  +    I     G  +      +L+D KR  + H G
Sbjct: 35  VGFDTEFVGEDAYRPELCLVQVSTAEQLFVIDPFECGSLD--GFWDLLLDRKRTVVVHAG 92

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ + ++  G     VF  +IA+ L    T   G    + +LL   + K +  +DW  
Sbjct: 93  REDVRMCYFQAGSAPPNVFDVQIAAGLV-GLTYPIGYAGLVHDLLRQRMQKGETLTDWRQ 151

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
             L+  Q++YA  DV +L     + TE+L++  R   A       + RA  D
Sbjct: 152 RPLTPAQVRYAYDDVRYLLPAHRKLTERLKKYRRLPWAEEEFAAAVKRAVAD 203


>gi|148827593|ref|YP_001292346.1| ribonuclease D [Haemophilus influenzae PittGG]
 gi|148718835|gb|ABQ99962.1| ribonuclease D [Haemophilus influenzae PittGG]
          Length = 401

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 46  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLANPKVL 103

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 104 KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTS-AGLAKLAQQYLNIEIDKGAT 162

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 163 LTNWIKRPLSDIQLQYAAGDVWYLLPL 189


>gi|154253761|ref|YP_001414585.1| ribonuclease D [Parvibaculum lavamentivorans DS-1]
 gi|154157711|gb|ABS64928.1| ribonuclease D [Parvibaculum lavamentivorans DS-1]
          Length = 427

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 80/167 (47%), Gaps = 2/167 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC++QL+     + +  +A     AP    ++ +    K+FH  
Sbjct: 66  VTVDTEFMRDATFWPILCLIQLAGPSDELIVDPLAPDLDLAP-FYALMKNRNVVKVFHAA 124

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R DI +  +       P+F T++A+ +   + +  G +  +++L G ++ K+ + +DWS 
Sbjct: 125 RQDIEIFCHEGKAIPDPLFDTQVAAMVC-GFGDSVGYETLVRKLAGGSVDKSSRFTDWSR 183

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
             LSD+QLQYA +DV +L  +     ++L    R+         L D
Sbjct: 184 RPLSDKQLQYAMADVTYLRTIYEVLAKRLTHTKRAHWVAEEMAVLQD 230


>gi|260580546|ref|ZP_05848374.1| ribonuclease D [Haemophilus influenzae RdAW]
 gi|260092888|gb|EEW76823.1| ribonuclease D [Haemophilus influenzae RdAW]
          Length = 399

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 46  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGEH-VSLIDPLAITDFSP-FVALLANPKVL 103

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L + I K   
Sbjct: 104 KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSA-GLAKLAQQYLNVEIDKGAT 162

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 163 RTNWIKRPLSDIQLQYAAGDVWYLLPL 189


>gi|255745267|ref|ZP_05419216.1| ribonuclease D [Vibrio cholera CIRS 101]
 gi|262155992|ref|ZP_06029112.1| ribonuclease D [Vibrio cholerae INDRE 91/1]
 gi|255737097|gb|EET92493.1| ribonuclease D [Vibrio cholera CIRS 101]
 gi|262030170|gb|EEY48814.1| ribonuclease D [Vibrio cholerae INDRE 91/1]
          Length = 373

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 10  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 67

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 68  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 126

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 127 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWDAA 179


>gi|229844446|ref|ZP_04464586.1| ribonuclease D [Haemophilus influenzae 6P18H1]
 gi|229812695|gb|EEP48384.1| ribonuclease D [Haemophilus influenzae 6P18H1]
          Length = 399

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 46  AQQQSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLANPKVL 103

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 104 KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTS-AGLAKLAQQYLNIEIDKGAT 162

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 163 LTNWIKRPLSDIQLQYAAGDVWYLLPL 189


>gi|121729927|ref|ZP_01682350.1| ribonuclease D [Vibrio cholerae V52]
 gi|121628334|gb|EAX60840.1| ribonuclease D [Vibrio cholerae V52]
          Length = 350

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 10  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 67

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 68  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 126

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 127 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWDAA 179


>gi|229846478|ref|ZP_04466586.1| ribonuclease D [Haemophilus influenzae 7P49H1]
 gi|229810571|gb|EEP46289.1| ribonuclease D [Haemophilus influenzae 7P49H1]
          Length = 380

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 27  AQQQSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLSNPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 85  KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFIGLGTS-AGLAKLAQQYLNIEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|294055851|ref|YP_003549509.1| Ribonuclease D [Coraliomargarita akajimensis DSM 45221]
 gi|293615184|gb|ADE55339.1| Ribonuclease D [Coraliomargarita akajimensis DSM 45221]
          Length = 386

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 80/170 (47%), Gaps = 2/170 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+ VDTE +        L +VQL   DG  ++I     +  +P L  ++ D    KI H 
Sbjct: 20  AVGVDTEFVWDRTYYPTLGVVQLGYPDGHCELIDAPEIEDWSP-LAELMSDPNVVKILHD 78

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            + D+ +L    G   + +F T++ +      ++   L+D LK LL + ++K +  SDW 
Sbjct: 79  AQQDLTILRRVCGSDPKTIFDTQLTAGFI-GLSSTISLRDILKTLLKVRLAKTETQSDWV 137

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           A  L++ Q++YA  DV     L  Q  ++   LGR +   +   +  D A
Sbjct: 138 ARPLTEAQIKYAEDDVRDSVRLMEQILKRADALGRREWIENEMTYYEDAA 187


>gi|301156355|emb|CBW15826.1| ribonuclease D [Haemophilus parainfluenzae T3T1]
          Length = 383

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 70/144 (48%), Gaps = 3/144 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE + +     +L ++QL  G+  V +I   +    +P  V +L D+   
Sbjct: 27  ARQQSAVALDTEFMRVSTYYPKLGLIQLYDGE-RVSLIDPLSITDFSP-FVELLRDQLVT 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    +P+  T+I +R    + N  GL   +   LGI + K   
Sbjct: 85  KILHACNEDLLVFLQEFDALPQPMMDTQIMARFL-GFANSAGLAKLVLHYLGIEMDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHL 160
            ++W    LS  QLQYAA DV +L
Sbjct: 144 RTNWLKRPLSPVQLQYAAGDVWYL 167


>gi|116747862|ref|YP_844549.1| 3'-5' exonuclease [Syntrophobacter fumaroxidans MPOB]
 gi|116696926|gb|ABK16114.1| 3'-5' exonuclease [Syntrophobacter fumaroxidans MPOB]
          Length = 295

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 74/164 (45%), Gaps = 6/164 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE+       DR+C++Q+S  +   D I      K+   L  +  + + EK+ H  
Sbjct: 26  LAVDTESNSFYAYFDRVCLIQISSPER--DYIIDPLSLKDLSVLGRLFENPRIEKVLHAA 83

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+  L   F  R   +F T IA +L      Q GL   L+   G++++K  Q  DW  
Sbjct: 84  SNDVLGLRRDFQFRFNGLFDTAIACKLLGY--KQLGLSKILETHFGVSLNKRWQRYDWGK 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
             L  +QL YA  D  +L ALR      LQ   R   A +C  F
Sbjct: 142 RPLVPDQLDYARLDTHYLIALRHMLAADLQ--SRELWAEACEAF 183


>gi|271500522|ref|YP_003333547.1| ribonuclease D [Dickeya dadantii Ech586]
 gi|270344077|gb|ACZ76842.1| ribonuclease D [Dickeya dadantii Ech586]
          Length = 373

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 83/188 (44%), Gaps = 5/188 (2%)

Query: 4   IRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           I   EG + A CA A  V  +A+DTE +       +L ++QL  GD    I  +A    N
Sbjct: 6   ITTDEG-LSAVCALACAVSEVALDTEFVRTRTYYPQLGLIQLYDGDNLSLIDPLAI--SN 62

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
                 +L + +  K  H G  D+ V    FG    P   T+I +   R     +G    
Sbjct: 63  WEPFRALLQNPQVTKYLHAGSEDLEVFLNAFGCLPSPFIDTQILAAF-RGKPLSYGFAAL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           + +   I + K++  +DW A  LS++Q QYAA+DV +L  +     E+ +  G  + A  
Sbjct: 122 VADYRQIVLDKSESRTDWLARPLSEKQCQYAAADVFYLLPVARVLVEETRLAGWMEAALD 181

Query: 183 CCNFLMDR 190
            C  L  R
Sbjct: 182 ECQLLCQR 189


>gi|322417808|ref|YP_004197031.1| 3'-5' exonuclease [Geobacter sp. M18]
 gi|320124195|gb|ADW11755.1| 3'-5' exonuclease [Geobacter sp. M18]
          Length = 377

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 72/154 (46%), Gaps = 4/154 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A D E   L    +++C++Q+S       I  +A    +   L  +  +   +KIFH  
Sbjct: 35  LAFDLEADSLHHYTEKVCLIQVSSESENRLIDPLAP--IDVRVLAPIFANPAIKKIFHGA 92

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +D+  L+  FG+ V  +F T IAS+      ++ GL   LK+  G+ + K  Q +DWS 
Sbjct: 93  DYDMRSLYRDFGIEVVNLFDTMIASQFL--GESEFGLAALLKKRFGVELDKRYQKADWSK 150

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
              S E L+YA  D   L  L  Q   +L   GR
Sbjct: 151 RPFSQEMLEYAMKDTSLLIELYRQLEAELLAKGR 184


>gi|85059311|ref|YP_455013.1| ribonuclease D [Sodalis glossinidius str. 'morsitans']
 gi|84779831|dbj|BAE74608.1| ribonuclease D [Sodalis glossinidius str. 'morsitans']
          Length = 380

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 78/170 (45%), Gaps = 7/170 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +AVDTE +       +L ++Q+  G+    +D + I   Q      + +L DE+  K+ H
Sbjct: 26  VAVDTEFVRTCTYYPQLGLIQMFDGEALTLIDPLAITDWQP----FIALLADEQVTKLLH 81

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+ V +++FG    P+  T++ +  T    +  G    + E L + + K +  +DW
Sbjct: 82  ACSEDLEVFWHSFGQMPVPMIDTQVLAAFTGRALS-CGFAALVAETLDVTLDKTESRTDW 140

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  LS  Q  YAA+DV  L  +  +   + Q+ G    A+  C  +  R
Sbjct: 141 LARPLSKRQCDYAAADVYWLLPMAHKLIAQTQQAGWWSQASQECEAICQR 190


>gi|269959116|ref|YP_003328905.1| ribonuclease D [Anaplasma centrale str. Israel]
 gi|269848947|gb|ACZ49591.1| ribonuclease D [Anaplasma centrale str. Israel]
          Length = 389

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 21  DAIAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           +++AVDTE +        RLC++Q++   G   ++ +   + +   L  +  DE   K+F
Sbjct: 26  ESLAVDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFDDEGICKVF 84

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSS 138
           H  R D+  L   F    +P+F T+ AS L   + N  G    +++ LG+ ++K   +  
Sbjct: 85  HDCRQDLDALSQRFLRLPKPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKLNKLLFKRV 144

Query: 139 DWSADDLSDEQLQYAASDVVHLHAL 163
           DWS   LS+ +++YA  DV +LH L
Sbjct: 145 DWSHRPLSEGKVRYALDDVTYLHEL 169


>gi|238751610|ref|ZP_04613100.1| Ribonuclease D [Yersinia rohdei ATCC 43380]
 gi|238710172|gb|EEQ02400.1| Ribonuclease D [Yersinia rohdei ATCC 43380]
          Length = 394

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        ++ D  
Sbjct: 40  ARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITQWQP----FRELIQDLN 95

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  + R+ +   G    + E  G+ + K
Sbjct: 96  VVKYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAFSGRSLSC--GFAMLVNEFEGVELDK 153

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   CN L  R
Sbjct: 154 SESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAIDECNLLCRR 210


>gi|260582345|ref|ZP_05850138.1| ribonuclease D [Haemophilus influenzae NT127]
 gi|260094713|gb|EEW78608.1| ribonuclease D [Haemophilus influenzae NT127]
          Length = 380

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 71/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G   V +I   A    +P  V +L + K  
Sbjct: 27  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGKH-VSLIDPLAITDFSP-FVALLANPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 85  KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSA-GLAKLAQQYLNIEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|71275157|ref|ZP_00651444.1| Ribonuclease D [Xylella fastidiosa Dixon]
 gi|71163966|gb|EAO13681.1| Ribonuclease D [Xylella fastidiosa Dixon]
          Length = 362

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 79/187 (42%), Gaps = 3/187 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +   D  A    R    I +DTE +        L +VQ++  D  + +  +  G  +A  
Sbjct: 5   IQHPDTLATWWDRKPTRIGMDTEFIREGTFWPELALVQIAIEDEILLVDPLVPGMTDALG 64

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      KI H    D+    Y  GV  RP+F T+I + LT       G +  + +
Sbjct: 65  L--WLAAPNVIKIMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGM-GYQKLVAK 121

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +  + + K +  SDW    L+  QL YAA+DV +L  L    TE+L  + RS      C 
Sbjct: 122 VTNVELGKGETRSDWMHRPLTPAQLDYAANDVRYLFVLHDTLTERLAEMSRSAWLEEDCT 181

Query: 186 FLMDRAE 192
            L D  E
Sbjct: 182 RLTDNIE 188


>gi|68248994|ref|YP_248106.1| ribonuclease D [Haemophilus influenzae 86-028NP]
 gi|68057193|gb|AAX87446.1| ribonuclease D [Haemophilus influenzae 86-028NP]
          Length = 380

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 71/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL   D  V +I   A    +P  V +L + K  
Sbjct: 27  AQMKSAVALDTEFMRVSTYFPKLGLIQLY-DDERVSLIDPLAITDFSP-FVALLSNPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 85  KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTS-AGLAKLAQQYLNIEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|82543793|ref|YP_407740.1| ribonuclease D [Shigella boydii Sb227]
 gi|81245204|gb|ABB65912.1| RNase D [Shigella boydii Sb227]
          Length = 375

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    FG   +P+  T+I S       +  G    ++E  G+ + K++
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPMS-WGFASMVEEYSGVTLDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 135 SRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|187733914|ref|YP_001880596.1| ribonuclease D [Shigella boydii CDC 3083-94]
 gi|187430906|gb|ACD10180.1| ribonuclease D [Shigella boydii CDC 3083-94]
          Length = 375

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 4/179 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    FG   +P+  T+I S       +  G    ++E  G+ + K++
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPMS-WGFASMVEEYSGVTLDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-MDRAEL 193
             +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  + M R E+
Sbjct: 135 SRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMRRQEV 193


>gi|157145434|ref|YP_001452753.1| ribonuclease D [Citrobacter koseri ATCC BAA-895]
 gi|157082639|gb|ABV12317.1| hypothetical protein CKO_01177 [Citrobacter koseri ATCC BAA-895]
          Length = 371

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I     G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHVALID--PHGITDWSPLRAVLRDTAI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V   TFG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNTFGELPQPLIDTQILAAFCGRPLS--WGFAAMVEEFTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITKKLMVETEASGWLPAALDECRLMQQR 185


>gi|170731148|ref|YP_001776581.1| ribonuclease D [Xylella fastidiosa M12]
 gi|167965941|gb|ACA12951.1| ribonuclease D [Xylella fastidiosa M12]
          Length = 362

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 79/187 (42%), Gaps = 3/187 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +   D  A    R    I +DTE +        L +VQ++  D  + +  +  G  +A  
Sbjct: 5   IQHPDTLATWWDRKPTRIGMDTEFIREGTFWPELALVQIAIEDEILLVDPLVPGMTDALG 64

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      KI H    D+    Y  GV  RP+F T+I + LT       G +  + +
Sbjct: 65  L--WLAAPNVIKIMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGM-GYQKLVAK 121

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +  + + K +  SDW    L+  QL YAA+DV +L  L    TE+L  + RS      C 
Sbjct: 122 VTNVELGKGETRSDWMHRPLTPAQLDYAANDVRYLFVLHDTLTERLAEMSRSAWLEEDCT 181

Query: 186 FLMDRAE 192
            L D  E
Sbjct: 182 RLTDNIE 188


>gi|320183816|gb|EFW58649.1| Ribonuclease D [Shigella flexneri CDC 796-83]
 gi|332096395|gb|EGJ01392.1| ribonuclease D [Shigella boydii 3594-74]
          Length = 371

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    FG   +P+  T+I S       +  G    ++E  G+ + K++
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPMS-WGFASMVEEYSGVTLDKSE 130

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 131 SRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|123442616|ref|YP_001006593.1| ribonuclease D [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122089577|emb|CAL12426.1| ribonuclease D [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 373

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 19  ARTHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITQWQP----FRELLQDLN 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F +   P+  T++ +  + R+ +   G    + E  G+ + K
Sbjct: 75  VVKYLHAGSEDLEVFLNAFELMPTPMIDTQVLAAFSGRSLSC--GFAMLVNEFEGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 133 SESRTDWIARPLSEKQCDYAAADVFYLLPLATKLVEATEAAGRMDAAKDECELLCRR 189


>gi|320173702|gb|EFW48889.1| Ribonuclease D [Shigella dysenteriae CDC 74-1112]
          Length = 371

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPAI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    FG   +P+  T+I S       +  G    ++E  G+ + K++
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPMS-WGFASMVEEYSGVTLDKSE 130

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 131 SRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|78224579|ref|YP_386326.1| 3'-5' exonuclease [Geobacter metallireducens GS-15]
 gi|78195834|gb|ABB33601.1| 3'-5' exonuclease [Geobacter metallireducens GS-15]
          Length = 382

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PG-DGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A D E   +   ++++C++Q + PG    VD + +A     AP    +  +    K+FH
Sbjct: 30  VACDLEADSMHHYQEKVCLIQFTVPGLAAIVDPLAVADLAPLAP----VFANPSIRKVFH 85

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +DI  L   FG+ V  +F T IA +       + GL   L++  G+ + K  Q +DW
Sbjct: 86  GADYDIRSLHRDFGIEVNNLFDTMIACQFL--GEREFGLAAVLRKRFGVELDKQYQRADW 143

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           S   L+   ++YAA D   L  L  +   +L+  GR       C  L
Sbjct: 144 SRRPLTAGMIEYAAKDTTLLIELCGRLEAELREKGRIGWVEEECALL 190


>gi|302335597|ref|YP_003800804.1| ribonuclease D [Olsenella uli DSM 7084]
 gi|301319437|gb|ADK67924.1| ribonuclease D [Olsenella uli DSM 7084]
          Length = 376

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 70/151 (46%), Gaps = 7/151 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+DTE L       RLC++Q +  D    +D I I     +   L  +L DE   K+FH
Sbjct: 22  LAIDTEFLRERTYFPRLCLIQAATPDESAAIDPILI----DDLSPLARLLTDESITKVFH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+ V++        P+F T++A+     +  Q G    +    G+ + KA+  +DW
Sbjct: 78  ACSQDLEVIYDALHCVPGPIFDTQLAAAFL-GHRQQIGYGALVDACCGVRLPKAESLTDW 136

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
           S   L  EQL YA  DV +L  +  Q   +L
Sbjct: 137 SRRPLDAEQLAYAEDDVRYLPGIYDQMMAEL 167


>gi|58617449|ref|YP_196648.1| ribonuclease D [Ehrlichia ruminantium str. Gardel]
 gi|58417061|emb|CAI28174.1| Ribonuclease D [Ehrlichia ruminantium str. Gardel]
          Length = 389

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 72/143 (50%), Gaps = 3/143 (2%)

Query: 23  IAVDTETL-GLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           IAVDTE +        RL ++Q++   G   +I + A   +   L  +  +++  KIFH 
Sbjct: 27  IAVDTEFIRNCNEYYPRLSLIQIAWSKGKC-VIDVLADDIDLSVLESIFYNKEIVKIFHD 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ-QSSDW 140
            + DI  L   F     P+F ++IA+     Y N  G    + + L +++ K   + S+W
Sbjct: 86  CKQDIDALLTKFPRIPYPIFDSQIAAMFCAYYDNAVGYSKLVAQFLDVSLDKLTLKRSNW 145

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
               LSD+++QYA  DVV+L+ L
Sbjct: 146 LMRPLSDDKIQYALDDVVYLYEL 168


>gi|319775680|ref|YP_004138168.1| ribonuclease D [Haemophilus influenzae F3047]
 gi|317450271|emb|CBY86487.1| ribonuclease D [Haemophilus influenzae F3047]
          Length = 380

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 27  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLSNPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V    F    RP+  T+I +R     T+  GL    ++ L I I K   
Sbjct: 85  KVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTS-AGLAKLAQQYLNIEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|261209844|ref|ZP_05924146.1| ribonuclease D [Vibrio sp. RC341]
 gi|260841142|gb|EEX67662.1| ribonuclease D [Vibrio sp. RC341]
          Length = 398

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 4/168 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 35  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVMDEMTP-FV 92

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 93  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 151

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G
Sbjct: 152 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAG 199


>gi|194468559|ref|ZP_03074543.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205358811|ref|ZP_02659348.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|194454923|gb|EDX43762.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205331760|gb|EDZ18524.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
          Length = 375

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D + 
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTEI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|237755371|ref|ZP_04583999.1| DNA polymerase I [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692455|gb|EEP61435.1| DNA polymerase I [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 586

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 73/150 (48%), Gaps = 6/150 (4%)

Query: 37  DRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVR 96
           D++ ++Q+   + T  I  +    +   N +  L+ E +  I H  +FD+  L     + 
Sbjct: 43  DKIRLIQIGDEENTFVIDLLKINPEVVKNHIQNLI-ENKGIIGHNLKFDLKFLKTNLNIL 101

Query: 97  VRPVFCTKIASRLTRTYTN--QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAA 154
            + VF T IAS++     N  +H L  + K  + +++ K  Q S W A DLS EQ++YAA
Sbjct: 102 PKIVFDTMIASQILAKGDNSQRHSLSASAKRFVSLDVDKTYQKSPWWAKDLSPEQIEYAA 161

Query: 155 SDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            D+    ALR  F E+  +L + +L     
Sbjct: 162 KDI---DALRHLFKEEKNQLNQDNLHKKAS 188


>gi|213865181|ref|ZP_03387300.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
          Length = 200

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 3   AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 60

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 61  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 118

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 119 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 174


>gi|188996542|ref|YP_001930793.1| DNA-directed DNA polymerase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931609|gb|ACD66239.1| DNA-directed DNA polymerase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 587

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 74/150 (49%), Gaps = 6/150 (4%)

Query: 37  DRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVR 96
           D++ ++Q+   + T  I  +    +   N +  L+ E +  I H  +FD+  L     + 
Sbjct: 44  DKIRLIQIGDEENTFVIDLLKINPEVVKNHIQNLI-ENKGIIGHNLKFDLKFLKTNLNIL 102

Query: 97  VRPVFCTKIASR-LTRTYTNQ-HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAA 154
            + VF T IAS+ L +  +NQ H L  + K  + +++ K  Q S W A DLS EQ++YAA
Sbjct: 103 PKIVFDTMIASQILAKGDSNQRHSLSASAKRFVSLDVDKTYQKSPWWAKDLSSEQIEYAA 162

Query: 155 SDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            D+     LR  F E+  +L + +L     
Sbjct: 163 KDI---DTLRHLFKEEKNQLNQDNLHKKAS 189


>gi|331683306|ref|ZP_08383907.1| ribonuclease D [Escherichia coli H299]
 gi|331079521|gb|EGI50718.1| ribonuclease D [Escherichia coli H299]
          Length = 371

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 83/180 (46%), Gaps = 6/180 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-MDRAEL 193
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  + M R E+
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMRRQEI 189


>gi|238897738|ref|YP_002923417.1| RNase D, processes tRNA precursor [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229465495|gb|ACQ67269.1| RNase D, processes tRNA precursor [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 387

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 77/169 (45%), Gaps = 3/169 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+A+DTE +        L ++QL  G   V +I      + AP    +L ++K  K  H 
Sbjct: 35  AVALDTEFVRTKTYYAELGLIQLYDGH-RVSLIDPFLITEWAP-FYCLLKNKKIVKFLHS 92

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              DI + F+ F     P+  ++I +  T    +  G    +KE  GI ++KA+  +DW 
Sbjct: 93  AGEDIEIFFHFFKTLPEPLIDSQILAAFTGRPVSC-GFSILVKEFQGIVLNKAESRTDWL 151

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           A  LS +Q  YAA DV +L  L     +K++  G  +     C  L  R
Sbjct: 152 ARPLSQKQCDYAAEDVFYLLPLANALMKKIETSGWMEAVKEECELLCQR 200


>gi|205357935|ref|ZP_02574364.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205328669|gb|EDZ15433.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|323130091|gb|ADX17521.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
          Length = 390

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 33  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 90

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 91  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 148

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 149 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 204


>gi|145628753|ref|ZP_01784553.1| ribonuclease D [Haemophilus influenzae 22.1-21]
 gi|144979223|gb|EDJ88909.1| ribonuclease D [Haemophilus influenzae 22.1-21]
          Length = 399

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V ++   A    +P  V +L + K  
Sbjct: 46  AQMKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLVDPLAITDFSP-FVALLSNPKVL 103

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R     T+  GL    ++ L + I K   
Sbjct: 104 KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSA-GLAKLAQQYLNVEIDKGAT 162

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 163 RTNWIKRPLSDIQLQYAAGDVWYLLPL 189


>gi|313238124|emb|CBY13222.1| unnamed protein product [Oikopleura dioica]
          Length = 354

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 81/174 (46%), Gaps = 8/174 (4%)

Query: 14  ECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
           E A R  D+   A+DTE   L   R+ LC++Q S   G   +I     +  +P  +G  +
Sbjct: 13  EQAGRGSDSPVCAIDTEADSLHRYRESLCLIQFS-AKGESVLIDPLVIEDLSP--LGSYL 69

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
            E      H   +D+ +    FG   + V+ T+I +RL      + GL D +    G+ +
Sbjct: 70  SEA-TVWMHGADYDMTMFKRQFGDLPKVVYDTQIGARLL--GARRFGLGDLVSLYFGVEL 126

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           SK+ Q +DW    LS + ++YA +DV +L  +      KL+ LGR +     C 
Sbjct: 127 SKSSQKADWGKRPLSPKMIEYALNDVHYLLEMGDLIVTKLKDLGRYEWFLESCT 180


>gi|254286913|ref|ZP_04961865.1| ribonuclease D [Vibrio cholerae AM-19226]
 gi|150423063|gb|EDN15012.1| ribonuclease D [Vibrio cholerae AM-19226]
          Length = 381

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 4/168 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAG 182


>gi|213648384|ref|ZP_03378437.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
          Length = 371

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|16765158|ref|NP_460773.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|194448143|ref|YP_002045863.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197262566|ref|ZP_03162640.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205358997|ref|ZP_02666341.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|16420349|gb|AAL20732.1| RNase D [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|194406447|gb|ACF66666.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197240821|gb|EDY23441.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205339484|gb|EDZ26248.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|261247002|emb|CBG24819.1| Ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267993774|gb|ACY88659.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158341|emb|CBW17840.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|332988704|gb|AEF07687.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 375

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|30062942|ref|NP_837113.1| ribonuclease D [Shigella flexneri 2a str. 2457T]
 gi|56479892|ref|NP_707318.2| ribonuclease D [Shigella flexneri 2a str. 301]
 gi|30041191|gb|AAP16920.1| RNase D [Shigella flexneri 2a str. 2457T]
 gi|56383443|gb|AAN43025.2| RNase D [Shigella flexneri 2a str. 301]
 gi|313649164|gb|EFS13598.1| ribonuclease D [Shigella flexneri 2a str. 2457T]
 gi|332758877|gb|EGJ89192.1| ribonuclease D [Shigella flexneri 2747-71]
 gi|332762455|gb|EGJ92720.1| ribonuclease D [Shigella flexneri 4343-70]
 gi|332767130|gb|EGJ97325.1| ribonuclease D [Shigella flexneri 2930-71]
 gi|333004261|gb|EGK23792.1| ribonuclease D [Shigella flexneri K-218]
          Length = 371

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRVFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|170717427|ref|YP_001784527.1| ribonuclease D [Haemophilus somnus 2336]
 gi|168825556|gb|ACA30927.1| ribonuclease D [Haemophilus somnus 2336]
          Length = 381

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 81/172 (47%), Gaps = 4/172 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+    IA+DTE +       +L ++QL  G+  V +I        +P  + +L ++K  
Sbjct: 30  AQQKTVIALDTEFVRTKSFYPKLGLIQLYDGE-QVSLIDPFELNDFSP-FIQLLANQKVT 87

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + F     P+  T+I +   + + N  GL   LK    + I K   
Sbjct: 88  KVLHACSEDLEVFQHYFQQLPTPMLDTQIMAAFLQ-HGNSIGLATLLKHYFKLEIDKGIS 146

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSDLATSCCNFL 187
            ++W A  LSD QL YAA+DV +L  L  +  +KL Q   +S +   C N L
Sbjct: 147 RTNWLARPLSDVQLHYAAADVWYLLPLYQRMQQKLAQTSWQSAVQNDCENLL 198


>gi|213052594|ref|ZP_03345472.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213419335|ref|ZP_03352401.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
 gi|213426609|ref|ZP_03359359.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213609541|ref|ZP_03369367.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|289828970|ref|ZP_06546670.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
          Length = 371

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|161613674|ref|YP_001587639.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161363038|gb|ABX66806.1| hypothetical protein SPAB_01399 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|322616813|gb|EFY13721.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618052|gb|EFY14944.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625723|gb|EFY22542.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626173|gb|EFY22983.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633779|gb|EFY30519.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322638933|gb|EFY35626.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640751|gb|EFY37401.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644138|gb|EFY40683.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649210|gb|EFY45648.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655369|gb|EFY51677.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660875|gb|EFY57106.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662828|gb|EFY59035.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668012|gb|EFY64171.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322674226|gb|EFY70320.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675419|gb|EFY71493.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322683166|gb|EFY79182.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686859|gb|EFY82837.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195248|gb|EFZ80428.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200159|gb|EFZ85245.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323203843|gb|EFZ88861.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207397|gb|EFZ92345.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213750|gb|EFZ98532.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217380|gb|EGA02099.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220925|gb|EGA05358.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323224700|gb|EGA08971.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231403|gb|EGA15516.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235843|gb|EGA19922.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240412|gb|EGA24455.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245305|gb|EGA29305.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323246673|gb|EGA30645.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253527|gb|EGA37355.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323263330|gb|EGA46866.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266778|gb|EGA50264.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323268984|gb|EGA52440.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|110641921|ref|YP_669651.1| ribonuclease D [Escherichia coli 536]
 gi|300981914|ref|ZP_07175784.1| ribonuclease D [Escherichia coli MS 200-1]
 gi|110343513|gb|ABG69750.1| ribonuclease D [Escherichia coli 536]
 gi|300307392|gb|EFJ61912.1| ribonuclease D [Escherichia coli MS 200-1]
 gi|324011590|gb|EGB80809.1| ribonuclease D [Escherichia coli MS 60-1]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|152978783|ref|YP_001344412.1| ribonuclease D [Actinobacillus succinogenes 130Z]
 gi|150840506|gb|ABR74477.1| ribonuclease D [Actinobacillus succinogenes 130Z]
          Length = 383

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 80/174 (45%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I        +P    +L D    
Sbjct: 27  AQQKSAVALDTEFIRIRSYYPKLGLIQLYDGE-RVSLIDPTTITDFSP-FTALLADINVI 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + F     P+  T++ +     + +  GL   ++  L + I K   
Sbjct: 85  KVLHACYEDLEVFSHYFQQLPEPIMDTQVMAGFL-AFPHSTGLASLIRHYLALEIDKGAS 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++QLQYAA+DV +L  L  +   +L +          C  L+++
Sbjct: 144 RTDWLARPLSEKQLQYAAADVWYLLPLYEKMAVELAKTRWQSAVEFDCGLLLEK 197


>gi|293410113|ref|ZP_06653689.1| ribonuclease D [Escherichia coli B354]
 gi|291470581|gb|EFF13065.1| ribonuclease D [Escherichia coli B354]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLSAALDECRLMQMR 185


>gi|294635861|ref|ZP_06714315.1| ribonuclease D [Edwardsiella tarda ATCC 23685]
 gi|291090794|gb|EFE23355.1| ribonuclease D [Edwardsiella tarda ATCC 23685]
          Length = 376

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 81/171 (47%), Gaps = 9/171 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +A+DTE +       +L +VQL  G+    +D + I+  Q      V +L + +  K+ H
Sbjct: 30  VALDTEFVRTRTYYPQLGLVQLYDGETLSLIDPLPISDWQP----FVDLLRNPQVVKLLH 85

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISKAQQSSD 139
            G  D+ V  + F    +P+  T+I +  T R  ++  G    +   LG+ + K++  +D
Sbjct: 86  AGSEDLEVFLHDFQTLPQPLIDTQILAAFTGRPLSS--GFAAMVNAYLGVELDKSESRTD 143

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           W A  LS+ Q  YAA+DV +L  +  Q   +++  G    A   C  L  R
Sbjct: 144 WLARPLSERQCDYAAADVYYLLPMAHQLLAEVEGCGWLPAALDECQALCRR 194


>gi|300938850|ref|ZP_07153558.1| ribonuclease D [Escherichia coli MS 21-1]
 gi|300456240|gb|EFK19733.1| ribonuclease D [Escherichia coli MS 21-1]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|261343835|ref|ZP_05971480.1| ribonuclease D [Providencia rustigianii DSM 4541]
 gi|282568219|gb|EFB73754.1| ribonuclease D [Providencia rustigianii DSM 4541]
          Length = 373

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 77/168 (45%), Gaps = 3/168 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +       +L ++QL  G+  V +I        +P    +L +  + K  H G
Sbjct: 25  LALDTEFVRTRTYYPQLGLLQLYDGN-QVSLIDPLLMTDFSP-FKALLTNPNQLKFLHAG 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V  + FG    P+  T+I +     Y    G    + E LGI + K++  +DW A
Sbjct: 83  SEDLEVFIHDFGCVPEPMIDTQIVAAFL-GYPISCGFATLVVEHLGIELDKSESRTDWLA 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             LS +Q  YA +DV++L  L     EK+   G  D A   C  ++ R
Sbjct: 142 RPLSAKQCDYATADVLYLLPLAKILMEKVTEAGYLDDAKDECQRVVAR 189


>gi|194445618|ref|YP_002041074.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|200390008|ref|ZP_03216619.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|194404281|gb|ACF64503.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|199602453|gb|EDZ00999.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
          Length = 375

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|16760707|ref|NP_456324.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29141535|ref|NP_804877.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|25289178|pir||AB0725 ribonuclease D [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503004|emb|CAD05500.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29137162|gb|AAO68726.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 375

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|309788586|ref|ZP_07683188.1| ribonuclease D [Shigella dysenteriae 1617]
 gi|308923613|gb|EFP69118.1| ribonuclease D [Shigella dysenteriae 1617]
          Length = 275

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    FG   +P+  T+I +       +  G    ++E  G+ + K++
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS-WGFASMVEEYSGVTLDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 135 SRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|170680016|ref|YP_001743442.1| ribonuclease D [Escherichia coli SMS-3-5]
 gi|218699628|ref|YP_002407257.1| ribonuclease D [Escherichia coli IAI39]
 gi|170517734|gb|ACB15912.1| ribonuclease D [Escherichia coli SMS-3-5]
 gi|218369614|emb|CAR17383.1| ribonuclease D [Escherichia coli IAI39]
          Length = 375

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|56413264|ref|YP_150339.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197362190|ref|YP_002141827.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56127521|gb|AAV77027.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197093667|emb|CAR59137.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRTCPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|323152955|gb|EFZ39224.1| ribonuclease D [Escherichia coli EPECa14]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|191171723|ref|ZP_03033270.1| ribonuclease D [Escherichia coli F11]
 gi|190908053|gb|EDV67645.1| ribonuclease D [Escherichia coli F11]
 gi|284921723|emb|CBG34795.1| ribonuclease D [Escherichia coli 042]
          Length = 375

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|229897495|ref|ZP_04512651.1| Ribonuclease D [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229693832|gb|EEO83881.1| Ribonuclease D [Yersinia pestis biovar Orientalis str. PEXU2]
          Length = 308

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    IA+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 32  ARTHAHIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITEWQP----FRALLQDLN 87

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  + R+ +   G    + E  G+ + K
Sbjct: 88  VVKYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAFSGRSLSC--GFAMLVAEFEGVELDK 145

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 146 SESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAKDECLLLCRR 202


>gi|312912807|dbj|BAJ36781.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224451|gb|EFX49514.1| Ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|110805403|ref|YP_688923.1| ribonuclease D [Shigella flexneri 5 str. 8401]
 gi|110614951|gb|ABF03618.1| RNase D, processes tRNA precursor [Shigella flexneri 5 str. 8401]
 gi|281600843|gb|ADA73827.1| RNase D [Shigella flexneri 2002017]
 gi|332759595|gb|EGJ89901.1| ribonuclease D [Shigella flexneri K-671]
 gi|333018392|gb|EGK37691.1| ribonuclease D [Shigella flexneri K-304]
          Length = 375

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRVFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|145636341|ref|ZP_01792010.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittHH]
 gi|145270506|gb|EDK10440.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittHH]
          Length = 382

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  + +L + K  
Sbjct: 27  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FIALLANPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V    F    RP+  T+I +R     T+  GL    ++ L + I K   
Sbjct: 85  KVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTS-AGLAKLAQQYLNVEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|323186982|gb|EFZ72300.1| ribonuclease D [Escherichia coli RN587/1]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|192361069|ref|YP_001982899.1| ribonuclease D [Cellvibrio japonicus Ueda107]
 gi|190687234|gb|ACE84912.1| ribonuclease D [Cellvibrio japonicus Ueda107]
          Length = 378

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 81/176 (46%), Gaps = 7/176 (3%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKR 75
           R   AIAVDTE +          ++Q+  G G   +D + IA  Q     L  +L+D K 
Sbjct: 24  RQQGAIAVDTEFMRTDTFYPIAGLLQIGDGKGCYLIDPLAIADWQP----LRELLLDGKV 79

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V      +   P+F T+I +          G  + +K LLGI I K +
Sbjct: 80  IKVLHSCSEDLEVFQRWLDLVPSPLFDTQIGAAFANLGFG-LGYANLVKTLLGIEIPKDE 138

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             SDW    LS  QL+YAA DV H+  +  +  + L+   R +   S C  L+++A
Sbjct: 139 TRSDWLQRPLSQSQLKYAALDVAHMLVVYGKLLQILKTSQRLEWVKSDCADLVEQA 194


>gi|285018846|ref|YP_003376557.1| ribonuclease d protein [Xanthomonas albilineans GPE PC73]
 gi|283474064|emb|CBA16565.1| probable ribonuclease d protein [Xanthomonas albilineans]
          Length = 361

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 77/165 (46%), Gaps = 3/165 (1%)

Query: 13  AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVD 72
           AE  A+    I +DTE +       +L +VQ++  +  + I  +  G   A  L   L D
Sbjct: 12  AERLAQRPARIGLDTEFVRERTYWPQLALVQMAVAEEILLIDPLIPGMPQA--LAPWLSD 69

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
               KI H    D+       G   RP+F T+IA+ L        G +  + ++ GI+++
Sbjct: 70  PGILKIMHSASEDLVTFKCACGTLPRPLFDTQIAAGLAGIGAGM-GYQKLVLDITGIHLT 128

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           K +  SDW    LS  QL+YAA DV HL AL      +LQ L RS
Sbjct: 129 KGETRSDWLRRPLSPAQLEYAADDVRHLFALHDTLHARLQALDRS 173


>gi|90419527|ref|ZP_01227437.1| ribonuclease D [Aurantimonas manganoxydans SI85-9A1]
 gi|90336464|gb|EAS50205.1| ribonuclease D [Aurantimonas manganoxydans SI85-9A1]
          Length = 385

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 78/173 (45%), Gaps = 2/173 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + VDTE +        LC++Q++  D  V +  +A G   AP    ++ DE+  K+FH  
Sbjct: 25  VTVDTEFIRETTFWPELCLIQMASDDLAVLVDPLADGLDLAP-FFDLMRDERIVKVFHAA 83

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
           R D+ ++     +   P+F T++A+ +   +         +       I K  + +DW  
Sbjct: 84  RQDVEIIHKLGDIIPVPLFDTQVAAMVC-GFGESIAYDQLVARTTDGRIDKTSRFTDWRR 142

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             LSD+QL YA +DV +L  +    + +L   GR+         L D A  DL
Sbjct: 143 RPLSDQQLAYALADVTYLRDVYRFLSAQLAEKGRTRWVDEEMAVLTDPATYDL 195


>gi|170770112|ref|ZP_02904565.1| ribonuclease D [Escherichia albertii TW07627]
 gi|170121069|gb|EDS90000.1| ribonuclease D [Escherichia albertii TW07627]
          Length = 375

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVRYLLPITTKLMAETEASGWLPAALDECRLMQIR 189


>gi|117623964|ref|YP_852877.1| ribonuclease D [Escherichia coli APEC O1]
 gi|227885769|ref|ZP_04003574.1| ribonuclease D [Escherichia coli 83972]
 gi|237705754|ref|ZP_04536235.1| ribonuclease D [Escherichia sp. 3_2_53FAA]
 gi|300994259|ref|ZP_07180813.1| ribonuclease D [Escherichia coli MS 45-1]
 gi|301050852|ref|ZP_07197705.1| ribonuclease D [Escherichia coli MS 185-1]
 gi|306814949|ref|ZP_07449105.1| ribonuclease D [Escherichia coli NC101]
 gi|312967002|ref|ZP_07781220.1| ribonuclease D [Escherichia coli 2362-75]
 gi|331657844|ref|ZP_08358806.1| ribonuclease D [Escherichia coli TA206]
 gi|115513088|gb|ABJ01163.1| Ribonuclease D [Escherichia coli APEC O1]
 gi|222033551|emb|CAP76292.1| ribonuclease D [Escherichia coli LF82]
 gi|226900511|gb|EEH86770.1| ribonuclease D [Escherichia sp. 3_2_53FAA]
 gi|227837342|gb|EEJ47808.1| ribonuclease D [Escherichia coli 83972]
 gi|300297490|gb|EFJ53875.1| ribonuclease D [Escherichia coli MS 185-1]
 gi|300406325|gb|EFJ89863.1| ribonuclease D [Escherichia coli MS 45-1]
 gi|305851597|gb|EFM52050.1| ribonuclease D [Escherichia coli NC101]
 gi|307553822|gb|ADN46597.1| ribonuclease D [Escherichia coli ABU 83972]
 gi|307626717|gb|ADN71021.1| ribonuclease D [Escherichia coli UM146]
 gi|312288466|gb|EFR16368.1| ribonuclease D [Escherichia coli 2362-75]
 gi|312946400|gb|ADR27227.1| ribonuclease D [Escherichia coli O83:H1 str. NRG 857C]
 gi|315286519|gb|EFU45954.1| ribonuclease D [Escherichia coli MS 110-3]
 gi|315290392|gb|EFU49767.1| ribonuclease D [Escherichia coli MS 153-1]
 gi|315299924|gb|EFU59162.1| ribonuclease D [Escherichia coli MS 16-3]
 gi|323952305|gb|EGB48178.1| ribonuclease D [Escherichia coli H252]
 gi|323956433|gb|EGB52175.1| ribonuclease D [Escherichia coli H263]
 gi|323978014|gb|EGB73100.1| ribonuclease D [Escherichia coli TW10509]
 gi|324007181|gb|EGB76400.1| ribonuclease D [Escherichia coli MS 57-2]
 gi|331056092|gb|EGI28101.1| ribonuclease D [Escherichia coli TA206]
          Length = 371

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|300904667|ref|ZP_07122502.1| ribonuclease D [Escherichia coli MS 84-1]
 gi|301305900|ref|ZP_07211983.1| ribonuclease D [Escherichia coli MS 124-1]
 gi|300403417|gb|EFJ86955.1| ribonuclease D [Escherichia coli MS 84-1]
 gi|300838826|gb|EFK66586.1| ribonuclease D [Escherichia coli MS 124-1]
 gi|315257385|gb|EFU37353.1| ribonuclease D [Escherichia coli MS 85-1]
 gi|323180583|gb|EFZ66128.1| ribonuclease D [Escherichia coli 1180]
          Length = 371

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|260855663|ref|YP_003229554.1| ribonuclease D [Escherichia coli O26:H11 str. 11368]
 gi|257754312|dbj|BAI25814.1| ribonuclease D [Escherichia coli O26:H11 str. 11368]
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|15802217|ref|NP_288240.1| ribonuclease D [Escherichia coli O157:H7 EDL933]
 gi|12515844|gb|AAG56793.1|AE005403_4 RNase D, processes tRNA precursor [Escherichia coli O157:H7 str.
           EDL933]
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|108760811|ref|YP_634116.1| putative ribonuclease D [Myxococcus xanthus DK 1622]
 gi|108464691|gb|ABF89876.1| putative ribonuclease D [Myxococcus xanthus DK 1622]
          Length = 389

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 72/150 (48%), Gaps = 7/150 (4%)

Query: 14  ECAARYVDA---IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGML 70
           E A R ++A   IAVD E   +   R RLC +QL+  D    +  +  G      L  ++
Sbjct: 18  ESATRTLEAAREIAVDLEADSMHAFRARLCFLQLATDDQVFLLDTLQPGVVPG-MLAPLM 76

Query: 71  VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGIN 130
            D  R K FH  + D+  L    GVRV+ +F T  A+ L      + GL D  +E LG+ 
Sbjct: 77  ADPARTKFFHAAQGDLQFL-AEVGVRVQGLFDTHRAATLL--GWPKVGLADLARERLGVE 133

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHL 160
           + K  Q SD+S   L     +Y A+DV +L
Sbjct: 134 LPKEHQQSDFSIRPLPPGMREYIANDVRYL 163


>gi|16129758|ref|NP_416318.1| ribonuclease D [Escherichia coli str. K-12 substr. MG1655]
 gi|89108643|ref|AP_002423.1| ribonuclease D [Escherichia coli str. K-12 substr. W3110]
 gi|170081460|ref|YP_001730780.1| ribonuclease D [Escherichia coli str. K-12 substr. DH10B]
 gi|238901018|ref|YP_002926814.1| ribonuclease D [Escherichia coli BW2952]
 gi|301019362|ref|ZP_07183546.1| ribonuclease D [Escherichia coli MS 196-1]
 gi|133152|sp|P09155|RND_ECOLI RecName: Full=Ribonuclease D; Short=RNase D
 gi|75765643|pdb|1YT3|A Chain A, Crystal Structure Of Escherichia Coli Rnase D, An
           Exoribonuclease Involved In Structured Rna Processing
 gi|581215|emb|CAA30098.1| unnamed protein product [Escherichia coli]
 gi|1736427|dbj|BAA15599.1| ribonuclease D [Escherichia coli str. K12 substr. W3110]
 gi|1788105|gb|AAC74874.1| ribonuclease D [Escherichia coli str. K-12 substr. MG1655]
 gi|169889295|gb|ACB03002.1| ribonuclease D [Escherichia coli str. K-12 substr. DH10B]
 gi|238863466|gb|ACR65464.1| ribonuclease D [Escherichia coli BW2952]
 gi|299882254|gb|EFI90465.1| ribonuclease D [Escherichia coli MS 196-1]
 gi|309702026|emb|CBJ01340.1| ribonuclease D [Escherichia coli ETEC H10407]
 gi|315136445|dbj|BAJ43604.1| ribonuclease D [Escherichia coli DH1]
 gi|226093|prf||1410308A ribonuclease D
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|170019851|ref|YP_001724805.1| ribonuclease D [Escherichia coli ATCC 8739]
 gi|256022532|ref|ZP_05436397.1| ribonuclease D [Escherichia sp. 4_1_40B]
 gi|293415119|ref|ZP_06657762.1| ribonuclease D [Escherichia coli B185]
 gi|300951410|ref|ZP_07165251.1| ribonuclease D [Escherichia coli MS 116-1]
 gi|300956696|ref|ZP_07168970.1| ribonuclease D [Escherichia coli MS 175-1]
 gi|301645686|ref|ZP_07245613.1| ribonuclease D [Escherichia coli MS 146-1]
 gi|307138464|ref|ZP_07497820.1| ribonuclease D [Escherichia coli H736]
 gi|331642413|ref|ZP_08343548.1| ribonuclease D [Escherichia coli H736]
 gi|331653208|ref|ZP_08354213.1| ribonuclease D [Escherichia coli M718]
 gi|169754779|gb|ACA77478.1| ribonuclease D [Escherichia coli ATCC 8739]
 gi|260449075|gb|ACX39497.1| ribonuclease D [Escherichia coli DH1]
 gi|291432767|gb|EFF05746.1| ribonuclease D [Escherichia coli B185]
 gi|300316496|gb|EFJ66280.1| ribonuclease D [Escherichia coli MS 175-1]
 gi|300449336|gb|EFK12956.1| ribonuclease D [Escherichia coli MS 116-1]
 gi|301076058|gb|EFK90864.1| ribonuclease D [Escherichia coli MS 146-1]
 gi|323937062|gb|EGB33342.1| ribonuclease D [Escherichia coli E1520]
 gi|323940530|gb|EGB36721.1| ribonuclease D [Escherichia coli E482]
 gi|331039211|gb|EGI11431.1| ribonuclease D [Escherichia coli H736]
 gi|331049306|gb|EGI21378.1| ribonuclease D [Escherichia coli M718]
 gi|332343528|gb|AEE56862.1| ribonuclease D [Escherichia coli UMNK88]
 gi|333006772|gb|EGK26269.1| ribonuclease D [Shigella flexneri K-272]
          Length = 371

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|310815760|ref|YP_003963724.1| ribonuclease D [Ketogulonicigenium vulgare Y25]
 gi|308754495|gb|ADO42424.1| ribonuclease D [Ketogulonicigenium vulgare Y25]
          Length = 388

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 75/157 (47%), Gaps = 3/157 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQL--SPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           + VDTE L       +LC+VQL  S  D    ++   A   +   L  + ++    K+FH
Sbjct: 23  VTVDTEFLRERTYYAKLCLVQLAFSGPDADAALVDPLADGIDLKPLYDLFLNPAVVKVFH 82

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R D+ +      V   P+F T++A+ +   Y  Q   +   +++   +I K  + +DW
Sbjct: 83  AARQDLEIFSVGQNVIPAPLFDTQVAAMVC-GYGEQVSYETLARKIAKADIDKTSRFTDW 141

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           S   LS+ Q +YA +DV HL  +    + ++ + GR+
Sbjct: 142 SRRPLSEAQKEYALADVTHLRQIYENLSAQIAKSGRA 178


>gi|301169093|emb|CBW28690.1| ribonuclease D [Haemophilus influenzae 10810]
          Length = 382

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 27  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLSNPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V    F    RP+  T+I +R     T+  GL    ++ L + I K   
Sbjct: 85  KVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTS-AGLAKLAQQYLNVEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|82776970|ref|YP_403319.1| ribonuclease D [Shigella dysenteriae Sd197]
 gi|81241118|gb|ABB61828.1| RNase D [Shigella dysenteriae Sd197]
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|195937492|ref|ZP_03082874.1| ribonuclease D [Escherichia coli O157:H7 str. EC4024]
 gi|256018008|ref|ZP_05431873.1| ribonuclease D [Shigella sp. D9]
 gi|261227700|ref|ZP_05941981.1| ribonuclease D [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258135|ref|ZP_05950668.1| ribonuclease D [Escherichia coli O157:H7 str. FRIK966]
 gi|293405300|ref|ZP_06649292.1| ribonuclease D [Escherichia coli FVEC1412]
 gi|298380942|ref|ZP_06990541.1| ribonuclease D [Escherichia coli FVEC1302]
 gi|300816311|ref|ZP_07096533.1| ribonuclease D [Escherichia coli MS 107-1]
 gi|300823140|ref|ZP_07103273.1| ribonuclease D [Escherichia coli MS 119-7]
 gi|300899043|ref|ZP_07117330.1| ribonuclease D [Escherichia coli MS 198-1]
 gi|300917626|ref|ZP_07134277.1| ribonuclease D [Escherichia coli MS 115-1]
 gi|300924870|ref|ZP_07140803.1| ribonuclease D [Escherichia coli MS 182-1]
 gi|307314118|ref|ZP_07593730.1| ribonuclease D [Escherichia coli W]
 gi|309794180|ref|ZP_07688604.1| ribonuclease D [Escherichia coli MS 145-7]
 gi|331663292|ref|ZP_08364202.1| ribonuclease D [Escherichia coli TA143]
 gi|331668492|ref|ZP_08369340.1| ribonuclease D [Escherichia coli TA271]
 gi|331673338|ref|ZP_08374106.1| ribonuclease D [Escherichia coli TA280]
 gi|331677680|ref|ZP_08378355.1| ribonuclease D [Escherichia coli H591]
 gi|291427508|gb|EFF00535.1| ribonuclease D [Escherichia coli FVEC1412]
 gi|298278384|gb|EFI19898.1| ribonuclease D [Escherichia coli FVEC1302]
 gi|300357343|gb|EFJ73213.1| ribonuclease D [Escherichia coli MS 198-1]
 gi|300415143|gb|EFJ98453.1| ribonuclease D [Escherichia coli MS 115-1]
 gi|300418949|gb|EFK02260.1| ribonuclease D [Escherichia coli MS 182-1]
 gi|300524294|gb|EFK45363.1| ribonuclease D [Escherichia coli MS 119-7]
 gi|300531001|gb|EFK52063.1| ribonuclease D [Escherichia coli MS 107-1]
 gi|306906256|gb|EFN36773.1| ribonuclease D [Escherichia coli W]
 gi|308122085|gb|EFO59347.1| ribonuclease D [Escherichia coli MS 145-7]
 gi|315061107|gb|ADT75434.1| ribonuclease D [Escherichia coli W]
 gi|320188500|gb|EFW63162.1| Ribonuclease D [Escherichia coli O157:H7 str. EC1212]
 gi|320197983|gb|EFW72591.1| Ribonuclease D [Escherichia coli EC4100B]
 gi|320641655|gb|EFX11043.1| ribonuclease D [Escherichia coli O157:H7 str. G5101]
 gi|320647014|gb|EFX15847.1| ribonuclease D [Escherichia coli O157:H- str. 493-89]
 gi|320652296|gb|EFX20594.1| ribonuclease D [Escherichia coli O157:H- str. H 2687]
 gi|320657898|gb|EFX25660.1| ribonuclease D [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320658471|gb|EFX26165.1| ribonuclease D [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668369|gb|EFX35196.1| ribonuclease D [Escherichia coli O157:H7 str. LSU-61]
 gi|323158715|gb|EFZ44729.1| ribonuclease D [Escherichia coli E128010]
 gi|323186449|gb|EFZ71797.1| ribonuclease D [Escherichia coli 1357]
 gi|323378318|gb|ADX50586.1| ribonuclease D [Escherichia coli KO11]
 gi|323948311|gb|EGB44299.1| ribonuclease D [Escherichia coli H120]
 gi|324018061|gb|EGB87280.1| ribonuclease D [Escherichia coli MS 117-3]
 gi|324118864|gb|EGC12753.1| ribonuclease D [Escherichia coli E1167]
 gi|326342179|gb|EGD65960.1| Ribonuclease D [Escherichia coli O157:H7 str. 1044]
 gi|326343729|gb|EGD67491.1| Ribonuclease D [Escherichia coli O157:H7 str. 1125]
 gi|331059091|gb|EGI31068.1| ribonuclease D [Escherichia coli TA143]
 gi|331063686|gb|EGI35597.1| ribonuclease D [Escherichia coli TA271]
 gi|331069536|gb|EGI40923.1| ribonuclease D [Escherichia coli TA280]
 gi|331074140|gb|EGI45460.1| ribonuclease D [Escherichia coli H591]
          Length = 371

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|253773243|ref|YP_003036074.1| ribonuclease D [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|297516497|ref|ZP_06934883.1| ribonuclease D [Escherichia coli OP50]
 gi|300927881|ref|ZP_07143442.1| ribonuclease D [Escherichia coli MS 187-1]
 gi|312969840|ref|ZP_07784023.1| ribonuclease D [Escherichia coli 1827-70]
 gi|253324287|gb|ACT28889.1| ribonuclease D [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|300464070|gb|EFK27563.1| ribonuclease D [Escherichia coli MS 187-1]
 gi|310338125|gb|EFQ03214.1| ribonuclease D [Escherichia coli 1827-70]
 gi|323961858|gb|EGB57457.1| ribonuclease D [Escherichia coli H489]
 gi|323972689|gb|EGB67892.1| ribonuclease D [Escherichia coli TA007]
          Length = 371

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|333003670|gb|EGK23206.1| ribonuclease D [Shigella flexneri VA-6]
          Length = 371

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRADWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|320194484|gb|EFW69115.1| Ribonuclease D [Escherichia coli WV_060327]
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|15831767|ref|NP_310540.1| ribonuclease D [Escherichia coli O157:H7 str. Sakai]
 gi|157156075|ref|YP_001463104.1| ribonuclease D [Escherichia coli E24377A]
 gi|187776027|ref|ZP_02799888.2| ribonuclease D [Escherichia coli O157:H7 str. EC4196]
 gi|188024852|ref|ZP_02774388.2| ribonuclease D [Escherichia coli O157:H7 str. EC4113]
 gi|189010430|ref|ZP_02807242.2| ribonuclease D [Escherichia coli O157:H7 str. EC4076]
 gi|189402540|ref|ZP_02783120.2| ribonuclease D [Escherichia coli O157:H7 str. EC4401]
 gi|189403490|ref|ZP_02795783.2| ribonuclease D [Escherichia coli O157:H7 str. EC4486]
 gi|189404421|ref|ZP_02789258.2| ribonuclease D [Escherichia coli O157:H7 str. EC4501]
 gi|189405084|ref|ZP_02813223.2| ribonuclease D [Escherichia coli O157:H7 str. EC869]
 gi|189406051|ref|ZP_02826040.2| ribonuclease D [Escherichia coli O157:H7 str. EC508]
 gi|191168835|ref|ZP_03030609.1| ribonuclease D [Escherichia coli B7A]
 gi|193066361|ref|ZP_03047410.1| ribonuclease D [Escherichia coli E22]
 gi|193071290|ref|ZP_03052209.1| ribonuclease D [Escherichia coli E110019]
 gi|194430003|ref|ZP_03062510.1| ribonuclease D [Escherichia coli B171]
 gi|208810493|ref|ZP_03252369.1| ribonuclease D [Escherichia coli O157:H7 str. EC4206]
 gi|208816683|ref|ZP_03257803.1| ribonuclease D [Escherichia coli O157:H7 str. EC4045]
 gi|208818758|ref|ZP_03259078.1| ribonuclease D [Escherichia coli O157:H7 str. EC4042]
 gi|209396542|ref|YP_002270881.1| ribonuclease D [Escherichia coli O157:H7 str. EC4115]
 gi|209919169|ref|YP_002293253.1| ribonuclease D [Escherichia coli SE11]
 gi|217328853|ref|ZP_03444934.1| ribonuclease D [Escherichia coli O157:H7 str. TW14588]
 gi|218554376|ref|YP_002387289.1| ribonuclease D [Escherichia coli IAI1]
 gi|218695366|ref|YP_002403033.1| ribonuclease D [Escherichia coli 55989]
 gi|218705302|ref|YP_002412821.1| ribonuclease D [Escherichia coli UMN026]
 gi|254793426|ref|YP_003078263.1| ribonuclease D [Escherichia coli O157:H7 str. TW14359]
 gi|260844148|ref|YP_003221926.1| ribonuclease D [Escherichia coli O103:H2 str. 12009]
 gi|291282984|ref|YP_003499802.1| Ribonuclease D [Escherichia coli O55:H7 str. CB9615]
 gi|293446176|ref|ZP_06662598.1| ribonuclease D [Escherichia coli B088]
 gi|332279045|ref|ZP_08391458.1| ribonuclease D [Shigella sp. D9]
 gi|13361980|dbj|BAB35936.1| RNase D, processes tRNA precursor [Escherichia coli O157:H7 str.
           Sakai]
 gi|157078105|gb|ABV17813.1| ribonuclease D [Escherichia coli E24377A]
 gi|187769404|gb|EDU33248.1| ribonuclease D [Escherichia coli O157:H7 str. EC4196]
 gi|188016291|gb|EDU54413.1| ribonuclease D [Escherichia coli O157:H7 str. EC4113]
 gi|189000217|gb|EDU69203.1| ribonuclease D [Escherichia coli O157:H7 str. EC4076]
 gi|189355025|gb|EDU73444.1| ribonuclease D [Escherichia coli O157:H7 str. EC4401]
 gi|189360343|gb|EDU78762.1| ribonuclease D [Escherichia coli O157:H7 str. EC4486]
 gi|189365729|gb|EDU84145.1| ribonuclease D [Escherichia coli O157:H7 str. EC4501]
 gi|189371954|gb|EDU90370.1| ribonuclease D [Escherichia coli O157:H7 str. EC869]
 gi|189376734|gb|EDU95150.1| ribonuclease D [Escherichia coli O157:H7 str. EC508]
 gi|190901115|gb|EDV60890.1| ribonuclease D [Escherichia coli B7A]
 gi|192926009|gb|EDV80654.1| ribonuclease D [Escherichia coli E22]
 gi|192955385|gb|EDV85869.1| ribonuclease D [Escherichia coli E110019]
 gi|194411930|gb|EDX28245.1| ribonuclease D [Escherichia coli B171]
 gi|208725009|gb|EDZ74716.1| ribonuclease D [Escherichia coli O157:H7 str. EC4206]
 gi|208731026|gb|EDZ79715.1| ribonuclease D [Escherichia coli O157:H7 str. EC4045]
 gi|208738881|gb|EDZ86563.1| ribonuclease D [Escherichia coli O157:H7 str. EC4042]
 gi|209157942|gb|ACI35375.1| ribonuclease D [Escherichia coli O157:H7 str. EC4115]
 gi|209768038|gb|ACI82331.1| RNase D [Escherichia coli]
 gi|209768040|gb|ACI82332.1| RNase D [Escherichia coli]
 gi|209768042|gb|ACI82333.1| RNase D [Escherichia coli]
 gi|209768044|gb|ACI82334.1| RNase D [Escherichia coli]
 gi|209768046|gb|ACI82335.1| RNase D [Escherichia coli]
 gi|209912428|dbj|BAG77502.1| ribonuclease D [Escherichia coli SE11]
 gi|217318200|gb|EEC26627.1| ribonuclease D [Escherichia coli O157:H7 str. TW14588]
 gi|218352098|emb|CAU97835.1| ribonuclease D [Escherichia coli 55989]
 gi|218361144|emb|CAQ98727.1| ribonuclease D [Escherichia coli IAI1]
 gi|218432399|emb|CAR13290.1| ribonuclease D [Escherichia coli UMN026]
 gi|254592826|gb|ACT72187.1| ribonuclease D [Escherichia coli O157:H7 str. TW14359]
 gi|257759295|dbj|BAI30792.1| ribonuclease D [Escherichia coli O103:H2 str. 12009]
 gi|290762857|gb|ADD56818.1| Ribonuclease D [Escherichia coli O55:H7 str. CB9615]
 gi|291323006|gb|EFE62434.1| ribonuclease D [Escherichia coli B088]
 gi|332101397|gb|EGJ04743.1| ribonuclease D [Shigella sp. D9]
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|109899113|ref|YP_662368.1| ribonuclease D [Pseudoalteromonas atlantica T6c]
 gi|109701394|gb|ABG41314.1| ribonuclease D [Pseudoalteromonas atlantica T6c]
          Length = 400

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 74/157 (47%), Gaps = 7/157 (4%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           AIAVDTE +       +L ++Q+  G     +D + I+    +   L  +L DE   K+ 
Sbjct: 34  AIAVDTEFVRTRTLYPQLGLIQIYDGQQIALIDPLEIS----DFTALKAILTDENIVKVL 89

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H    DI        +  RP+F ++ A+ +T    +  G    ++ +L I + K +  +D
Sbjct: 90  HSCSEDIETFICALDIVPRPIFDSQFAAAITGMGPS-LGYAKLVEVMLDIQVDKGESRTD 148

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           W A  LS +Q QYAA DV++L  L     +K    GR
Sbjct: 149 WLARPLSPKQCQYAAYDVLYLFQLYPTLCDKTLAQGR 185


>gi|260868323|ref|YP_003234725.1| ribonuclease D [Escherichia coli O111:H- str. 11128]
 gi|257764679|dbj|BAI36174.1| ribonuclease D [Escherichia coli O111:H- str. 11128]
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|26248062|ref|NP_754102.1| ribonuclease D [Escherichia coli CFT073]
 gi|91211019|ref|YP_541005.1| ribonuclease D [Escherichia coli UTI89]
 gi|215487015|ref|YP_002329446.1| ribonuclease D [Escherichia coli O127:H6 str. E2348/69]
 gi|218558666|ref|YP_002391579.1| ribonuclease D [Escherichia coli S88]
 gi|218689740|ref|YP_002397952.1| ribonuclease D [Escherichia coli ED1a]
 gi|26108465|gb|AAN80667.1|AE016761_242 Ribonuclease D [Escherichia coli CFT073]
 gi|91072593|gb|ABE07474.1| ribonuclease D [Escherichia coli UTI89]
 gi|215265087|emb|CAS09475.1| ribonuclease D [Escherichia coli O127:H6 str. E2348/69]
 gi|218365435|emb|CAR03162.1| ribonuclease D [Escherichia coli S88]
 gi|218427304|emb|CAR08103.1| ribonuclease D [Escherichia coli ED1a]
 gi|294489955|gb|ADE88711.1| ribonuclease D [Escherichia coli IHE3034]
          Length = 375

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|301026544|ref|ZP_07189972.1| ribonuclease D [Escherichia coli MS 69-1]
 gi|300395475|gb|EFJ79013.1| ribonuclease D [Escherichia coli MS 69-1]
          Length = 371

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPIS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|323175119|gb|EFZ60733.1| ribonuclease D [Escherichia coli LT-68]
          Length = 375

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|157161268|ref|YP_001458586.1| ribonuclease D [Escherichia coli HS]
 gi|188495947|ref|ZP_03003217.1| ribonuclease D [Escherichia coli 53638]
 gi|194439630|ref|ZP_03071702.1| ribonuclease D [Escherichia coli 101-1]
 gi|254161863|ref|YP_003044971.1| ribonuclease D [Escherichia coli B str. REL606]
 gi|157066948|gb|ABV06203.1| ribonuclease D [Escherichia coli HS]
 gi|188491146|gb|EDU66249.1| ribonuclease D [Escherichia coli 53638]
 gi|194421451|gb|EDX37466.1| ribonuclease D [Escherichia coli 101-1]
 gi|242377525|emb|CAQ32279.1| RNase D [Escherichia coli BL21(DE3)]
 gi|253973764|gb|ACT39435.1| ribonuclease D [Escherichia coli B str. REL606]
 gi|253977958|gb|ACT43628.1| ribonuclease D [Escherichia coli BL21(DE3)]
          Length = 375

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|148825327|ref|YP_001290080.1| ribonuclease D [Haemophilus influenzae PittEE]
 gi|148715487|gb|ABQ97697.1| translation-associated GTPase [Haemophilus influenzae PittEE]
          Length = 380

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 78/174 (44%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  + +L + K  
Sbjct: 27  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FIALLANPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R         GL    ++ L I I K   
Sbjct: 85  KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFI-GLGASAGLAKLAQQYLNIEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            ++W    LSD QLQYAA DV +L  L     ++L +       +  C   + +
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEKAVSDDCELALSK 197


>gi|238788499|ref|ZP_04632292.1| Ribonuclease D [Yersinia frederiksenii ATCC 33641]
 gi|238723412|gb|EEQ15059.1| Ribonuclease D [Yersinia frederiksenii ATCC 33641]
          Length = 394

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 40  ARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITEWQP----FRELLQDLN 95

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    FG+   P+  T++ +  + RT +   G    + E  G+ + K
Sbjct: 96  VVKYLHAGSEDLEVFLNAFGLMPTPMIDTQVLAAFSGRTLSC--GFAMLVNEFEGVELDK 153

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +     +   R D A   C  L  R
Sbjct: 154 SESRTDWIARPLSEKQCDYAAADVFYLLPLATKLVAATEAAERMDAAIDECQLLCRR 210


>gi|320181157|gb|EFW56076.1| Ribonuclease D [Shigella boydii ATCC 9905]
 gi|332089922|gb|EGI95022.1| ribonuclease D [Shigella boydii 5216-82]
 gi|332093315|gb|EGI98374.1| ribonuclease D [Shigella dysenteriae 155-74]
          Length = 371

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKSILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|281178870|dbj|BAI55200.1| ribonuclease D [Escherichia coli SE15]
          Length = 375

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|262041917|ref|ZP_06015100.1| ribonuclease D [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040723|gb|EEW41811.1| ribonuclease D [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 371

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA    A+A+DTE +       +L ++QL  G   V +I        AP +  +L+++  
Sbjct: 14  AASTASAVALDTEFVRTRTYYPQLGLLQLFDGQ-QVSLIDPLTINDWAP-MRDLLLNQDV 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    F +  +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLPAALDECRVMQQR 185


>gi|326795603|ref|YP_004313423.1| ribonuclease D [Marinomonas mediterranea MMB-1]
 gi|326546367|gb|ADZ91587.1| ribonuclease D [Marinomonas mediterranea MMB-1]
          Length = 383

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 80/171 (46%), Gaps = 9/171 (5%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           ++ IAVDTE L          ++Q+S G+  V +I      + AP L  ++V+    K+F
Sbjct: 29  LNVIAVDTEFLRRTTYYPITGLIQISEGEKAV-LIDPQTITEWAP-LKDLMVNLDVMKVF 86

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL---LGINISKAQQ 136
           H    D+ V     GV   P + T+I       Y N       +K +   L I ++K + 
Sbjct: 87  HACSEDLDVFDRLLGVLPTPFYDTQIG----EAYANGQWSVSYVKLIQAYLSIEVAKDET 142

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            SDW+   L++ Q +YAA DVV+L  +  Q  E LQ+    D A   C+ L
Sbjct: 143 RSDWTVRPLTEAQKRYAALDVVYLAKVYPQQIEMLQKKNMLDWALEDCDTL 193


>gi|254226821|ref|ZP_04920393.1| ribonuclease D [Vibrio cholerae V51]
 gi|125620668|gb|EAZ49030.1| ribonuclease D [Vibrio cholerae V51]
          Length = 381

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 4/168 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVLDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTQAG 182


>gi|198244835|ref|YP_002215323.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|197939351|gb|ACH76684.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
          Length = 375

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|152970868|ref|YP_001335977.1| ribonuclease D [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|150955717|gb|ABR77747.1| RNase D, processes tRNA precursor [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 371

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA    A+A+DTE +       +L ++QL  G   V +I        AP +  +L+++  
Sbjct: 14  AASTASAVALDTEFVRTRTYYPQLGLLQLFDGQ-QVSLIDPLTINDWAP-MRDLLLNQDV 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    F +  +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLPAALDECRVMQQR 185


>gi|51596384|ref|YP_070575.1| ribonuclease D [Yersinia pseudotuberculosis IP 32953]
 gi|149365996|ref|ZP_01888031.1| ribonuclease D [Yersinia pestis CA88-4125]
 gi|153949850|ref|YP_001400986.1| ribonuclease D [Yersinia pseudotuberculosis IP 31758]
 gi|162421744|ref|YP_001606825.1| ribonuclease D [Yersinia pestis Angola]
 gi|165928352|ref|ZP_02224184.1| ribonuclease D [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938856|ref|ZP_02227410.1| ribonuclease D [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009317|ref|ZP_02230215.1| ribonuclease D [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166210648|ref|ZP_02236683.1| ribonuclease D [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167401505|ref|ZP_02307002.1| ribonuclease D [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420357|ref|ZP_02312110.1| ribonuclease D [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167424411|ref|ZP_02316164.1| ribonuclease D [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170024358|ref|YP_001720863.1| ribonuclease D [Yersinia pseudotuberculosis YPIII]
 gi|218929182|ref|YP_002347057.1| ribonuclease D [Yersinia pestis CO92]
 gi|229894791|ref|ZP_04509971.1| ribonuclease D [Yersinia pestis Pestoides A]
 gi|229898140|ref|ZP_04513289.1| ribonuclease D [Yersinia pestis biovar Orientalis str. India 195]
 gi|229902002|ref|ZP_04517123.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|270490819|ref|ZP_06207893.1| ribonuclease D [Yersinia pestis KIM D27]
 gi|294503859|ref|YP_003567921.1| ribonuclease D [Yersinia pestis Z176003]
 gi|51589666|emb|CAH21296.1| ribonuclease D [Yersinia pseudotuberculosis IP 32953]
 gi|115347793|emb|CAL20710.1| ribonuclease D [Yersinia pestis CO92]
 gi|149292409|gb|EDM42483.1| ribonuclease D [Yersinia pestis CA88-4125]
 gi|152961345|gb|ABS48806.1| ribonuclease D [Yersinia pseudotuberculosis IP 31758]
 gi|162354559|gb|ABX88507.1| ribonuclease D [Yersinia pestis Angola]
 gi|165913219|gb|EDR31842.1| ribonuclease D [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919635|gb|EDR36968.1| ribonuclease D [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991872|gb|EDR44173.1| ribonuclease D [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207828|gb|EDR52308.1| ribonuclease D [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962052|gb|EDR58073.1| ribonuclease D [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049201|gb|EDR60609.1| ribonuclease D [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056293|gb|EDR66062.1| ribonuclease D [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169750892|gb|ACA68410.1| ribonuclease D [Yersinia pseudotuberculosis YPIII]
 gi|229680898|gb|EEO76993.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|229688856|gb|EEO80923.1| ribonuclease D [Yersinia pestis biovar Orientalis str. India 195]
 gi|229702264|gb|EEO90283.1| ribonuclease D [Yersinia pestis Pestoides A]
 gi|262362022|gb|ACY58743.1| ribonuclease D [Yersinia pestis D106004]
 gi|262365841|gb|ACY62398.1| ribonuclease D [Yersinia pestis D182038]
 gi|270339323|gb|EFA50100.1| ribonuclease D [Yersinia pestis KIM D27]
 gi|294354318|gb|ADE64659.1| ribonuclease D [Yersinia pestis Z176003]
 gi|320015246|gb|ADV98817.1| ribonuclease D [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 373

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    IA+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 19  ARTHAHIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITEWQP----FRALLQDLN 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  + R+ +   G    + E  G+ + K
Sbjct: 75  VVKYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAFSGRSLSC--GFAMLVAEFEGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 133 SESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAKDECLLLCRR 189


>gi|238895380|ref|YP_002920115.1| ribonuclease D [Klebsiella pneumoniae NTUH-K2044]
 gi|238547697|dbj|BAH64048.1| ribonuclease D [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 375

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA    A+A+DTE +       +L ++QL  G   V +I        AP +  +L+++  
Sbjct: 18  AASTASAVALDTEFVRTRTYYPQLGLLQLFDGQ-QVSLIDPLTINDWAP-MRDLLLNQDV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    F +  +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLPAALDECRVMQQR 189


>gi|332307210|ref|YP_004435061.1| ribonuclease D [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174539|gb|AEE23793.1| ribonuclease D [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 391

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 76/158 (48%), Gaps = 7/158 (4%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           +AIAVDTE +       +L ++Q+  G     +D + I+    +   L  +L DE   K+
Sbjct: 23  EAIAVDTEFVRTRTLYPKLGLIQIYDGQQIALIDPLEIS----DFSALKAILTDENIVKV 78

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
            H    DI        +  +P+F ++ A+ +     +  G    ++ +L I + K +  +
Sbjct: 79  LHSCSEDIETFICALDIVPKPIFDSQFAAAIVGMGAS-LGYAKLVEVMLDIQVDKGESRT 137

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           DW A  LS EQ +YAA DV++L+ L     +K +  GR
Sbjct: 138 DWLARPLSPEQCRYAAYDVLYLYQLYPTLRDKARAQGR 175


>gi|331647298|ref|ZP_08348392.1| ribonuclease D [Escherichia coli M605]
 gi|330911610|gb|EGH40120.1| ribonuclease D [Escherichia coli AA86]
 gi|331044081|gb|EGI16217.1| ribonuclease D [Escherichia coli M605]
          Length = 371

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNIFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|330000265|ref|ZP_08303673.1| ribonuclease D [Klebsiella sp. MS 92-3]
 gi|328538027|gb|EGF64198.1| ribonuclease D [Klebsiella sp. MS 92-3]
          Length = 372

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA    A+A+DTE +       +L ++QL  G   V +I        AP +  +L+++  
Sbjct: 15  AASTASAVALDTEFVRTRTYYPQLGLLQLFDGQ-QVSLIDPLTINDWAP-MRDLLLNQDV 72

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    F +  +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 73  TKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVALDKS 130

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 131 ESRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLPAALDECRVMQQR 186


>gi|194434924|ref|ZP_03067168.1| ribonuclease D [Shigella dysenteriae 1012]
 gi|194416812|gb|EDX32937.1| ribonuclease D [Shigella dysenteriae 1012]
          Length = 375

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 83/180 (46%), Gaps = 6/180 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKSILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-MDRAEL 193
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  + M R E+
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMRRQEV 193


>gi|195873245|ref|ZP_02696622.2| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195634367|gb|EDX52719.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 375

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|22126121|ref|NP_669544.1| ribonuclease D [Yersinia pestis KIM 10]
 gi|45441720|ref|NP_993259.1| ribonuclease D [Yersinia pestis biovar Microtus str. 91001]
 gi|108807454|ref|YP_651370.1| ribonuclease D [Yersinia pestis Antiqua]
 gi|108811715|ref|YP_647482.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|145598343|ref|YP_001162419.1| ribonuclease D [Yersinia pestis Pestoides F]
 gi|167469552|ref|ZP_02334256.1| ribonuclease D [Yersinia pestis FV-1]
 gi|186895427|ref|YP_001872539.1| ribonuclease D [Yersinia pseudotuberculosis PB1/+]
 gi|21959080|gb|AAM85795.1|AE013826_7 RNase D [Yersinia pestis KIM 10]
 gi|45436582|gb|AAS62136.1| ribonuclease D [Yersinia pestis biovar Microtus str. 91001]
 gi|108775363|gb|ABG17882.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|108779367|gb|ABG13425.1| ribonuclease D [Yersinia pestis Antiqua]
 gi|145210039|gb|ABP39446.1| ribonuclease D [Yersinia pestis Pestoides F]
 gi|186698453|gb|ACC89082.1| ribonuclease D [Yersinia pseudotuberculosis PB1/+]
          Length = 386

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    IA+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 32  ARTHAHIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITEWQP----FRALLQDLN 87

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  + R+ +   G    + E  G+ + K
Sbjct: 88  VVKYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAFSGRSLSC--GFAMLVAEFEGVELDK 145

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 146 SESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAKDECLLLCRR 202


>gi|205352517|ref|YP_002226318.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205359829|ref|ZP_02832566.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|207856676|ref|YP_002243327.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|205272298|emb|CAR37177.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205342684|gb|EDZ29448.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|206708479|emb|CAR32800.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326627575|gb|EGE33918.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 375

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|238754880|ref|ZP_04616230.1| Ribonuclease D [Yersinia ruckeri ATCC 29473]
 gi|238706891|gb|EEP99258.1| Ribonuclease D [Yersinia ruckeri ATCC 29473]
          Length = 373

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR+   +A+DTE +       +L ++QL  G+    +D + I   Q        +L D+ 
Sbjct: 19  ARHHAQVALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPLPITEWQP----FRELLQDQS 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  T RT +   G    + EL G+ + K
Sbjct: 75  VVKFLHAGSEDLEVFLNAFQQLPTPMIDTQVLAAFTGRTLSC--GFAMLVAELQGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  L+++Q  YAA+DV +L  +  Q     +  GR   A   C  L  R
Sbjct: 133 SESRTDWLARPLTEKQCDYAAADVFYLLPMAQQLVAATEAAGRMAAAEDECLLLCRR 189


>gi|62180380|ref|YP_216797.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194734944|ref|YP_002114851.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197248423|ref|YP_002146207.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197301010|ref|ZP_02662940.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|205360221|ref|ZP_02681919.2| ribonuclease D [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|62128013|gb|AAX65716.1| RNase D, processes tRNA precursor [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194710446|gb|ACF89667.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197212126|gb|ACH49523.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197289302|gb|EDY28669.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|205350690|gb|EDZ37321.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|322714855|gb|EFZ06426.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 375

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|224583693|ref|YP_002637491.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238912118|ref|ZP_04655955.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|224468220|gb|ACN46050.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 371

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|308270300|emb|CBX26912.1| hypothetical protein N47_A09410 [uncultured Desulfobacterium sp.]
          Length = 382

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 77/167 (46%), Gaps = 8/167 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           I  D E   +    +++C++Q++  +    +D I++    K    L  +  D +  KIFH
Sbjct: 31  IGFDLEADSMHHFPEKVCLLQVATKNCIFVIDTIKL----KELSLLKPIFADNEITKIFH 86

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+  LF  F + +  +F +++ASR       + GL+  ++    + + K     DW
Sbjct: 87  GADYDVRSLFRDFNIEINNLFDSELASRFLGV--KETGLEAVIRHRFNVYLEKKFTKRDW 144

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           S   L D+ L YAA DV +L  L     ++L  +GR       C+ L
Sbjct: 145 SKRPLIDDMLHYAADDVRYLVPLYEILEKELNDIGRLFWVKEECDIL 191


>gi|205357371|ref|ZP_02347252.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205322073|gb|EDZ09912.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 375

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 18  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 189


>gi|118582016|ref|YP_903266.1| 3'-5' exonuclease [Pelobacter propionicus DSM 2379]
 gi|118504726|gb|ABL01209.1| 3'-5' exonuclease [Pelobacter propionicus DSM 2379]
          Length = 382

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 71/154 (46%), Gaps = 4/154 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVD E   L   R+++C++Q+S    +  I  +A   K+   L   L +     + H  
Sbjct: 33  VAVDLEMDSLHHYREKVCLIQISTRTESWLIDPLAL--KDLSPLAAPLGNRDILIVMHGA 90

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            +DI  L    G+ V  +F T IASRL      + GL   LK   GI ++K  Q +DWS 
Sbjct: 91  DYDIRSLHRDHGIEVTNLFDTMIASRLL--GITEFGLAALLKARFGIELNKKYQKADWSK 148

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LS E   YA +D   L  L     ++L   GR
Sbjct: 149 RPLSPEMRAYAVADTADLLRLYDMLRDELLEKGR 182


>gi|320085676|emb|CBY95454.1| RNase D, processes tRNA precursor [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 371

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|262404337|ref|ZP_06080892.1| ribonuclease D [Vibrio sp. RC586]
 gi|262349369|gb|EEY98507.1| ribonuclease D [Vibrio sp. RC586]
          Length = 381

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 81/168 (48%), Gaps = 4/168 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVMDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAG 182


>gi|326623067|gb|EGE29412.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 371

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFAAMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|26991275|ref|NP_746700.1| ribonuclease D [Pseudomonas putida KT2440]
 gi|24986330|gb|AAN70164.1|AE016655_9 ribonuclease D [Pseudomonas putida KT2440]
          Length = 377

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 71/148 (47%), Gaps = 17/148 (11%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT----VDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           +AVDTE + +     +  ++Q+  GDG     +D + I   Q     L  +L D    K+
Sbjct: 27  VAVDTEFMRVDTFYPKAGLIQI--GDGQRAFLIDPLLIGNWQP----LADLLEDSAVVKV 80

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISKAQ 135
            H    D+ VL    G   +P+F T++A+     Y N     G    ++E+LGI + K +
Sbjct: 81  LHACSEDLEVLLRLTGKLPQPLFDTQLAA----GYLNLGFSMGYSRLVQEVLGIELPKGE 136

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHAL 163
             SDW    LS+ Q+ YAA D VHL  L
Sbjct: 137 TRSDWLQRPLSETQVSYAAEDAVHLAEL 164


>gi|145634613|ref|ZP_01790322.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittAA]
 gi|145268158|gb|EDK08153.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittAA]
          Length = 362

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 70/147 (47%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  V +L + K  
Sbjct: 9   AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FVALLANPKVL 66

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R         GL    ++ L + I K   
Sbjct: 67  KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFI-GLGASAGLAKLAQQYLNVEIDKGAT 125

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 126 RTNWIKRPLSDIQLQYAAGDVWYLLPL 152


>gi|283785541|ref|YP_003365406.1| ribonuclease D [Citrobacter rodentium ICC168]
 gi|282948995|emb|CBG88598.1| ribonuclease D [Citrobacter rodentium ICC168]
          Length = 377

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I     G  +   L  +L D   
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGERVALID--PHGISDWSPLKAILRDTAI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKYLHAGSEDLEVFLNAFGELPQPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPIAGKLMAETEAAGWLPAALDECRLMQQR 189


>gi|301327561|ref|ZP_07220781.1| ribonuclease D [Escherichia coli MS 78-1]
 gi|300845871|gb|EFK73631.1| ribonuclease D [Escherichia coli MS 78-1]
          Length = 371

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQREYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|113460879|ref|YP_718946.1| ribonuclease D [Haemophilus somnus 129PT]
 gi|112822922|gb|ABI25011.1| ribonuclease D [Haemophilus somnus 129PT]
          Length = 381

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 81/172 (47%), Gaps = 4/172 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+    IA+DTE +       +L ++QL  G+  V +I        +P  + +L ++K  
Sbjct: 30  AQQKTVIALDTEFVRTKSFYPKLGLIQLYDGE-QVSLIDPFELSDFSP-FIQLLANQKVT 87

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + F     P+  T+I +   + + N  GL   LK    + I K   
Sbjct: 88  KVLHACSEDLEVFQHYFQQLPTPMLDTQIMAAFLQ-HGNSIGLAILLKHYFKLEIDKGIS 146

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL-QRLGRSDLATSCCNFL 187
            ++W A  LSD QL YAA+DV +L  L  +  +KL Q   +S +   C N L
Sbjct: 147 RTNWLARPLSDVQLHYAAADVWYLLPLYQRMQQKLAQTSWQSAVQNDCENLL 198


>gi|258621252|ref|ZP_05716286.1| ribonuclease D [Vibrio mimicus VM573]
 gi|258586640|gb|EEW11355.1| ribonuclease D [Vibrio mimicus VM573]
          Length = 373

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 81/168 (48%), Gaps = 4/168 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 10  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVINEMTP-FV 67

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 68  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 126

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G
Sbjct: 127 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAG 174


>gi|161503057|ref|YP_001570169.1| ribonuclease D [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864404|gb|ABX21027.1| hypothetical protein SARI_01122 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 371

 Score = 57.8 bits (138), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 79/177 (44%), Gaps = 7/177 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI-AAGQKNAPNLVGMLVDEK 74
           A R   AIA+DTE +       +L ++QL  G    D+  I   G  +   L  +L D  
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDG---ADVALIDPLGITDWSPLKAVLRDTG 70

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K
Sbjct: 71  ITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDK 128

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 129 SESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|325277926|ref|ZP_08143467.1| ribonuclease D [Pseudomonas sp. TJI-51]
 gi|324096941|gb|EGB95246.1| ribonuclease D [Pseudomonas sp. TJI-51]
          Length = 377

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 69/144 (47%), Gaps = 9/144 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE + +     +  ++Q+  G     I  +  G  N   L  +L +    K+ H  
Sbjct: 27  VAVDTEFMRVDTFYPKAGLIQIGDGQRAFLIDPLLIG--NWQPLAELLENSGVVKVLHAC 84

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISKAQQSSD 139
             D+ VL    G   +P+F T++A+     Y N     G    ++E+LGI++ K +  SD
Sbjct: 85  SEDLEVLLRLTGKLPQPLFDTQLAA----GYLNLGFSMGYSRLVQEVLGIDLPKGETRSD 140

Query: 140 WSADDLSDEQLQYAASDVVHLHAL 163
           W    LSD Q+ YAA D VHL  L
Sbjct: 141 WLQRPLSDTQVSYAAEDAVHLAEL 164


>gi|167035116|ref|YP_001670347.1| ribonuclease D [Pseudomonas putida GB-1]
 gi|166861604|gb|ABZ00012.1| ribonuclease D [Pseudomonas putida GB-1]
          Length = 377

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 76/159 (47%), Gaps = 20/159 (12%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT----VDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           +AVDTE + +     +  ++Q+  GDG     +D + I   Q     L  +L D    K+
Sbjct: 27  VAVDTEFMRVDTFYPKAGLIQI--GDGQRAFLIDPLLIGDWQP----LADLLEDSGVVKV 80

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISKAQ 135
            H    D+ VL    G   +P+F T++A+     Y N     G    ++++LGI + K +
Sbjct: 81  LHACSEDLEVLLRLTGKLPQPLFDTQLAA----GYLNLGFSMGYSRLVQDVLGIELPKGE 136

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
             SDW    LS+ Q+ YAA D VHL  L   FTE   RL
Sbjct: 137 TRSDWLQRPLSETQVSYAAEDAVHLAEL---FTELRPRL 172


>gi|71898238|ref|ZP_00680412.1| Ribonuclease D [Xylella fastidiosa Ann-1]
 gi|71731977|gb|EAO34034.1| Ribonuclease D [Xylella fastidiosa Ann-1]
          Length = 339

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 67/154 (43%), Gaps = 3/154 (1%)

Query: 39  LCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVR 98
           L +VQ++  D  + +  +  G  +A  L   L      KI H    D+    Y  GV  R
Sbjct: 15  LALVQIAIEDEILLVDPLVPGMTDALGL--WLAAPNVIKIMHSASEDLIAFKYACGVLPR 72

Query: 99  PVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVV 158
           P+F T+I +          G +  + ++  + + K +  SDW    L+  QL YAA+DV 
Sbjct: 73  PLFDTQIGAA-LTGLGGGMGYQKLVAKVTNVELGKGETRSDWMHRPLTPAQLDYAANDVR 131

Query: 159 HLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           +L  L    TE+L  + RS      C  L D  E
Sbjct: 132 YLFVLHDTLTERLAEMSRSAWLEEDCTRLTDNIE 165


>gi|148546540|ref|YP_001266642.1| ribonuclease D [Pseudomonas putida F1]
 gi|148510598|gb|ABQ77458.1| ribonuclease D [Pseudomonas putida F1]
          Length = 377

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 68/144 (47%), Gaps = 9/144 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVDTE + +     +  ++Q+  G     I  +  G  N   L  +L D    K+ H  
Sbjct: 27  VAVDTEFMRVDTFYPKAGLIQIGDGQRAFLIDPLLIG--NWQPLADLLEDSGVVKVLHAC 84

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISKAQQSSD 139
             D+ VL    G   +P+F T++A+     Y N     G    ++E+LGI + K +  SD
Sbjct: 85  SEDLEVLLRLTGKLPQPLFDTQLAA----GYLNLGFSMGYSRLVQEVLGIELPKGETRSD 140

Query: 140 WSADDLSDEQLQYAASDVVHLHAL 163
           W    LS+ Q+ YAA D VHL  L
Sbjct: 141 WLQRPLSETQVSYAAEDAVHLAEL 164


>gi|307131134|ref|YP_003883150.1| ribonuclease D [Dickeya dadantii 3937]
 gi|306528663|gb|ADM98593.1| ribonuclease D [Dickeya dadantii 3937]
          Length = 373

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 89/189 (47%), Gaps = 7/189 (3%)

Query: 4   IRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           I   EG + A CA A  V  +A+DTE +       +L ++QL  GD  + +I   A +  
Sbjct: 6   ITTDEG-LSAVCAQACAVSEVALDTEFVRTRTYYPQLGLIQLYDGD-NLSLIDPLAIRDW 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKD 121
           AP    +L + +  K  H G  D+ V    FG    P   T+I A+ L +  +  +G   
Sbjct: 64  AP-FRALLQNPQVTKFLHAGSEDLEVFLNAFGGLPSPFIDTQILAAFLGKPLS--YGFAA 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            + +   + + K++  +DW A  LS++Q QYAA+DV +L  +     E+ +  G  + A 
Sbjct: 121 LVADYRQVALDKSESRTDWLARPLSEKQCQYAAADVFYLLPVARTLVEETRAAGWLEAAL 180

Query: 182 SCCNFLMDR 190
             C  L  R
Sbjct: 181 DECLLLCQR 189


>gi|302866117|ref|YP_003834754.1| 3'-5' exonuclease [Micromonospora aurantiaca ATCC 27029]
 gi|315502675|ref|YP_004081562.1| 3'-5' exonuclease [Micromonospora sp. L5]
 gi|302568976|gb|ADL45178.1| 3'-5' exonuclease [Micromonospora aurantiaca ATCC 27029]
 gi|315409294|gb|ADU07411.1| 3'-5' exonuclease [Micromonospora sp. L5]
          Length = 439

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 3/113 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E + H    D+A L    G+R R +F T++A+RL      + GL    ++LLG ++ K  
Sbjct: 126 EWVLHAASQDLACL-AEVGLRPRRLFDTELAARLA--GFERVGLAALTEQLLGFSLEKHH 182

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            ++DWS+  L +  L YAA DV  L  LR    E+LQR G+S  A    + L+
Sbjct: 183 SAADWSSRPLPESWLTYAALDVELLVDLRDSLDEELQRQGKSGWAAEEFDALV 235


>gi|313497620|gb|ADR58986.1| Rnd [Pseudomonas putida BIRD-1]
          Length = 377

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 71/148 (47%), Gaps = 17/148 (11%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT----VDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           +AVDTE + +     +  ++Q+  GDG     +D + I   Q     L  +L D    K+
Sbjct: 27  VAVDTEFMRVDTFYPKAGLIQI--GDGQRAFLIDPLLIGNWQP----LADLLEDSGVVKV 80

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISKAQ 135
            H    D+ VL    G   +P+F T++A+     Y N     G    ++E+LGI + K +
Sbjct: 81  LHACSEDLEVLLRLTGKLPQPLFDTQLAA----GYLNLGFSMGYSRLVQEVLGIELPKGE 136

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHAL 163
             SDW    LS+ Q+ YAA D VHL  L
Sbjct: 137 TRSDWLQRPLSETQVSYAAEDAVHLAEL 164


>gi|197285028|ref|YP_002150900.1| ribonuclease D [Proteus mirabilis HI4320]
 gi|194682515|emb|CAR42495.1| ribonuclease D [Proteus mirabilis HI4320]
          Length = 372

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA  V  IA+DTE + +      L ++Q+  G   + +I      +  P  V +L +   
Sbjct: 18  AASEVSQIALDTEFVRIRTYYPHLGLIQMYDGK-QISLIDPLTITEWTP-FVELLTNPAV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V  + FG    P+  T++ +     Y    G    +++   I + K++
Sbjct: 76  LKYLHAGSEDLEVFSHQFGCVPTPMIDTQVVAAFL-GYPISCGFATLVEKYEHIALDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L+++Q QYA+ DV +L  L  +   + Q  G  D     C  + +R
Sbjct: 135 SRTDWLARPLTEKQCQYASGDVFYLLPLAKKLIAQAQEAGYMDAIVDECEMIAER 189


>gi|238796317|ref|ZP_04639826.1| Ribonuclease D [Yersinia mollaretii ATCC 43969]
 gi|238719762|gb|EEQ11569.1| Ribonuclease D [Yersinia mollaretii ATCC 43969]
          Length = 395

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 41  ARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITEWQP----FRELLQDLN 96

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  + R+ +   G    + E  G+ + K
Sbjct: 97  VVKYLHAGSEDLEVFLNAFDRMPTPMIDTQVLAAFSGRSLSC--GFAMLVNEFEGVELDK 154

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 155 SESRTDWIARPLSEKQCDYAAADVFYLLPLATKLVEATEAAGRMDAAKDECELLCRR 211


>gi|332141837|ref|YP_004427575.1| ribonuclease D [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551859|gb|AEA98577.1| ribonuclease D [Alteromonas macleodii str. 'Deep ecotype']
          Length = 385

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 75/161 (46%), Gaps = 3/161 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA+  +A+A+DTE +        L ++QL  G   V I  +A    N    V +L + + 
Sbjct: 18  AAQRQEAVALDTEFVRTKTLTPHLGLIQLYDGHQLVLIDPLAID--NMQPFVALLENTEV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+      F     PVF T+IA  +     +  G    ++ L  I++ K +
Sbjct: 76  VKVLHSCSEDLEAFLTAFDTVPTPVFDTQIAGSILDMGPSL-GYAKLVELLCEISLDKGE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             +DW A  L + QL YAA+DV++L     Q    +Q LG+
Sbjct: 135 SRTDWLARPLREAQLSYAANDVLYLLPCYQQLASNVQALGK 175


>gi|227355430|ref|ZP_03839826.1| ribonuclease D [Proteus mirabilis ATCC 29906]
 gi|227164417|gb|EEI49301.1| ribonuclease D [Proteus mirabilis ATCC 29906]
          Length = 399

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA  V  IA+DTE + +      L ++Q+  G   + +I      +  P  V +L +   
Sbjct: 45  AASEVSQIALDTEFVRIRTYYPHLGLIQMYDGK-QISLIDPLTITEWTP-FVELLTNPAV 102

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V  + FG    P+  T++ +     Y    G    +++   I + K++
Sbjct: 103 LKYLHAGSEDLEVFSHQFGCVPTPMIDTQVVAAFL-GYPISCGFATLVEKYEHIALDKSE 161

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L+++Q QYA+ DV +L  L  +   + Q  G  D     C  + +R
Sbjct: 162 SRTDWLARPLTEKQCQYASGDVFYLLPLAKKLIAQAQEAGYMDAIVDECEMIAER 216


>gi|89075742|ref|ZP_01162130.1| hypothetical ribonuclease D [Photobacterium sp. SKA34]
 gi|89048474|gb|EAR54049.1| hypothetical ribonuclease D [Photobacterium sp. SKA34]
          Length = 363

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 83/177 (46%), Gaps = 7/177 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           +AR   A+ +DTE +       RL ++QL  G+    +D I +    ++   L  +L D+
Sbjct: 6   SARAHSAVMLDTEFVRTRTLYPRLGLIQLFDGEQLSLIDPIEV----EDMEPLWALLRDQ 61

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+ H    D+ V  +  G    P+F T++ +     +    G    +KE +G+ + K
Sbjct: 62  SVIKVLHACGEDLEVFQHHAGCLPTPMFDTQLMAAFL-GHGISTGFGALVKEYVGVELDK 120

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +  ++W A  L+ +QL YAA+DV +L  L      K+++ G  +     C  +M R
Sbjct: 121 GEARTNWLARPLTAKQLDYAAADVYYLKPLFETLLAKVEKRGYMEALQQECQSVMQR 177


>gi|323968571|gb|EGB63977.1| ribonuclease D [Escherichia coli M863]
 gi|327252925|gb|EGE64579.1| ribonuclease D [Escherichia coli STEC_7v]
          Length = 371

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 81/178 (45%), Gaps = 9/178 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           A R   AIA+DTE +       +L ++QL  G+    +D + I     +   L  +L D 
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLVIT----DWSPLKAILRDP 69

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINIS 132
              K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + 
Sbjct: 70  SITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLD 127

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 128 KSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|270262203|ref|ZP_06190475.1| hypothetical protein SOD_b04110 [Serratia odorifera 4Rx13]
 gi|270044079|gb|EFA17171.1| hypothetical protein SOD_b04110 [Serratia odorifera 4Rx13]
          Length = 373

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 81/176 (46%), Gaps = 7/176 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    IA+DTE +       +L ++QL  G+    +D + I   Q      + +L D +
Sbjct: 19  ARNHAQIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPIKQWQP----FIDLLSDTQ 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K  H G  D+ V    F     P+  T+I +  T    +  G    + E + +++ K+
Sbjct: 75  IVKFLHAGSEDLEVFLNAFKTLPTPMVDTQILAAFTGRPLS-CGFATLVTEYMQVDLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L+++Q  YAA+DV +L  +  Q  ++ +  G +  A + C  L  R
Sbjct: 134 ESRTDWLARPLTEKQCVYAAADVFYLLPMAQQLVQETEDAGWTAAAANECLLLCQR 189


>gi|145640347|ref|ZP_01795931.1| ribonuclease D [Haemophilus influenzae R3021]
 gi|145274933|gb|EDK14795.1| ribonuclease D [Haemophilus influenzae 22.4-21]
          Length = 380

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 70/147 (47%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  + +L + K  
Sbjct: 27  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FIALLANPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    RP+  T+I +R         GL    ++ L + I K   
Sbjct: 85  KILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFI-GLGASAGLAKLAQQYLNVEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|238782530|ref|ZP_04626561.1| Ribonuclease D [Yersinia bercovieri ATCC 43970]
 gi|238716457|gb|EEQ08438.1| Ribonuclease D [Yersinia bercovieri ATCC 43970]
          Length = 395

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEK 74
           AR    +A+DTE +       +L ++QL  G+    +D + I   Q        +L D  
Sbjct: 41  ARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPITEWQP----FRELLQDLA 96

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISK 133
             K  H G  D+ V    F     P+  T++ +  + R+ +   G    + E  G+ + K
Sbjct: 97  VVKYLHAGSEDLEVFLNAFDRMPTPMIDTQVLAAFSGRSLSC--GFAMLVNEFEGVELDK 154

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 155 SESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAKDECQLLCRR 211


>gi|258626516|ref|ZP_05721356.1| ribonuclease D [Vibrio mimicus VM603]
 gi|258581227|gb|EEW06136.1| ribonuclease D [Vibrio mimicus VM603]
          Length = 385

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 81/168 (48%), Gaps = 4/168 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 22  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVIDEMTP-FV 79

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 80  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 138

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G
Sbjct: 139 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAG 186


>gi|262171029|ref|ZP_06038707.1| ribonuclease D [Vibrio mimicus MB-451]
 gi|261892105|gb|EEY38091.1| ribonuclease D [Vibrio mimicus MB-451]
          Length = 381

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 81/168 (48%), Gaps = 4/168 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
           GD+   C AAR  D + +DTE +       +L ++Q+  G+  + +I      +  P  V
Sbjct: 18  GDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGEN-LSLIDPTVIDEMTP-FV 75

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++ L
Sbjct: 76  ELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQDQL 134

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G
Sbjct: 135 QVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAG 182


>gi|323166513|gb|EFZ52276.1| ribonuclease D [Shigella sonnei 53G]
          Length = 371

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRVFPAIAQDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|213586553|ref|ZP_03368379.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
          Length = 165

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 69/146 (47%), Gaps = 5/146 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D   
Sbjct: 14  AVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG    P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--WGFASMVEEYTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHL 160
           +  +DW A  LS+ Q +YAA+DV +L
Sbjct: 130 ESRTDWLARPLSERQCEYAAADVWYL 155


>gi|74311884|ref|YP_310303.1| ribonuclease D [Shigella sonnei Ss046]
 gi|73855361|gb|AAZ88068.1| RNase D [Shigella sonnei Ss046]
          Length = 375

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 18  AVRVFPAIAQDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 134 ESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|283832800|ref|ZP_06352541.1| ribonuclease D [Citrobacter youngae ATCC 29220]
 gi|291072487|gb|EFE10596.1| ribonuclease D [Citrobacter youngae ATCC 29220]
          Length = 371

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL   DG    +    G  +   L  +L D   
Sbjct: 14  AVREFPAIALDTEFVRTRTYYPQLGLIQLF--DGKHVALIDPQGITDWSPLRAILRDTAI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPQPLIDTQILAAFCGRPLS--WGFAAMVEEFTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +      + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITTTLMAETEASGWLPAALDECRLMQQR 185


>gi|251789601|ref|YP_003004322.1| ribonuclease D [Dickeya zeae Ech1591]
 gi|247538222|gb|ACT06843.1| ribonuclease D [Dickeya zeae Ech1591]
          Length = 373

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 88/189 (46%), Gaps = 7/189 (3%)

Query: 4   IRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           I   EG + A CA A  V  +A+DTE +       +L ++QL  GD  + +I   A +  
Sbjct: 6   ITTDEG-LSAVCAQACAVSEVALDTEFVRTRTYYPQLGLIQLYDGD-NLSLIDPLAIRDW 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKD 121
           AP    +L + +  K  H G  D+ V    FG    P   ++I A+ L +  +  +G   
Sbjct: 64  AP-FRALLQNPQITKFLHAGSEDLEVFLNAFGCLPSPFIDSQILAAFLGKPLS--YGFAA 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            + +   + + K++  +DW A  LS++Q QYAA+DV +L  +      + +  G  D A 
Sbjct: 121 LVADYRQVALDKSESRTDWLARPLSEKQCQYAAADVFYLLPVARTLVAETRAAGWLDAAL 180

Query: 182 SCCNFLMDR 190
             C  L  R
Sbjct: 181 DECRLLCQR 189


>gi|163782924|ref|ZP_02177919.1| DNA polymerase I (PolI) [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881604|gb|EDP75113.1| DNA polymerase I (PolI) [Hydrogenivirga sp. 128-5-R1-1]
          Length = 576

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 20  VDAIAVDTETLGLMPR------RDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           V  + +DTET G   R       +R+ ++ L      VD+++    +K    +VG     
Sbjct: 22  VPYLFIDTETTGDRIRLFQVGDEERIFVIDLFDLPEAVDVLKELIAKKG---VVG----- 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
                 H  +FD+  + Y  G+     F T I S L      +H L    + LLG  + K
Sbjct: 74  ------HNLKFDLKFM-YPLGIVPYATFDTMIGSFLLGY--ERHSLSHVAERLLGYTMDK 124

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           + Q SDWS   L+ +Q++YAA+DV+ +  L  +  EKL  LG +D
Sbjct: 125 SLQLSDWSRTALTKQQIEYAATDVLVVRELFYKMREKLNALGETD 169


>gi|218548642|ref|YP_002382433.1| ribonuclease D [Escherichia fergusonii ATCC 35469]
 gi|218356183|emb|CAQ88800.1| ribonuclease D [Escherichia fergusonii ATCC 35469]
 gi|324113537|gb|EGC07512.1| ribonuclease D [Escherichia fergusonii B253]
          Length = 375

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 9/178 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           A R   AIA+DTE +       +L ++QL  G+    +D + I    ++   L  +L D 
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLTI----RDWSPLKSVLRDP 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINIS 132
              K  H G  D+ V    FG   +P+  T++ A+   R  +   G    ++E  G+ + 
Sbjct: 74  AITKFLHAGSEDLEVFLNKFGEMPQPLIDTQVLAAFCGRPMS--WGFASMVEEYSGVILD 131

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 132 KSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMAETEASGWLPAALDECRLMQMR 189


>gi|325497053|gb|EGC94912.1| ribonuclease D [Escherichia fergusonii ECD227]
          Length = 375

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 9/178 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           A R   AIA+DTE +       +L ++QL  G+    +D + I    ++   L  +L D 
Sbjct: 18  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLTI----RDWSPLKSVLRDP 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINIS 132
              K  H G  D+ V    FG   +P+  T++ A+   R  +   G    ++E  G+ + 
Sbjct: 74  AITKFLHAGSEDLEVFLNKFGEMPQPLIDTQVLAAFCGRPMS--WGFASMVEEYSGVILD 131

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 132 KSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMAETEASGWLPAALDECRLMQMR 189


>gi|304396155|ref|ZP_07378037.1| ribonuclease D [Pantoea sp. aB]
 gi|304356524|gb|EFM20889.1| ribonuclease D [Pantoea sp. aB]
          Length = 373

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 78/176 (44%), Gaps = 7/176 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV--DIIRIAAGQKNAPNLVGMLVDEK 74
           AR   A+A+DTE +       +L ++QL      V  D + I    ++    + +L D +
Sbjct: 19  ARQQAAVALDTEFVRTRTYYPQLGLIQLFDDHQLVLIDPLNI----RDWSPFIALLTDTR 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K  H G  D+ V  + FGV   P+  T+I +  +    +  G    +     + + K+
Sbjct: 75  VTKFLHAGGEDLEVFLHRFGVLPTPMIDTQILAAFSGQPLS-WGFASMVAHFTQVELDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L+  Q +YAA+DV +L  +  Q     +  G    A S C+ L  R
Sbjct: 134 ESRTDWLARPLTQRQCEYAAADVHYLLPIARQLMINTEEAGNMAAALSECDNLCQR 189


>gi|325578461|ref|ZP_08148596.1| ribonuclease D [Haemophilus parainfluenzae ATCC 33392]
 gi|325160197|gb|EGC72326.1| ribonuclease D [Haemophilus parainfluenzae ATCC 33392]
          Length = 383

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 70/144 (48%), Gaps = 3/144 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE + +     +L ++QL  G+  V +I   +    +P  V +L D++  
Sbjct: 27  ARQQSAVALDTEFMRISTYYPKLGLIQLYDGE-RVSLIDPLSITDFSP-FVELLRDQQVT 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F    + +  T+I +R    + N  GL   +   LGI + K   
Sbjct: 85  KILHACNEDLLVFLQEFDALPQLMMDTQIMARFL-GFANSAGLAKLVLHYLGIEMDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHL 160
            ++W    LS  QLQYAA DV +L
Sbjct: 144 RTNWLKRPLSPVQLQYAAGDVWYL 167


>gi|333018685|gb|EGK37978.1| ribonuclease D [Shigella flexneri K-227]
          Length = 371

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D   
Sbjct: 14  AVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVTLDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YA +DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAVADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|183219597|ref|YP_001837593.1| putative ribonuclease D [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189909736|ref|YP_001961291.1| ribonuclease III [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167774412|gb|ABZ92713.1| Ribonuclease III [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167778019|gb|ABZ96317.1| Putative ribonuclease D (RNase D) [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 406

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 79/167 (47%), Gaps = 8/167 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +++DTE+ G      ++C++Q++       +D ++I     N   L  +  D    KIFH
Sbjct: 29  MSIDTESSGYYTYYPKVCLIQINSNGKNYLIDPLKIT----NLSALGPLFEDPNILKIFH 84

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             + DI  L   FG +      T I+SRL     +       ++    + +SK +Q S+W
Sbjct: 85  SAQDDIKALKRDFGFKFVNTADTMISSRLLSLEQSSLSFV--VEHYHKVTLSKVEQKSNW 142

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
               L  +QL+YAA D  +L ++ L+  E L+R    D A S  +F+
Sbjct: 143 EIRPLQKQQLKYAALDTAYLESIWLKMEEDLKRRSLYDEAKSEFDFI 189


>gi|268589713|ref|ZP_06123934.1| ribonuclease D [Providencia rettgeri DSM 1131]
 gi|291314943|gb|EFE55396.1| ribonuclease D [Providencia rettgeri DSM 1131]
          Length = 373

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 78/168 (46%), Gaps = 3/168 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +       +L ++QL  G   V +I        +P    +L + ++ K  H G
Sbjct: 25  LALDTEFVRTRTYYPQLGLLQLYDGK-QVSLIDPLLMTDFSP-FKALLTNPEQLKFLHAG 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V  + F     P+  T++ +     Y    G    + E LGI + K++  +DW A
Sbjct: 83  SEDLEVFMHDFDCVPEPMIDTQVVAAFL-GYPISCGFASLVAEHLGIELDKSESRTDWLA 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             LS++Q  YAA+DV++L  L     EK+   G  + A   C  ++ R
Sbjct: 142 RPLSEKQCDYAAADVLYLLPLAEILMEKVTEAGYLEDAKDECQRVVAR 189


>gi|115896423|ref|XP_795972.2| PREDICTED: similar to G protein-coupled receptor
           [Strongylocentrotus purpuratus]
 gi|115925241|ref|XP_001183731.1| PREDICTED: similar to G protein-coupled receptor
           [Strongylocentrotus purpuratus]
          Length = 976

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 86/189 (45%), Gaps = 20/189 (10%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTV---DIIRIAAGQKNAPNLVGMLVDEKREKI 78
            I +D E + L   + RL +VQ+S  DG     D  +     K   +L   L  +   K+
Sbjct: 734 VIGLDCEGVELGREKGRLTLVQISTWDGKAFLFDAFKNPQLLKGNSSLKKTLEHDSILKV 793

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIA-----SRLTRTYTNQHGLKDNLKELLGINIS- 132
            H    D   L++ FGV+++ VF T IA      +L R +  Q G K  L ELLG   S 
Sbjct: 794 IHACNSDTYSLYHDFGVKLKNVFDTSIAMFTIMEQLNRNHPYQIGYK-ALCELLGEAASH 852

Query: 133 -------KAQQSSD-WSADDLSDEQLQYAASDVVHL-HALRLQFTEKLQRLGRSDLATSC 183
                  K  ++ D W    L++E + YAASD + L   + L+    L R+ R DL T  
Sbjct: 853 KDDDFKKKMIETEDFWKIRPLTEEMIYYAASDTLCLVPTVYLKLNGMLTRVWR-DLFTWS 911

Query: 184 CNFLMDRAE 192
           C   M+R +
Sbjct: 912 CKNAMERKQ 920


>gi|90580077|ref|ZP_01235885.1| hypothetical ribonuclease D [Vibrio angustum S14]
 gi|90438962|gb|EAS64145.1| hypothetical ribonuclease D [Vibrio angustum S14]
          Length = 375

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 83/177 (46%), Gaps = 7/177 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           +AR   A+ +DTE +       RL ++QL  G+    +D + +    ++   L  +L D+
Sbjct: 18  SARTHTAVMLDTEFVRTRTLYPRLGLIQLFDGEQLSLIDPLEV----EDMEPLWALLRDQ 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+ H    D+ V  +  G    P+F T++ +     +    G    +KE +G+ + K
Sbjct: 74  SVIKVLHACGEDLEVFQHHAGCLPTPMFDTQLMAAFL-GHGISTGFGTLVKEYVGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +  ++W A  L+++QL YAA+DV +L  L      K++  G  +     C  +M R
Sbjct: 133 GEARTNWLARPLTEKQLDYAAADVYYLKPLFESLLAKVEERGYMEALQQECESVMHR 189


>gi|237731840|ref|ZP_04562321.1| ribonuclease D [Citrobacter sp. 30_2]
 gi|226907379|gb|EEH93297.1| ribonuclease D [Citrobacter sp. 30_2]
          Length = 371

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R   AIA+DTE +       +L ++QL   DG    +    G  +   L  +L D   
Sbjct: 14  AVREFPAIALDTEFVRTRTYYPQLGLIQLF--DGKHVALIDPQGITDWSPLRDILRDTAI 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 72  TKFLHAGSEDLEVFLNAFGELPQPLIDTQILAAFCGRPMS--WGFAAMVEEFTGVALDKS 129

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 130 ESRTDWLARPLTERQCEYAAADVWYLLPITTKLMVETEASGWLPAALDECRLMQQR 185


>gi|145638698|ref|ZP_01794307.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittII]
 gi|145272293|gb|EDK12201.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittII]
 gi|309750190|gb|ADO80174.1| Ribonuclease D [Haemophilus influenzae R2866]
          Length = 380

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 72/147 (48%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  + +L + K  
Sbjct: 27  AQQQSAVALDTEFMRVSTYFPKLGLIQLYDGEH-VSLIDPLAITDFSP-FIALLANPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V    F    RP+  T+I +R     T+  GL    ++ L + I K   
Sbjct: 85  KVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGTSA-GLAKLAQQYLNVEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LS+ QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSNIQLQYAAGDVWYLLPL 170


>gi|239992935|ref|ZP_04713459.1| ribonuclease D [Alteromonas macleodii ATCC 27126]
          Length = 385

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 79/176 (44%), Gaps = 3/176 (1%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEK 74
            AA+  +A+A+DTE +        L ++QL  G   V I  +A    N    + ++ + +
Sbjct: 17  TAAQRQEAVALDTEFVRTKTLTPHLGLIQLYDGHQLVLIDPLAID--NMQPFIDLMENTE 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+ H    DI      F     PVF T++A  +     +  G    ++ L  I++ K 
Sbjct: 75  VVKVLHSCSEDIEAFLTAFDTVPTPVFDTQLAGSILDMGPS-LGYAKLVELLCDISLDKG 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L + QL YAA+DV++L     Q   K+Q  G+          L+D+
Sbjct: 134 ESRTDWLARPLREAQLSYAANDVLYLLPCYQQLASKVQEAGKVHWIYQEIALLVDK 189


>gi|118590153|ref|ZP_01547556.1| probable ribonuclease d protein [Stappia aggregata IAM 12614]
 gi|118437125|gb|EAV43763.1| probable ribonuclease d protein [Stappia aggregata IAM 12614]
          Length = 394

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 71/140 (50%), Gaps = 2/140 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + VDTE L       +LC++Q++  D    +  ++ G    P    ++ D    K+FH
Sbjct: 21  DYVTVDTEFLRETTFWPKLCVIQMAGPDMAFIVDALSEGLDLEP-FFELMRDGSVTKVFH 79

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R DI ++++   +   P+F T++A+ +   + +       + ++ G  I K+ + +DW
Sbjct: 80  AARQDIEIIYHLGELIPAPLFDTQVAAMVC-GFGDSISYDQLVYKVTGARIDKSSRFTDW 138

Query: 141 SADDLSDEQLQYAASDVVHL 160
           +   L+ +QL YA +DV HL
Sbjct: 139 ARRPLTAKQLDYALADVTHL 158


>gi|303253729|ref|ZP_07339866.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307247590|ref|ZP_07529633.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|302647454|gb|EFL77673.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306855860|gb|EFM88020.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
          Length = 371

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 3/171 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+A+DTE +       +L ++QL  GD TV +I        +P  +G+L  +   K+ H 
Sbjct: 28  AVALDTEFIRTRSYYPKLGLIQLFDGD-TVSLIDPNPISDFSP-FIGLLTCQNVVKVLHA 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+ V  + F     P+  T+I +       +  G    +   L + + K    +DW 
Sbjct: 86  CSEDLEVFQHLFKQLPTPLADTQIMAGFAGVGISL-GFAKLVAHYLNVELDKGASRTDWL 144

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           A  L++EQLQYAA+DV +L  +  +    L      +     C +L+++ E
Sbjct: 145 ARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQNAVEQECQYLLNKRE 195


>gi|89897107|ref|YP_520594.1| hypothetical protein DSY4361 [Desulfitobacterium hafniense Y51]
 gi|89336555|dbj|BAE86150.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 578

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 71/144 (49%), Gaps = 4/144 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTET GL P   +L ++QL+  D  V +I   +       L+  ++     KIF   
Sbjct: 25  IAVDTETTGLDPHTCQLRLIQLAAEDLPVLVIDCFSFLPEGRELINAILSTSGIKIFQNA 84

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN--QHGLKDNLKELLGINISKAQQSSDW 140
           +FD+  L     +    +F T +AS+L R      Q  LK   +  L  ++ K +Q+S+W
Sbjct: 85  KFDLQFLM-ALDIFPPTLFDTMLASQLLRGSGGPVQSNLKALAQHYLNEDLDKEEQTSNW 143

Query: 141 SADDLSDEQLQYAASDVVHLHALR 164
              +L++ Q+ YAA D   L  LR
Sbjct: 144 QG-ELTESQILYAARDAEILLRLR 166


>gi|260598272|ref|YP_003210843.1| ribonuclease D [Cronobacter turicensis z3032]
 gi|260217449|emb|CBA31565.1| Ribonuclease D [Cronobacter turicensis z3032]
          Length = 409

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 80/174 (45%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE +       +L ++QL  G+  V +I      + AP    +L D+   
Sbjct: 55  ARTQRALALDTEFVRTRTYYPQLGLIQLYDGE-NVALIDPLTITEWAP-FQALLQDQNIT 112

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    FG+   P   T++ +     +    G    ++   G+ + K++ 
Sbjct: 113 KFLHAGSEDLEVFQNAFGMMPDPFIDTQVLASFV-GHPLSCGFATLVEHHTGVALDKSES 171

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  L++ Q  YAA+DV +L  +  +  E+++  G    A + C  +  R
Sbjct: 172 RTDWLARPLTERQCDYAAADVWYLLPIAHKLMEQVREAGWLTAAINECRLMTQR 225


>gi|260776343|ref|ZP_05885238.1| ribonuclease D [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607566|gb|EEX33831.1| ribonuclease D [Vibrio coralliilyticus ATCC BAA-450]
          Length = 371

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 80/178 (44%), Gaps = 12/178 (6%)

Query: 15  CA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CA AR  D + +DTE +       +L ++QL  G+    I         A   V +L D 
Sbjct: 16  CAQARNADVVMLDTEFVRTRTYYPQLGLIQLFDGETLSLIDPTVIDDMTA--FVHLLKDT 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL----LGI 129
              K+ H    D+ V   +FG    P+  T++ +         HGL      L    LG+
Sbjct: 74  SVLKVLHACGEDLEVFNNSFGCLPYPMVDTQLMAAFL-----GHGLSTGFASLVESYLGV 128

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            + K++  +DW A  L+D+QL YAA+DV +L  L  +  E++ + G  + A    + L
Sbjct: 129 ELDKSESRTDWLARPLTDKQLDYAAADVHYLLPLYEKLLEEITQAGWWEAAQQESDLL 186


>gi|219667033|ref|YP_002457468.1| DNA-directed DNA polymerase [Desulfitobacterium hafniense DCB-2]
 gi|219537293|gb|ACL19032.1| DNA-directed DNA polymerase [Desulfitobacterium hafniense DCB-2]
          Length = 583

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 4/144 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTET GL P   +L ++QL+  D  V +I   +       L+  ++     K+F   
Sbjct: 30  IAVDTETTGLDPHTCQLRLIQLAAEDLPVLVIDCFSFLPEGRELINAILSTSGVKVFQNA 89

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN--QHGLKDNLKELLGINISKAQQSSDW 140
           +FD+  L     +    +F T +AS+L R      Q  LK   +  L  ++ K +Q+S+W
Sbjct: 90  KFDLQFLM-ALDIFPPTLFDTMLASQLLRGSGGPVQSNLKALAQHYLNEDLDKEEQTSNW 148

Query: 141 SADDLSDEQLQYAASDVVHLHALR 164
              +L++ Q+ YAA D   L  LR
Sbjct: 149 QG-ELTESQILYAARDAEILLRLR 171


>gi|156973677|ref|YP_001444584.1| ribonuclease D [Vibrio harveyi ATCC BAA-1116]
 gi|156525271|gb|ABU70357.1| hypothetical protein VIBHAR_01380 [Vibrio harveyi ATCC BAA-1116]
          Length = 382

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 16/188 (8%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 21  DLEEVCALAREADVVMLDTEFVRIRTYYPQLGLIQLFDGKQLSLIDPTELT----DMTSF 76

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           V +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 77  VELLKDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 131

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  +    
Sbjct: 132 VEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLMPLYEKLLDKVNEAGWWEAVQQ 191

Query: 183 CCNFLMDR 190
             + L+ +
Sbjct: 192 ESDLLVSK 199


>gi|308187080|ref|YP_003931211.1| RNase D, processes tRNA precursor [Pantoea vagans C9-1]
 gi|308057590|gb|ADO09762.1| RNase D, processes tRNA precursor [Pantoea vagans C9-1]
          Length = 373

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 77/176 (43%), Gaps = 7/176 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV--DIIRIAAGQKNAPNLVGMLVDEK 74
           AR   A+A+DTE +       +L ++QL      V  D + I    ++    + +L D  
Sbjct: 19  ARQHAAVALDTEFVRTRTYYPQLGLIQLFDDHQLVLIDPLNI----RDWSPFIALLTDTS 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K  H G  D+ V  + FGV   P+  T+I +  +    +  G    +     + + K+
Sbjct: 75  VTKFLHAGGEDLEVFLHRFGVLPTPMIDTQILAAFSGQPLSW-GFASMVAHFTQVELDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  L+  Q +YAA+DV +L  +  Q     +  G    A S C+ L  R
Sbjct: 134 ESRTDWLARPLTQRQCEYAAADVHYLLPIARQLMINTEEAGNMAAALSECDNLCQR 189


>gi|104783019|ref|YP_609517.1| ribonuclease D, processes tRNA [Pseudomonas entomophila L48]
 gi|95112006|emb|CAK16733.1| ribonuclease D, processes tRNA [Pseudomonas entomophila L48]
          Length = 377

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 74/153 (48%), Gaps = 17/153 (11%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT----VDIIRIAAGQKNAPNLVGMLVDE 73
           R +  +A+DTE + +     +  +VQ+  GDG     +D + I+  Q     L  +L D 
Sbjct: 22  RKLPFVALDTEFMRVDTFYPKAGLVQI--GDGNQAFLIDPLLISDWQP----LADLLDDS 75

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGIN 130
              K+ H    D+ VL    G   +P+F T++A+     Y N     G    ++E+LG+ 
Sbjct: 76  GVVKVLHACSEDLEVLLRLTGKLPQPLFDTQLAA----GYLNIGFSMGYSRLVQEVLGLE 131

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
           + K +  SDW    LS+ Q+ YAA D VHL  L
Sbjct: 132 LPKGETRSDWLQRPLSETQVSYAAEDAVHLAEL 164


>gi|163803649|ref|ZP_02197513.1| cell division topological specificity factor MinE [Vibrio sp. AND4]
 gi|159172559|gb|EDP57420.1| cell division topological specificity factor MinE [Vibrio sp. AND4]
          Length = 372

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 86/188 (45%), Gaps = 16/188 (8%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 11  DLEEVCALAREADVVMLDTEFVRIRTFYPQLGLIQLFDGKQLSLIDPTELT----DMTSF 66

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           V +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 67  VELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G  +    
Sbjct: 122 VEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLMPLYEKLLDKVNQAGWWEAVQQ 181

Query: 183 CCNFLMDR 190
             + L+ +
Sbjct: 182 ESDLLVSK 189


>gi|269960729|ref|ZP_06175101.1| ribonuclease D [Vibrio harveyi 1DA3]
 gi|269834806|gb|EEZ88893.1| ribonuclease D [Vibrio harveyi 1DA3]
          Length = 372

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 16/188 (8%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 11  DLEEVCALAREADVVMLDTEFVRIRTYYPQLGLIQLFDGKQLSLIDPTELT----DMTSF 66

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           V +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 67  VELLKDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  +    
Sbjct: 122 VEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLMPLYEKLLDKVNEAGWWEAVQQ 181

Query: 183 CCNFLMDR 190
             + L+ +
Sbjct: 182 ESDLLVSK 189


>gi|226329911|ref|ZP_03805429.1| hypothetical protein PROPEN_03824 [Proteus penneri ATCC 35198]
 gi|225200706|gb|EEG83060.1| hypothetical protein PROPEN_03824 [Proteus penneri ATCC 35198]
          Length = 372

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 79/175 (45%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA     IA+DTE + +      L ++Q+  G     I  +A   K+    V +L ++  
Sbjct: 18  AASEASQIALDTEFVRIRTYYPHLGLIQMYDGKQISLIDPLAI--KDWTPFVELLTNQGI 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V  + FG    P+  T++ +     +    G    +++   + + K++
Sbjct: 76  MKFLHAGSEDLEVFSHQFGCVPTPMIDTQVVAAFL-GHPISCGFATLVEKYENVALDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L+++Q QYA+ DV +L  L  +  ++ +  G  D     C  + +R
Sbjct: 135 SRTDWLARPLTEKQCQYASGDVFYLLPLAEKLIKEAEEAGYMDAIADECEMIAER 189


>gi|114775667|ref|ZP_01451235.1| ribonuclease D [Mariprofundus ferrooxydans PV-1]
 gi|114553778|gb|EAU56159.1| ribonuclease D [Mariprofundus ferrooxydans PV-1]
          Length = 398

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++F   G    P+F T++A+ L   Y  Q G  + ++ +    + K + 
Sbjct: 80  KVFHAARQDIEIIFNEAGGLPLPLFDTQVAAALL-GYGQQVGFGNLVQRITKKLLPKGES 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            +DW A  L+ +Q+ YAA DV+ L  +     E+L+   R+
Sbjct: 139 FTDWKARPLTKKQMAYAADDVIWLMPVFQHLKERLEAAKRT 179


>gi|145632638|ref|ZP_01788372.1| ribonuclease D [Haemophilus influenzae 3655]
 gi|144986833|gb|EDJ93385.1| ribonuclease D [Haemophilus influenzae 3655]
 gi|309972450|gb|ADO95651.1| Ribonuclease D [Haemophilus influenzae R2846]
          Length = 380

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 70/147 (47%), Gaps = 3/147 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+  V +I   A    +P  + +L + K  
Sbjct: 27  AQQKSAVALDTEFMRVSTYFPKLGLIQLYDGE-RVSLIDPLAITDFSP-FIALLANPKVL 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ V    F     P+  T+I +R      +  GL    ++ L I I K   
Sbjct: 85  KILHSCSEDLLVFLQEFDQLPHPMIDTQIMARFIGLGASA-GLAKLAQQYLNIEIDKGAT 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHAL 163
            ++W    LSD QLQYAA DV +L  L
Sbjct: 144 RTNWIKRPLSDIQLQYAAGDVWYLLPL 170


>gi|119487547|ref|ZP_01621157.1| hypothetical protein L8106_26862 [Lyngbya sp. PCC 8106]
 gi|119455716|gb|EAW36852.1| hypothetical protein L8106_26862 [Lyngbya sp. PCC 8106]
          Length = 309

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 15/151 (9%)

Query: 62  NAPNLVGMLVDE-----KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY--- 113
           + P L  + ++E       EK+FH   +D+ +L      + + V CT + ++    Y   
Sbjct: 62  DQPELTTLFIEEIMANPAIEKVFHNANYDLKLLG---KKQSKNVTCTLVMAKKIPYYLLP 118

Query: 114 TNQHGLKDNLKELLG--INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
              + LK  L   LG   NI K +QSSDW    L+++QL+YA  DVV+L  +  Q   KL
Sbjct: 119 VPNYQLK-TLATQLGDFTNIDKQEQSSDWGQRPLTEKQLEYAQMDVVYLAQIH-QCLLKL 176

Query: 172 QRLGRSDLATSCCNFLMDRAELDLLGWENVD 202
           Q L   D  T   N L  R +     W+ +D
Sbjct: 177 QPLASPDPTTEDLNKLATRYQEIAHDWKQLD 207


>gi|330504002|ref|YP_004380871.1| ribonuclease D [Pseudomonas mendocina NK-01]
 gi|328918288|gb|AEB59119.1| ribonuclease D [Pseudomonas mendocina NK-01]
          Length = 377

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 76/157 (48%), Gaps = 24/157 (15%)

Query: 15  CAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIA-----AGQKNAPNL 66
           CAA + +  +A+DTE + +        ++Q+S GDG   +D +RI+     A    APN+
Sbjct: 18  CAAWQALPFVALDTEFMRVDTFYPIAGLLQVSGGDGAYLIDPLRISDWRPFAALLEAPNV 77

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNL 123
           V         K+ H    D+ V     G    P+F T++A+     Y N     G    +
Sbjct: 78  V---------KVLHSCSEDLEVFLRLSGSLPAPLFDTQLAA----GYLNLGFSMGYSRLV 124

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHL 160
           + LL I + K +  SDW    LS+ Q++YAA DV+HL
Sbjct: 125 QALLDIELPKGETRSDWLQRPLSELQVRYAAEDVLHL 161


>gi|304389402|ref|ZP_07371365.1| ribonuclease D [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|304327212|gb|EFL94447.1| ribonuclease D [Mobiluncus curtisii subsp. curtisii ATCC 35241]
          Length = 406

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 83/178 (46%), Gaps = 10/178 (5%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGM-LV 71
           E  A     +A+DTE  G         +VQL   G GT  I  IA      P+L  +   
Sbjct: 32  ELVADATGPVALDTERAGSFRYSQGAYLVQLRREGAGTFLIDPIAF-----PDLEPLSRA 86

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
             K E I H    D+  L    G+R + +F T++A++L        GL   L+++LGI++
Sbjct: 87  IGKAEWILHDATQDLPYLL-ELGMRPQLLFDTELAAKLLNF--QGFGLAAVLEQVLGISL 143

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           +K   ++DWS   L  +   YAA DV +L  LR     +LQ   + D A    +FL+D
Sbjct: 144 AKEHSAADWSTRPLPSDWQTYAALDVDYLIDLRNHLWLQLQDADKDDWAEQEFDFLLD 201


>gi|32035264|ref|ZP_00135282.1| COG0349: Ribonuclease D [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126208098|ref|YP_001053323.1| ribonuclease D [Actinobacillus pleuropneumoniae L20]
 gi|190149931|ref|YP_001968456.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|307249819|ref|ZP_07531795.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307261076|ref|ZP_07542755.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|307263258|ref|ZP_07544876.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|126096890|gb|ABN73718.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 5b str.
           L20]
 gi|189915062|gb|ACE61314.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|306858121|gb|EFM90201.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306869208|gb|EFN01006.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|306871320|gb|EFN03046.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 371

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 3/171 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+A+DTE +       +L ++QL  GD TV +I   +    +P  +G+L  +   K+ H 
Sbjct: 28  AVALDTEFIRTRSYYPKLGLIQLFDGD-TVSLIDPNSISDFSP-FIGLLTCQNVVKVLHA 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+ V  + F     P+  T+I +       +  G    +   L + + K    +DW 
Sbjct: 86  CSEDLEVFQHLFKQLPTPLADTQIMAGFAGGGISL-GFAKLVAHYLNVELDKGASRTDWL 144

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           A  L++EQLQYAA+DV +L  +  +    L      +     C +L+ + E
Sbjct: 145 ARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQNAVEQECRYLLSKRE 195


>gi|127513115|ref|YP_001094312.1| ribonuclease D [Shewanella loihica PV-4]
 gi|126638410|gb|ABO24053.1| ribonuclease D [Shewanella loihica PV-4]
          Length = 368

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 21/168 (12%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA-------PNLVGML 70
           R    + +DTE +       +L ++Q+  G+    I  +A    +A        +++ +L
Sbjct: 20  RQAKVLMLDTEFVRTRTYYAKLGLIQVYDGETLALIDPVAVSDLSAFWALLERDDMISVL 79

Query: 71  --VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
               E  E +  YGR    VLF +   ++   FC          + +  G    ++  LG
Sbjct: 80  HSCSEDLEVLARYGRCQPKVLFDS---QIAAAFCG---------WGHGMGYAKLVEHCLG 127

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           + + K +  +DW    LSD QLQYAA+DV +L+ L  Q  EKLQ  GR
Sbjct: 128 VQLDKGESRTDWMKRPLSDAQLQYAANDVDYLYRLYPQLLEKLQESGR 175


>gi|78485923|ref|YP_391848.1| 3'-5' exonuclease [Thiomicrospira crunogena XCL-2]
 gi|78364209|gb|ABB42174.1| ribonuclease D [Thiomicrospira crunogena XCL-2]
          Length = 385

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 79/167 (47%), Gaps = 7/167 (4%)

Query: 7   HEGDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
            + D+ A C   +    IA+DTE +        L ++Q+   DG   II   A + +   
Sbjct: 8   QQADLDAFCELLKTCPWIALDTEFVRTDTYFSILSLIQIQTHDGQAAIIDPLAIE-DLTA 66

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  ++ +    K+FH  R DI VL+   G     ++ T+IA  L   + +  GL   +K 
Sbjct: 67  LWSIISNPNVRKVFHSARQDIEVLYQVSGQMPISIYDTQIAC-LFLQHGDLAGLARVVKA 125

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
            L   + K Q  ++W    L+D+QL+YA +DV +L  L     EKLQ
Sbjct: 126 ELNFTLEKDQTRTNWQQRPLTDKQLEYAINDVRYLAPLY----EKLQ 168


>gi|170723061|ref|YP_001750749.1| ribonuclease D [Pseudomonas putida W619]
 gi|169761064|gb|ACA74380.1| ribonuclease D [Pseudomonas putida W619]
          Length = 377

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 73/153 (47%), Gaps = 17/153 (11%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT----VDIIRIAAGQKNAPNLVGMLVDE 73
           R +  +A+DTE + +     +  ++Q+  GDG     +D + I   Q     L  +L D 
Sbjct: 22  RTLPFVALDTEFMRVDTFYPKAGLIQI--GDGERAYLIDPLLIVDWQP----LGELLEDA 75

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGIN 130
              K+ H    D+ VL    G   +P+F T++A+     Y N     G    ++E+LG+ 
Sbjct: 76  GVVKVLHACSEDLEVLLRLTGKLPQPLFDTQLAA----GYLNLGFSMGYSRLVQEVLGLE 131

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
           + K +  SDW    LSD Q+ YAA D VHL  L
Sbjct: 132 LPKGETRSDWLQRPLSDTQVSYAAEDAVHLAEL 164


>gi|298346894|ref|YP_003719581.1| ribonuclease D [Mobiluncus curtisii ATCC 43063]
 gi|298236955|gb|ADI68087.1| ribonuclease D [Mobiluncus curtisii ATCC 43063]
          Length = 406

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 83/178 (46%), Gaps = 10/178 (5%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGM-LV 71
           E  A     +A+DTE  G         +VQL   G GT  I  IA      P+L  +   
Sbjct: 32  ELIADATGPVALDTERAGSFRYSQGAYLVQLRREGAGTFLIDPIAF-----PDLEPLSRA 86

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
             K E I H    D+  L    G+R + +F T++A++L        GL   L+++LGI++
Sbjct: 87  IGKAEWILHDATQDLPYLL-ELGMRPQLLFDTELAAKLLNF--QGFGLAAVLEQVLGISL 143

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           +K   ++DWS   L  +   YAA DV +L  LR     +LQ   + D A    +FL+D
Sbjct: 144 AKEHSAADWSTRPLPSDWQTYAALDVDYLIDLRNHLWLQLQDADKDDWAEQEFDFLLD 201


>gi|300723126|ref|YP_003712424.1| RNase D, processes tRNA [Xenorhabdus nematophila ATCC 19061]
 gi|297629641|emb|CBJ90244.1| RNase D, processes tRNA precursor [Xenorhabdus nematophila ATCC
           19061]
          Length = 379

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 7/170 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IA+DTE +       +L ++QL  G+    +D + I+  Q     L  +LVD    K+ H
Sbjct: 28  IALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPLEISQWQP----LKALLVDPDVLKLIH 83

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V   +F     P+  T++ +     +    G    + E L + + K++  +DW
Sbjct: 84  AGSEDLEVFGNSFQCLPTPMIDTQVLAAFI-GHPISCGFATLVAEYLHVELDKSESRTDW 142

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  LS +Q +YAA+DV +L  L     +K ++ G  D A    + +  R
Sbjct: 143 LARPLSRKQCEYAAADVYYLLPLADILLKKTEQAGYFDAAKDESDLIAQR 192


>gi|221134772|ref|ZP_03561075.1| ribonuclease D [Glaciecola sp. HTCC2999]
          Length = 382

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 5/151 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI-AAGQKNAPNLVGMLVDEKREKIFHY 81
           IAVDTE +        + +VQ+  G   VDI  I      +   L  ++ + +  K+ H 
Sbjct: 27  IAVDTEFVRTRTFYPHIGLVQIYDG---VDIALIDPIAIDDLSPLSQLMTNPQVIKVLHA 83

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+    +  GV   P+F T++A++L     N  G    ++ L  I + K +  +DW 
Sbjct: 84  CSEDLETFEFALGVMPEPLFDTQVAAQLA-GLGNSVGYGRLVELLQDITLEKGESRTDWI 142

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
              LS EQL YAA DV++L     +  EKL+
Sbjct: 143 RRPLSPEQLIYAAEDVLYLLPCYFKLAEKLE 173


>gi|315656649|ref|ZP_07909536.1| ribonuclease D [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|315492604|gb|EFU82208.1| ribonuclease D [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 406

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 83/178 (46%), Gaps = 10/178 (5%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGM-LV 71
           E  A     +A+DTE  G         +VQL   G GT  I  IA      P+L  +   
Sbjct: 32  ELIADATGPVALDTERAGSFRYSQGAYLVQLRREGAGTFLIDPIAF-----PDLEPLSRA 86

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
             K E I H    D+  L    G+R + +F T++A++L        GL   L+++LGI++
Sbjct: 87  IGKAEWILHDATQDLPYLL-ELGMRPQLLFDTELAAKLLNF--QGFGLAAVLEQVLGISL 143

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           +K   ++DWS   L  +   YAA DV +L  LR     +LQ   + D A    +FL+D
Sbjct: 144 AKEHSAADWSTRPLPSDWQTYAALDVDYLIDLRNHLWLQLQDADKDDWAEQEFDFLLD 201


>gi|315655438|ref|ZP_07908338.1| ribonuclease D [Mobiluncus curtisii ATCC 51333]
 gi|315490378|gb|EFU80003.1| ribonuclease D [Mobiluncus curtisii ATCC 51333]
          Length = 406

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 83/178 (46%), Gaps = 10/178 (5%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGM-LV 71
           E  A     +A+DTE  G         +VQL   G GT  I  IA      P+L  +   
Sbjct: 32  ELIADATGPVALDTERAGSFRYSQGAYLVQLRREGAGTFLIDPIAF-----PDLEPLSRA 86

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
             K E I H    D+  L    G+R + +F T++A++L        GL   L+++LGI++
Sbjct: 87  IGKAEWILHDATQDLPYLL-ELGMRPQLLFDTELAAKLLNF--QGFGLAAVLEQVLGISL 143

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           +K   ++DWS   L  +   YAA DV +L  LR     +LQ   + D A    +FL+D
Sbjct: 144 AKEHSAADWSTRPLPSDWQTYAALDVDYLIDLRNHLWLQLQDADKDDWAEQEFDFLLD 201


>gi|37679238|ref|NP_933847.1| ribonuclease D [Vibrio vulnificus YJ016]
 gi|37197981|dbj|BAC93818.1| ribonuclease D [Vibrio vulnificus YJ016]
          Length = 390

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 75/171 (43%), Gaps = 12/171 (7%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+   C+ AR  D + +DTE +       +L ++QL  GD    I        +A     
Sbjct: 30  DLARVCSKAREADVVMLDTEFVRTRTYYPQLGLIQLFDGDSLSLIDPTVLTDMSA--FTE 87

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL-- 126
           +L D    K+ H    D+ V    FG    P+  T+I +         HGL      L  
Sbjct: 88  LLNDASVMKVLHACGEDLEVFHNAFGAMPVPMVDTQIMAAFL-----GHGLSTGFAALVE 142

Query: 127 --LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
             L + + K++  +DW A  LSD+QL+YAA+DV +L  L     EK+   G
Sbjct: 143 QYLNVELDKSESRTDWLARPLSDKQLEYAAADVHYLLPLYEILLEKVMAAG 193


>gi|307256641|ref|ZP_07538420.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306864689|gb|EFM96593.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 371

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 77/171 (45%), Gaps = 3/171 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+A+DTE +       +L ++QL  GD TV +I        +P  +G+L  +   K+ H 
Sbjct: 28  AVALDTEFIRTRSYYPKLGLIQLFDGD-TVSLIDPNPISDFSP-FIGLLTCQNVVKVLHA 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+ V  + F     P+  T+I +       +  G    +   L + + K    +DW 
Sbjct: 86  CSEDLEVFQHLFKQLPTPLADTQIMAGFAGGGISL-GFAKLVAHYLNVELDKGASRTDWL 144

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           A  L++EQLQYAA+DV +L  +  +    L      +     C +L+ + E
Sbjct: 145 ARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQNAVEQECRYLLSKRE 195


>gi|90411623|ref|ZP_01219633.1| hypothetical ribonuclease D [Photobacterium profundum 3TCK]
 gi|90327513|gb|EAS43866.1| hypothetical ribonuclease D [Photobacterium profundum 3TCK]
          Length = 374

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    + +DTE +       +L ++Q+  GD  V I  I    ++      +L D+   
Sbjct: 19  ARTYSVVMLDTEFVRTRTLYPKLGLIQMFDGDNLVLIDPIEI--EDLTPFWDLLRDQSVI 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  +  G    P+  T++ +     +    G    + E +G+++ K + 
Sbjct: 77  KVLHACGEDLEVFQHHAGCLPTPMIDTQLMAAFL-GHGVSAGFGSLVSEYVGVDLEKGEA 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            ++W A  L+D+QL YAA+DV +L  L     EK++  G  D     C  LM +
Sbjct: 136 RTNWLARPLTDKQLDYAAADVFYLLPLYETLLEKVKAKGWMDALELECTALMQK 189


>gi|91228923|ref|ZP_01262822.1| ribonuclease D [Vibrio alginolyticus 12G01]
 gi|91187531|gb|EAS73864.1| ribonuclease D [Vibrio alginolyticus 12G01]
          Length = 277

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 76/163 (46%), Gaps = 11/163 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE + +     +L ++QL  G+  + +I         P  V +L D    
Sbjct: 32  AREADVVMLDTEFVRIRTFYPQLGLIQLFDGN-RLSLIDPTELTDMTP-FVALLKDTSVL 89

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL----KELLGINIS 132
           K+ H    D+ V    FG    P+  T++ +         HGL        +E LG+ + 
Sbjct: 90  KVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFASLVEEYLGVELD 144

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G
Sbjct: 145 KSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLFDKVTQAG 187


>gi|269138811|ref|YP_003295512.1| ribonuclease D [Edwardsiella tarda EIB202]
 gi|267984472|gb|ACY84301.1| ribonuclease D [Edwardsiella tarda EIB202]
 gi|304558803|gb|ADM41467.1| Ribonuclease D [Edwardsiella tarda FL6-60]
          Length = 371

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 81/171 (47%), Gaps = 9/171 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IA+DTE +       +L +VQL  G+    +D + I+  Q      V +L + +  K+ H
Sbjct: 26  IALDTEFVRTRTYYPQLGLVQLYDGETLSLIDPLPISDWQP----FVDLLRNPQVVKLLH 81

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISKAQQSSD 139
            G  D+ V  + F    +P+  T+I +  T R  ++  G    +   L +++ K++  +D
Sbjct: 82  AGSEDLEVFLHDFQTLPQPLIDTQILAAFTGRPLSS--GFAAMVSAYLQVDLDKSESRTD 139

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           W A  LS+ Q  YAA+DV +L  +  +   +++  G    A   C  L  R
Sbjct: 140 WLARPLSERQCDYAAADVYYLLPMAHKLLAEVEACGWLPAALDECQALCRR 190


>gi|212711905|ref|ZP_03320033.1| hypothetical protein PROVALCAL_02980 [Providencia alcalifaciens DSM
           30120]
 gi|212685427|gb|EEB44955.1| hypothetical protein PROVALCAL_02980 [Providencia alcalifaciens DSM
           30120]
          Length = 373

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 71/153 (46%), Gaps = 3/153 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +       +L ++QL  G   V +I        +P    +L +  + K  H G
Sbjct: 25  LALDTEFVRTRTYYPQLGLLQLYDGK-QVSLIDPLLMTDFSP-FKALLTNPNQLKFLHAG 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V  + FG    P+  T++ +     Y    G    + E LGI + K++  +DW A
Sbjct: 83  SEDLEVFMHDFGCVPEPMIDTQVLAAFL-GYPISCGFATLVAEHLGIELDKSESRTDWLA 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
             LS++Q  YA +DV++L  L     EK+   G
Sbjct: 142 RPLSEKQCDYATADVLYLLPLAKILMEKVSEEG 174


>gi|254821715|ref|ZP_05226716.1| ribonuclease D [Mycobacterium intracellulare ATCC 13950]
          Length = 430

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 86/194 (44%), Gaps = 5/194 (2%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQK 61
           ++ V+E +  AE   R     AVD E        +R  ++Q+   G GTV I  ++ G+ 
Sbjct: 35  SVSVYEIEAAAERLDRGRGPFAVDAERASGFRYSNRAYLIQIRRAGSGTVLIDPVSHGRD 94

Query: 62  NAPNLVGML-VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
               L  +  V    E I H    D+  L    G+R   ++ T++A RL      +  L 
Sbjct: 95  PLEALRPVAEVLGTDEWILHSADQDLPCL-AEVGMRPPALYDTELAGRLA--GFERVNLA 151

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             ++ LLG  ++K   ++DWS   L  E L YAA DV  L  LR    E L   G++D A
Sbjct: 152 TMVERLLGFGLAKGHGAADWSKRPLPAEWLNYAALDVELLIELRAAIAEVLAGQGKTDWA 211

Query: 181 TSCCNFLMDRAELD 194
               ++L D    D
Sbjct: 212 AQEFDYLRDTGSKD 225


>gi|26452498|dbj|BAC43334.1| putative nucleolar protein [Arabidopsis thaliana]
          Length = 578

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDI--IRIAAGQKNAPNLVGMLVDE 73
           R V+  AVD E       +   C++Q+S    D  VD   +RI  G    P L  +  D 
Sbjct: 277 RSVEEFAVDLEHNQYRSFQGLTCLMQISTRTEDYIVDTFKLRIHIG----PYLREIFKDP 332

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K++K+ H    DI  L   FG+ V  +F T  ASR+     N   L+  L+   G+  +K
Sbjct: 333 KKKKVMHGADRDIIWLQRDFGIYVCNLFDTGQASRVLNLERN--SLEFLLQHFCGVTANK 390

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             Q++DW    L +E  +YA  D  +L  +      +LQR+ + D  T
Sbjct: 391 EYQNADWRIRPLPEEMTRYAREDTHYLLYIYDLIKLELQRMAKDDAHT 438


>gi|165976032|ref|YP_001651625.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|303249665|ref|ZP_07335870.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307245476|ref|ZP_07527563.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307252170|ref|ZP_07534068.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307254430|ref|ZP_07536267.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307258890|ref|ZP_07540621.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|165876133|gb|ABY69181.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|302651477|gb|EFL81628.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306853535|gb|EFM85753.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306860314|gb|EFM92329.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306862571|gb|EFM94528.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866914|gb|EFM98771.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
          Length = 371

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 77/171 (45%), Gaps = 3/171 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+A+DTE +       +L ++QL  GD TV +I        +P  +G+L  +   K+ H 
Sbjct: 28  AVALDTEFIRTRSYYPKLGLIQLFDGD-TVSLIDPNPISDFSP-FIGLLTCQNVVKVLHA 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+ V  + F     P+  T+I +       +  G    +   L + + K    +DW 
Sbjct: 86  CSEDLEVFQHLFKQLPTPLADTQIMAGFAGGGISL-GFAKLVAHYLNVELDKGASRTDWL 144

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           A  L++EQLQYAA+DV +L  +  +    L      +     C +L+ + E
Sbjct: 145 ARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQNAVEQECRYLLSKRE 195


>gi|262193925|ref|YP_003265134.1| 3'-5' exonuclease [Haliangium ochraceum DSM 14365]
 gi|262077272|gb|ACY13241.1| 3'-5' exonuclease [Haliangium ochraceum DSM 14365]
          Length = 925

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 67/135 (49%), Gaps = 5/135 (3%)

Query: 39  LCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVR 98
           LC+VQL+  + TV +I   A     P +  +L      KI H  +F+ +V F   G+ + 
Sbjct: 791 LCLVQLAAPEYTV-VIDARAVDDLGP-VSELLASRAVVKIIHNAQFERSV-FRKLGMDIE 847

Query: 99  PVFCT-KIASRL-TRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASD 156
            VF T K++ RL  R     HGL       LG  + K +Q SDW+   L+  QL YAA D
Sbjct: 848 NVFDTLKVSRRLRGRKREGGHGLGAVCARELGRELDKHEQRSDWTQRPLTQRQLDYAALD 907

Query: 157 VVHLHALRLQFTEKL 171
              L AL  +FT +L
Sbjct: 908 AEVLLALHERFTREL 922


>gi|85860425|ref|YP_462627.1| ribonuclease D [Syntrophus aciditrophicus SB]
 gi|85723516|gb|ABC78459.1| ribonuclease D [Syntrophus aciditrophicus SB]
          Length = 339

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 72/160 (45%), Gaps = 6/160 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I++DTE   +   R++LC+VQ+     T   +       +   L     D +  K+ H G
Sbjct: 78  ISLDTEYDSMHYFREKLCLVQVRASKRTY--VFDPFNGIDLQFLRPYFADPRLLKVTHAG 135

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ--QSSDW 140
             DI +L   +G   R +F T  A+ +  +      L   +++ LG+ I K +  Q S W
Sbjct: 136 DNDIRILKRDYGFEFRNIFDTHRAAHMLGS--QYLALSSIIEQYLGVEIEKTKKMQRSKW 193

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            A  LS+ QL+YA  D  +L  L     EKL   G  + A
Sbjct: 194 EARPLSEGQLRYAVQDTAYLADLYRHLNEKLSLKGMQERA 233


>gi|119512751|ref|ZP_01631822.1| 3'-5' exonuclease [Nodularia spumigena CCY9414]
 gi|119462619|gb|EAW43585.1| 3'-5' exonuclease [Nodularia spumigena CCY9414]
          Length = 306

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 85/178 (47%), Gaps = 18/178 (10%)

Query: 17  ARYVDA--IAVDTETLGLMPRRDRLCIVQL--SPGDGTVDIIRIAAGQKNAPNLVG---- 68
           A Y +A  + +DTE      R  RL ++Q+   P D + D + +     N P++VG    
Sbjct: 15  AEYTNAKTLWIDTEVADYKSRNPRLSLIQVLDDPTDMSGDRVNLL-DVLNQPDVVGEFIE 73

Query: 69  -MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCT-KIASRLTRTYTN--QHGLKDNLK 124
            ++++ + EK+FH   +D+  L      R + + CT +IA ++         + LK    
Sbjct: 74  QIMINPEIEKVFHNANYDLKFLG---KKRAKNITCTLEIAQKIPYYILPLPNYQLKTLAT 130

Query: 125 ELLGIN-ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L   N I K +QSSDW    L++ Q++YA  D ++L  + LQ  E LQ     D  T
Sbjct: 131 ALCRFNYIDKQEQSSDWGRRPLTEGQIEYAYLDCIYLAQVHLQLLE-LQVASNPDPKT 187


>gi|119476222|ref|ZP_01616573.1| ribonuclease D [marine gamma proteobacterium HTCC2143]
 gi|119450086|gb|EAW31321.1| ribonuclease D [marine gamma proteobacterium HTCC2143]
          Length = 384

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 82/178 (46%), Gaps = 15/178 (8%)

Query: 18  RYVDAIAVDTETLGLMPRRDRL----CIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLV 71
           ++   +A+DTE +    R D       ++Q+S G G   +D + I     +   L  +L 
Sbjct: 30  QHAAVLALDTEFI----RTDTFYPIGALLQISEGTGCFLIDPLSI----DDFSPLTALLT 81

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           D    K+ H    D+ V    F V  +P+  T+IA+ L   Y    G +   + LL I++
Sbjct: 82  DPAIVKVLHSCSEDLEVFERLFQVLPQPLIDTQIAAGLD-GYGFSLGYQKMTEALLQIHV 140

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           +K +  S+W    L++ Q+ YAA DV +L  +  Q  + L+  GR       C+ L +
Sbjct: 141 AKGETRSNWLQRPLTESQIHYAALDVAYLPEMYQQLKQSLESKGRWQWLLDECSPLTN 198


>gi|269103055|ref|ZP_06155752.1| ribonuclease D [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268162953|gb|EEZ41449.1| ribonuclease D [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 382

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 82/187 (43%), Gaps = 4/187 (2%)

Query: 3   TIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           TI     D+   C AA    AI +DTE +       +L ++QL  G   + +I   A + 
Sbjct: 4   TIITTTADLKMVCQAASSAPAIMLDTEFVRTRTLYPKLGLIQLFDGK-QLSLIDPLAIED 62

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
             P L  +L D+   K+ H    D+ V  +  G    P+  T++ +     +    G   
Sbjct: 63  MEP-LWDLLRDQSVMKVLHACGEDLEVFQHHAGCLPVPMLDTQLMAAFL-GHGVSTGFGA 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            +KE +G+ + K +  ++W A  L+D QL YAA+DV +L  L     EK+   G      
Sbjct: 121 LVKEYVGVELDKGEARTNWLARPLTDRQLNYAAADVFYLLPLYETLLEKVGAAGYCKALE 180

Query: 182 SCCNFLM 188
             CN  M
Sbjct: 181 QECNATM 187


>gi|163752438|ref|ZP_02159629.1| ribonuclease D [Shewanella benthica KT99]
 gi|161327662|gb|EDP98855.1| ribonuclease D [Shewanella benthica KT99]
          Length = 380

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 74/161 (45%), Gaps = 7/161 (4%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R  D + +DTE +       RL ++Q   G     I  +A    N     G+L +     
Sbjct: 29  RQSDLLVLDTEFVRTRTFYARLGLIQAYDGKTLALIDPVAVN--NLSEFWGLLAEPGITT 86

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL--KDNLKELLGINISKAQ 135
           + H    D+ V       +   +F ++IA+ L       HGL     +++ L I++ K +
Sbjct: 87  VLHSCSEDLEVFARNGHCQPANLFDSQIAAALCGL---GHGLGYAKLVEQTLDISLDKGE 143

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             +DW    LS+ QL YAA+DV +L+ L  Q  EKLQ+ GR
Sbjct: 144 SRTDWMKRPLSEAQLNYAANDVYYLYNLYPQLLEKLQQQGR 184


>gi|320157018|ref|YP_004189397.1| ribonuclease D [Vibrio vulnificus MO6-24/O]
 gi|319932330|gb|ADV87194.1| ribonuclease D [Vibrio vulnificus MO6-24/O]
          Length = 390

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 73/163 (44%), Gaps = 11/163 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  GD T+ +I       +      +L D    
Sbjct: 38  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGD-TLSLIDPTV-LTDMSAFTELLNDASVM 95

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL----LGINIS 132
           K+ H    D+ V    FG    P+  T+I +         HGL      L    L + + 
Sbjct: 96  KVLHACGEDLEVFHNAFGAIPVPMVDTQIMAAFL-----GHGLSTGFAALVEQYLNVELD 150

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           K++  +DW A  LSD+QL+YAA+DV +L  L     EK+   G
Sbjct: 151 KSESRTDWLARPLSDKQLEYAAADVHYLLPLYEILLEKVMEAG 193


>gi|254361720|ref|ZP_04977856.1| ribonuclease D [Mannheimia haemolytica PHL213]
 gi|261492043|ref|ZP_05988618.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495020|ref|ZP_05991488.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153093246|gb|EDN74252.1| ribonuclease D [Mannheimia haemolytica PHL213]
 gi|261309336|gb|EEY10571.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261312326|gb|EEY13454.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 372

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 75/176 (42%), Gaps = 3/176 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +        L ++QL  G   V +I        +P  V +L D+   
Sbjct: 23  ARKTKVVALDTEFIRTRTYYPILGLIQLFDGQ-QVSLIDPNTISDFSP-FVSLLADKNII 80

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  Y F     P+  T++ +       +  G    +   L I + K   
Sbjct: 81  KVLHACSEDLEVFEYQFKQLPEPMLDTQVMAAFAGIGISM-GFAKLVSHYLNIELDKGAS 139

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            +DW A  LS EQLQYAA+DV +L  +  +  + L +          C  L+ +A+
Sbjct: 140 RTDWLARPLSAEQLQYAAADVWYLLPVYEKLAQALTKSTWQSAVAEECVALLKKAK 195


>gi|157370999|ref|YP_001478988.1| ribonuclease D [Serratia proteamaculans 568]
 gi|157322763|gb|ABV41860.1| ribonuclease D [Serratia proteamaculans 568]
          Length = 390

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 79/170 (46%), Gaps = 7/170 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IA+DTE +       +L ++QL  G+    +D + I   Q      + +L + +  K  H
Sbjct: 42  IALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPIKQWQP----FIELLSNTQVVKFLH 97

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    F     P+  T+I +  T    +  G    + E + + + K++  +DW
Sbjct: 98  AGSEDLEVFLNAFKTLPTPMVDTQILAAFTGRPMS-CGFATLVAEYMEVELDKSEARTDW 156

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L+++Q  YAA+DV +L  +  +  ++ +  G +  A++ C  L  R
Sbjct: 157 LARPLTEKQCVYAAADVFYLLPMAKRLVQETEEAGWTAAASNECLLLCQR 206


>gi|262394860|ref|YP_003286714.1| ribonuclease D [Vibrio sp. Ex25]
 gi|262338454|gb|ACY52249.1| ribonuclease D [Vibrio sp. Ex25]
          Length = 388

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 82/178 (46%), Gaps = 11/178 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE + +     +L ++QL  G+  + +I         P  V +L D    
Sbjct: 35  AREADVVMLDTEFVRIRTFYPQLGLIQLFDGN-RLSLIDPTELTDMTP-FVALLKDTSVL 92

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGINIS 132
           K+ H    D+ V    FG    P+  T++ +         HGL       ++E LG+ + 
Sbjct: 93  KVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFASLVEEYLGVELD 147

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G  +      + L+ +
Sbjct: 148 KSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTQAGWWEAVQQESDLLVSK 205


>gi|319786955|ref|YP_004146430.1| ribonuclease D [Pseudoxanthomonas suwonensis 11-1]
 gi|317465467|gb|ADV27199.1| ribonuclease D [Pseudoxanthomonas suwonensis 11-1]
          Length = 364

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 77/171 (45%), Gaps = 8/171 (4%)

Query: 10  DIPAECAARYVDA---IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           D PAE   R   A   I +DTE +       RL +VQ++ G    D++ + A     P  
Sbjct: 8   DQPAELLRRLQSAPSRIGLDTEFIRERTFWPRLALVQMAVGG---DVLLVDALVPGMPEA 64

Query: 67  VGMLVDEKRE-KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           +   +D     K+ H    D+       G   RP++ T++A+ L          +  + +
Sbjct: 65  IAAWLDAPHVLKVMHSASEDLVTFRCACGTVPRPMYDTQVAAALAGFGAGMG-YQRLVAQ 123

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           + G  ++K +  SDW    LS  QL+YAA DV HL A+      +L+ LGR
Sbjct: 124 VTGTTLAKGETRSDWMRRPLSPAQLEYAADDVRHLDAVYQATLARLRELGR 174


>gi|70728873|ref|YP_258622.1| ribonuclease D [Pseudomonas fluorescens Pf-5]
 gi|68343172|gb|AAY90778.1| ribonuclease D [Pseudomonas fluorescens Pf-5]
          Length = 377

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (47%), Gaps = 10/117 (8%)

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHG 118
           N   L  +L +    K+ H    D+ VL    G    P+F T++A+     Y N     G
Sbjct: 64  NWQPLAALLENPAVVKVVHACSEDLEVLLRLTGSLPAPLFDTQLAA----AYLNLGFSMG 119

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
               ++E+LGI++ K +  SDW    LS+ Q+ YAA D VHL  +   FTE   RL 
Sbjct: 120 YSRLVQEVLGIDLPKGETRSDWLQRPLSETQVSYAAEDAVHLAQV---FTELRPRLS 173


>gi|269967938|ref|ZP_06181978.1| ribonuclease D [Vibrio alginolyticus 40B]
 gi|269827461|gb|EEZ81755.1| ribonuclease D [Vibrio alginolyticus 40B]
          Length = 388

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 82/178 (46%), Gaps = 11/178 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE + +     +L ++QL  G+  + +I         P  V +L D    
Sbjct: 35  AREADVVMLDTEFVRIRTFYPQLGLIQLFDGN-RLSLIDPTELTDMTP-FVALLKDTSVL 92

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGINIS 132
           K+ H    D+ V    FG    P+  T++ +         HGL       ++E LG+ + 
Sbjct: 93  KVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFASLVEEYLGVELD 147

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G  +      + L+ +
Sbjct: 148 KSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLFDKVTQAGWWEAVQQESDLLVSK 205


>gi|224370825|ref|YP_002604989.1| Rnd [Desulfobacterium autotrophicum HRM2]
 gi|223693542|gb|ACN16825.1| Rnd [Desulfobacterium autotrophicum HRM2]
          Length = 377

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 83/177 (46%), Gaps = 9/177 (5%)

Query: 3   TIRVHEGDIPAECAARYVDA-IAVDTETLGLMPRRDRLCIVQLS-PGDG-TVDIIRIAAG 59
           T+  ++ D+ A C     +  +A D E   +   ++++C+VQ++ P D   VD + I   
Sbjct: 5   TLIENDEDLAARCDLLKTEKRLAFDLEADSMHHFKEKVCLVQMADPNDSFVVDPLSI--- 61

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +   L  +  D    K+FH   FDI  L   F + V  +F T+IA R       +  L
Sbjct: 62  -DDLSVLKPVFEDPAITKVFHGSDFDIRSLDRDFDIHVNNLFDTEIACRFL--GIQKRSL 118

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
              L++   + + K  Q +DWS   LS E + Y+ +DV +L  L     ++L+  GR
Sbjct: 119 AALLEKHFDLTLDKRFQKTDWSRRPLSKEMIAYSVNDVAYLLELSDILKKRLEDEGR 175


>gi|78048167|ref|YP_364342.1| ribonuclease D [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|78036597|emb|CAJ24288.1| ribonuclease D [Xanthomonas campestris pv. vesicatoria str. 85-10]
          Length = 363

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 80/189 (42%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +H  ++     A     I +DTE +       +L +VQ++ GD  + I  +  G   A  
Sbjct: 6   IHPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGDEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       G   RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTAPDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+    T +L   GR +       
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDALTRRLAEQGRLEWLAEDAE 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|218439906|ref|YP_002378235.1| 3'-5' exonuclease [Cyanothece sp. PCC 7424]
 gi|218172634|gb|ACK71367.1| 3'-5' exonuclease [Cyanothece sp. PCC 7424]
          Length = 308

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 80/166 (48%), Gaps = 20/166 (12%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQL--SPGDGTVDIIRIAAGQKNAPNLV-----GMLVD 72
           V  + +DTE+  L  ++ RL ++Q+   P D       I     N P++V      ++V+
Sbjct: 20  VKILWLDTESTDLNSKKSRLSLIQVLAYPEDTNGSRTYIFDVLDN-PDIVDYFIEKIMVN 78

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY---TNQHGLKDNLKELLG- 128
           ++  KIFH  + D+  L    G + + V CT   S+    +      H LK  L E L  
Sbjct: 79  DQINKIFHNAQHDLQFLG---GKKAKNVTCTLKLSKTIPYHILPVPNHTLK-TLTEYLTD 134

Query: 129 -INISKAQQSSDWSADDLSDEQLQYAASDVV---HLHALRLQFTEK 170
             N+SK +Q+SDWS   LS +QL YA  D V   H+H   L+  ++
Sbjct: 135 FKNVSKEEQTSDWSQRPLSQKQLDYAKMDPVYLAHIHGRLLELNQQ 180


>gi|332667981|ref|YP_004450769.1| 3'-5' exonuclease [Haliscomenobacter hydrossis DSM 1100]
 gi|332336795|gb|AEE53896.1| 3'-5' exonuclease [Haliscomenobacter hydrossis DSM 1100]
          Length = 395

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 68/144 (47%), Gaps = 3/144 (2%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           ++ +  D+E +G      RLC++Q++   G   I       KN    + M+ +    K+ 
Sbjct: 23  IEWMCFDSEFVGEKRFTTRLCLIQVATRHGLFLIDPFPL--KNLDPFLEMIENPNIVKVT 80

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H G  D  +L+ +FG   +  F T+IA+     Y      K  ++  L IN++K+   +D
Sbjct: 81  HAGENDYRLLYASFGTIPKNTFDTQIAAGFL-GYRYPLAFKKLVETELKINMNKSFTVAD 139

Query: 140 WSADDLSDEQLQYAASDVVHLHAL 163
           W A   +  QL+YA  D+  L+ L
Sbjct: 140 WEARPFNQNQLKYAIQDIEPLYDL 163


>gi|294626013|ref|ZP_06704623.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292599683|gb|EFF43810.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 363

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 82/189 (43%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
            H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  
Sbjct: 6   THPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L+     K+ H    D+       G   RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLIATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L   GR +      +
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELTRRLTEQGRLEWLAEDAD 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|154508933|ref|ZP_02044575.1| hypothetical protein ACTODO_01449 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798567|gb|EDN80987.1| hypothetical protein ACTODO_01449 [Actinomyces odontolyticus ATCC
           17982]
          Length = 414

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 2/95 (2%)

Query: 94  GVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYA 153
           G+R   +F T+IA+RL      + GL   ++++LG+ + K  Q+SDWS   L  E L+YA
Sbjct: 117 GLRPSTLFDTEIAARLI--GLERFGLAAVVEQVLGLGLVKDHQASDWSVRPLPKEWLRYA 174

Query: 154 ASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           A DV  L  L  + +++L  +GR + A     + +
Sbjct: 175 ALDVELLTELYYRLSKRLDEMGRWEWAQQEFGYAL 209


>gi|88705065|ref|ZP_01102777.1| ribonuclease D [Congregibacter litoralis KT71]
 gi|88700760|gb|EAQ97867.1| ribonuclease D [Congregibacter litoralis KT71]
          Length = 370

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 66/143 (46%), Gaps = 7/143 (4%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREK 77
            D IAVDTE +        + ++QL   D    +D + I+    N   L  +L D    K
Sbjct: 22  ADEIAVDTEFMRRNSYYPHIALLQLCTDDHAWLIDPLTIS----NLDGLRALLTDSACIK 77

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +  GV   P+  T+ A+ L        G +  +KELLG+ + K +  
Sbjct: 78  VLHSCSEDLEVFRHWLGVLPSPLVDTQRATALLGKGFGL-GYRALVKELLGVELDKGETR 136

Query: 138 SDWSADDLSDEQLQYAASDVVHL 160
           SDW    LS+ Q  YAA DV+ L
Sbjct: 137 SDWLKRPLSESQCHYAALDVLEL 159


>gi|325928069|ref|ZP_08189282.1| ribonuclease D [Xanthomonas perforans 91-118]
 gi|325541567|gb|EGD13096.1| ribonuclease D [Xanthomonas perforans 91-118]
          Length = 363

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 80/189 (42%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +H  ++     A     I +DTE +       +L +VQ++ GD  + I  +  G   A  
Sbjct: 6   IHPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGDEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       G   RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+    T +L   GR +       
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDALTRRLAEQGRLEWLAEDAE 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|188991267|ref|YP_001903277.1| hypothetical protein xccb100_1872 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167733027|emb|CAP51225.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 362

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 74/156 (47%), Gaps = 6/156 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE +       +L +VQ++ G+  + I  +  G  +A  L   LV     K+ H  
Sbjct: 22  IGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMTDA--LKDWLVAPDIVKVMHSA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+       GV  RP+F T+IA+ L          K  ++E+ G  ++K +  SDW  
Sbjct: 80  SEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEVTGTLLTKGETRSDWMR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKL---QRLG 175
             LS  QL+YAA DV +L A+    T KL    RLG
Sbjct: 139 RPLSPAQLEYAADDVRYLFAIHDALTAKLTAQDRLG 174


>gi|293192610|ref|ZP_06609564.1| putative ribonuclease D [Actinomyces odontolyticus F0309]
 gi|292820117|gb|EFF79114.1| putative ribonuclease D [Actinomyces odontolyticus F0309]
          Length = 414

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 51/87 (58%), Gaps = 2/87 (2%)

Query: 94  GVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYA 153
           G+R   +F T+IA+RL      + GL   ++++LG+ + K  Q+SDWS   L  E L+YA
Sbjct: 117 GLRPSALFDTEIAARLI--GLERFGLAAVVEQVLGLGLVKDHQASDWSVRPLPKEWLRYA 174

Query: 154 ASDVVHLHALRLQFTEKLQRLGRSDLA 180
           A DV  L  L  + +++L  +GR + A
Sbjct: 175 ALDVELLTELYYRLSKRLDEMGRWEWA 201


>gi|289665658|ref|ZP_06487239.1| ribonuclease D [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 210

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 77/173 (44%), Gaps = 6/173 (3%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
            H  ++     A     I +DTE +       +L +VQL+ G+  + I  +  G   A  
Sbjct: 6   THPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQLAIGEEILLIDPLIPGMNEA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQ---RLG 175
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L    RLG
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPSQLEYAADDVRYLFAIHDELTRRLTEQDRLG 175


>gi|21243147|ref|NP_642729.1| ribonuclease D [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108668|gb|AAM37265.1| ribonuclease D [Xanthomonas axonopodis pv. citri str. 306]
          Length = 363

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 82/189 (43%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
            H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  
Sbjct: 6   THPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L+     K+ H    D+       G   RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLIATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L   GR +      +
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELTRRLAEQGRLEWLAEDAD 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|262375228|ref|ZP_06068461.1| ribonuclease D [Acinetobacter lwoffii SH145]
 gi|262309482|gb|EEY90612.1| ribonuclease D [Acinetobacter lwoffii SH145]
          Length = 380

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 10/118 (8%)

Query: 75  REKIFHYGRFDIAVLF-YTFGVRVRPVFCTKIASRLTRTYTNQHGLK----DNLKELLGI 129
           ++ IFH    DI +++ YT    +  VF T++           HGL+    + LK++L +
Sbjct: 72  QQNIFHACSEDIDLIYHYTQKKSLSNVFDTQVGMSFLG-----HGLQVSYQNALKQMLEV 126

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +I K Q  SDW A  LS EQL YAA+DV +L  L  +  + L      D A   C FL
Sbjct: 127 DIEKDQTRSDWLARPLSSEQLLYAANDVHYLVQLSEKIKQDLDSKDLLDFALQDCRFL 184


>gi|294666468|ref|ZP_06731711.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292603774|gb|EFF47182.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 363

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 81/189 (42%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
            H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  
Sbjct: 6   THPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L+     K+ H    D+       G   RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLIATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L   GR +       
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELTRRLTEQGRLEWQAEDAE 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|260366009|ref|ZP_05778494.1| ribonuclease D [Vibrio parahaemolyticus K5030]
 gi|308111259|gb|EFO48799.1| ribonuclease D [Vibrio parahaemolyticus K5030]
          Length = 292

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 16/173 (9%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 27  DLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTELT----DMTSF 82

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           + +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 83  IELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 137

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G
Sbjct: 138 VEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAG 190


>gi|226945355|ref|YP_002800428.1| ribonuclease D protein [Azotobacter vinelandii DJ]
 gi|226720282|gb|ACO79453.1| ribonuclease D protein [Azotobacter vinelandii DJ]
          Length = 375

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 10/168 (5%)

Query: 8   EGDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           +  + + CA  R +  +A+DTE + +     +  +VQ+  G     I  +  G      L
Sbjct: 11  DASLASHCARWRQLPFVALDTEFVRVDTFYPQTGLVQVGDGRSAYLIDPLDIGDWRP--L 68

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNL 123
             +L D    K+ H    D+ VL    G    P+F T++A+     Y N     G    +
Sbjct: 69  AALLEDPAVVKVLHACSEDLEVLLRLTGSLPLPLFDTQLAA----AYLNLGFSMGYSRLV 124

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
           + +LGI + K +  SDW    LS+ Q++YAA D VHL  L +    +L
Sbjct: 125 QAVLGIELPKGETRSDWLQRPLSELQIRYAAEDAVHLAELYVALGARL 172


>gi|10176710|dbj|BAB09932.1| nucleolar protein-like [Arabidopsis thaliana]
          Length = 834

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDI--IRIAAGQKNAPNLVGMLVDE 73
           R V+  AVD E       +   C++Q+S    D  VD   +RI  G    P L  +  D 
Sbjct: 240 RSVEEFAVDLEHNQYRSFQGLTCLMQISTRTEDYIVDTFKLRIHIG----PYLREIFKDP 295

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K++K+ H    DI  L   FG+ V  +F T  ASR+     N   L+  L+   G+  +K
Sbjct: 296 KKKKVMHGADRDIIWLQRDFGIYVCNLFDTGQASRVLNLERN--SLEFLLQHFCGVTANK 353

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             Q++DW    L +E  +YA  D  +L  +      +LQR+ + D  T
Sbjct: 354 EYQNADWRIRPLPEEMTRYAREDTHYLLYIYDLIKLELQRMAKDDAHT 401


>gi|15239221|ref|NP_198440.1| 3'-5' exonuclease domain-containing protein / helicase and RNase D
           C-terminal domain-containing protein / HRDC
           domain-containing protein [Arabidopsis thaliana]
          Length = 838

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDI--IRIAAGQKNAPNLVGMLVDE 73
           R V+  AVD E       +   C++Q+S    D  VD   +RI  G    P L  +  D 
Sbjct: 245 RSVEEFAVDLEHNQYRSFQGLTCLMQISTRTEDYIVDTFKLRIHIG----PYLREIFKDP 300

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K++K+ H    DI  L   FG+ V  +F T  ASR+     N   L+  L+   G+  +K
Sbjct: 301 KKKKVMHGADRDIIWLQRDFGIYVCNLFDTGQASRVLNLERN--SLEFLLQHFCGVTANK 358

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             Q++DW    L +E  +YA  D  +L  +      +LQR+ + D  T
Sbjct: 359 EYQNADWRIRPLPEEMTRYAREDTHYLLYIYDLIKLELQRMAKDDAHT 406


>gi|262199835|ref|YP_003271044.1| ribonuclease D [Haliangium ochraceum DSM 14365]
 gi|262083182|gb|ACY19151.1| Ribonuclease D [Haliangium ochraceum DSM 14365]
          Length = 400

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 39  LCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV-DEKREKIFHYGRFDIAVLFYTFGVRV 97
           L +VQ+S GD     I +       P  V  L+ D     + H  + D+ +L   F +  
Sbjct: 46  LALVQVSWGDPEAPEIALIDSVAVDPTPVLRLIGDPAVVSVAHAAKQDLGILAARFDIFA 105

Query: 98  RPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDV 157
              + T+IA+        Q G    +  LLG+ + KA Q + W    LS  QL+YAA DV
Sbjct: 106 ENFWDTQIAAAFV-GMAEQIGYGKLVDALLGVQLDKASQFTKWLERPLSPAQLRYAADDV 164

Query: 158 VHLHALRLQFTEKLQRLGR 176
            +L  +    +++L  LGR
Sbjct: 165 RYLPRVWAHLSQRLDELGR 183


>gi|260895639|ref|ZP_05904135.1| ribonuclease D [Vibrio parahaemolyticus Peru-466]
 gi|308088174|gb|EFO37869.1| ribonuclease D [Vibrio parahaemolyticus Peru-466]
          Length = 325

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 16/173 (9%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 27  DLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTELT----DMTSF 82

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           + +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 83  IELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 137

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G
Sbjct: 138 VEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAG 190


>gi|152996550|ref|YP_001341385.1| ribonuclease D [Marinomonas sp. MWYL1]
 gi|150837474|gb|ABR71450.1| ribonuclease D [Marinomonas sp. MWYL1]
          Length = 384

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 65/138 (47%), Gaps = 3/138 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTE +          ++Q+S GD  V I  ++  +     L  ++VD    K+FH  
Sbjct: 37  IAVDTEFIRRTTYFPITGLIQISEGDKAVLIDPLSIDEWEP--LRNLMVDPSVMKVFHAC 94

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V     GV   P + T+I         +   +K  + E L I ++K +  SDW  
Sbjct: 95  SEDLDVFDRLLGVLPTPFYDTQIGEAYASAQWSLSYVK-LIHEYLQIEVAKDETRSDWVQ 153

Query: 143 DDLSDEQLQYAASDVVHL 160
             L+D Q +YAA DVV+L
Sbjct: 154 RPLTDAQKRYAALDVVYL 171


>gi|153840116|ref|ZP_01992783.1| ribonuclease D [Vibrio parahaemolyticus AQ3810]
 gi|149746274|gb|EDM57352.1| ribonuclease D [Vibrio parahaemolyticus AQ3810]
          Length = 341

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 16/173 (9%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 27  DLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTELT----DMTSF 82

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           + +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 83  IELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 137

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G
Sbjct: 138 VEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAG 190


>gi|21231744|ref|NP_637661.1| ribonuclease D [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66768130|ref|YP_242892.1| ribonuclease D [Xanthomonas campestris pv. campestris str. 8004]
 gi|21113449|gb|AAM41585.1| ribonuclease D [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573462|gb|AAY48872.1| ribonuclease D [Xanthomonas campestris pv. campestris str. 8004]
          Length = 362

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 74/156 (47%), Gaps = 6/156 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE +       +L +VQ++ G+  + I  +  G  +A  L   L+     K+ H  
Sbjct: 22  IGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMTDA--LKDWLIAPDIVKVMHSA 79

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+       GV  RP+F T+IA+ L          K  ++E+ G  ++K +  SDW  
Sbjct: 80  SEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEVTGTLLTKGETRSDWMR 138

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKL---QRLG 175
             LS  QL+YAA DV +L A+    T KL    RLG
Sbjct: 139 RPLSPAQLEYAADDVRYLFAIHDALTAKLTAQDRLG 174


>gi|160892401|gb|ABX52080.1| RRP6-like protein 2 [Arabidopsis thaliana]
 gi|332006642|gb|AED94025.1| exosome complex exonuclease RRP6 [Arabidopsis thaliana]
          Length = 870

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDI--IRIAAGQKNAPNLVGMLVDE 73
           R V+  AVD E       +   C++Q+S    D  VD   +RI  G    P L  +  D 
Sbjct: 277 RSVEEFAVDLEHNQYRSFQGLTCLMQISTRTEDYIVDTFKLRIHIG----PYLREIFKDP 332

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K++K+ H    DI  L   FG+ V  +F T  ASR+     N   L+  L+   G+  +K
Sbjct: 333 KKKKVMHGADRDIIWLQRDFGIYVCNLFDTGQASRVLNLERN--SLEFLLQHFCGVTANK 390

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             Q++DW    L +E  +YA  D  +L  +      +LQR+ + D  T
Sbjct: 391 EYQNADWRIRPLPEEMTRYAREDTHYLLYIYDLIKLELQRMAKDDAHT 438


>gi|330808098|ref|YP_004352560.1| ribonuclease D [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327376206|gb|AEA67556.1| ribonuclease D [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 377

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 53/113 (46%), Gaps = 7/113 (6%)

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHG 118
           N   L  +L +    K+ H    D+ VL    G    P+F T++A+     Y N     G
Sbjct: 64  NWQPLAALLENPAVLKVLHACSEDLEVLLRLTGSLPAPLFDTQLAA----AYLNLGFSMG 119

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
               ++E+LGI + K +  SDW    LS+ Q+ YAA D VHL  + +    KL
Sbjct: 120 YSRLVQEVLGIELPKGETRSDWLQRPLSETQISYAAEDAVHLAEVFVLLRPKL 172


>gi|325914723|ref|ZP_08177061.1| ribonuclease D [Xanthomonas vesicatoria ATCC 35937]
 gi|325539000|gb|EGD10658.1| ribonuclease D [Xanthomonas vesicatoria ATCC 35937]
          Length = 364

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 76/171 (44%), Gaps = 3/171 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
            H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  
Sbjct: 6   THPSELTERLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNEA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + + +L  L R
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSASQLEYAADDVRYLFAIHDELSRRLTELDR 173


>gi|260878202|ref|ZP_05890557.1| ribonuclease D [Vibrio parahaemolyticus AN-5034]
 gi|308090210|gb|EFO39905.1| ribonuclease D [Vibrio parahaemolyticus AN-5034]
          Length = 372

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 85/188 (45%), Gaps = 16/188 (8%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 27  DLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTELT----DMTSF 82

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           + +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 83  IELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 137

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  +    
Sbjct: 138 VEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEAVQQ 197

Query: 183 CCNFLMDR 190
             + L+ +
Sbjct: 198 ESDLLVSK 205


>gi|28897645|ref|NP_797250.1| ribonuclease D [Vibrio parahaemolyticus RIMD 2210633]
 gi|28805858|dbj|BAC59134.1| ribonuclease D [Vibrio parahaemolyticus RIMD 2210633]
 gi|328473373|gb|EGF44221.1| ribonuclease D [Vibrio parahaemolyticus 10329]
          Length = 388

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 85/188 (45%), Gaps = 16/188 (8%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 27  DLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTELT----DMTSF 82

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           + +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 83  IELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 137

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  +    
Sbjct: 138 VEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEAVQQ 197

Query: 183 CCNFLMDR 190
             + L+ +
Sbjct: 198 ESDLLVSK 205


>gi|206576967|ref|YP_002237811.1| ribonuclease D [Klebsiella pneumoniae 342]
 gi|290508867|ref|ZP_06548238.1| ribonuclease D [Klebsiella sp. 1_1_55]
 gi|206566025|gb|ACI07801.1| ribonuclease D [Klebsiella pneumoniae 342]
 gi|289778261|gb|EFD86258.1| ribonuclease D [Klebsiella sp. 1_1_55]
          Length = 375

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 79/168 (47%), Gaps = 7/168 (4%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGT-VDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGR 83
           +DTE +       +L ++QL   DGT V +I        AP +  +L+++   K  H G 
Sbjct: 27  LDTEFVRTRTYYPQLGLLQLF--DGTQVSLIDPLTISDWAP-MRELLLNQDVTKYLHAGS 83

Query: 84  FDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            D+ V    F +  +P+  T+I A+   R  +   G    ++E  G+ + K++  +DW A
Sbjct: 84  EDLEVFLNAFSLMPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVALDKSESRTDWLA 141

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 142 RPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLSAALDECRLMQQR 189


>gi|262194484|ref|YP_003265693.1| 3'-5' exonuclease [Haliangium ochraceum DSM 14365]
 gi|262077831|gb|ACY13800.1| 3'-5' exonuclease [Haliangium ochraceum DSM 14365]
          Length = 925

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 39  LCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVR 98
           LC+VQL+  + TV +I   A     P +  +L      KI H  +F+ +V F   G+ + 
Sbjct: 791 LCLVQLAAPEYTV-VIDARAVDDLGP-VSELLASRAVVKIIHNAQFERSV-FRKLGMDIE 847

Query: 99  PVFCT-KIASRL-TRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASD 156
            VF T K++ RL  R     HGL       LG  + K +Q SDW+   L+  QL YAA D
Sbjct: 848 NVFDTLKVSRRLRGRKREGGHGLGAVCARELGRELDKHEQRSDWTLRPLTQRQLDYAALD 907

Query: 157 VVHLHALRLQFTEKL 171
              L  L  +FT +L
Sbjct: 908 AEVLLVLHERFTREL 922


>gi|288934742|ref|YP_003438801.1| ribonuclease D [Klebsiella variicola At-22]
 gi|288889451|gb|ADC57769.1| ribonuclease D [Klebsiella variicola At-22]
          Length = 371

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 79/168 (47%), Gaps = 7/168 (4%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGT-VDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGR 83
           +DTE +       +L ++QL   DGT V +I        AP +  +L+++   K  H G 
Sbjct: 23  LDTEFVRTRTYYPQLGLLQLF--DGTQVSLIDPLTISDWAP-MRELLLNQDVTKYLHAGS 79

Query: 84  FDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
            D+ V    F +  +P+  T+I A+   R  +   G    ++E  G+ + K++  +DW A
Sbjct: 80  EDLEVFLNAFSLMPQPLIDTQILAAFCGRPMS--WGFASMVEEYSGVALDKSESRTDWLA 137

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 138 RPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLSAALDECRLMQQR 185


>gi|260901199|ref|ZP_05909594.1| ribonuclease D [Vibrio parahaemolyticus AQ4037]
 gi|308106837|gb|EFO44377.1| ribonuclease D [Vibrio parahaemolyticus AQ4037]
          Length = 354

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 16/173 (9%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNL 66
           D+   CA AR  D + +DTE + +     +L ++QL  G     +D   +     +  + 
Sbjct: 27  DLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTELT----DMTSF 82

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN---- 122
           + +L D    K+ H    D+ V    FG    P+  T++ +         HGL       
Sbjct: 83  IELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFL-----GHGLSTGFATL 137

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G
Sbjct: 138 VEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAG 190


>gi|156933634|ref|YP_001437550.1| ribonuclease D [Cronobacter sakazakii ATCC BAA-894]
 gi|156531888|gb|ABU76714.1| hypothetical protein ESA_01456 [Cronobacter sakazakii ATCC BAA-894]
          Length = 369

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE +       +L ++QL  G+  V +I        AP    +L D+   
Sbjct: 15  ARTQRALALDTEFVRTRTYYPQLGLIQLYDGEN-VALIDPLTITDWAP-FQALLQDQNVT 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F +   P   T++ +     +    G    ++   G+ + K++ 
Sbjct: 73  KFLHAGSEDLEVFQNAFSMMPDPFIDTQVLASFV-GHPLSCGFATLVEHHTGVVLDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  L++ Q  YAA+DV +L  +  +  E+++  G    A + C  +  R
Sbjct: 132 RTDWLARPLTERQCDYAAADVWYLLPIAHKLMEQVREAGWLTAAINECRLMTQR 185


>gi|149196457|ref|ZP_01873512.1| hypothetical protein LNTAR_14907 [Lentisphaera araneosa HTCC2155]
 gi|149140718|gb|EDM29116.1| hypothetical protein LNTAR_14907 [Lentisphaera araneosa HTCC2155]
          Length = 372

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 48/102 (47%), Gaps = 1/102 (0%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ +         + +F T++A   T     Q  L     E++ I ISK QQ
Sbjct: 76  KILHSPDQDLKLFKLFCDAEAKNIFDTQLAYAFTGA-PKQVSLAKLCLEMMDIEISKTQQ 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            SDW+   L D QL YAA DV +L  +     EKL+  GR D
Sbjct: 135 VSDWTKRPLKDSQLNYAAEDVRYLIEITETLREKLKENGRYD 176


>gi|71065355|ref|YP_264082.1| putative ribonuclease D [Psychrobacter arcticus 273-4]
 gi|71038340|gb|AAZ18648.1| putative ribonuclease D [Psychrobacter arcticus 273-4]
          Length = 432

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 73/155 (47%), Gaps = 8/155 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +       RL +VQL+ G+    +  + A Q     L   L+ +    I+H  
Sbjct: 72  VALDTEFIKRDTYYPRLALVQLNTGNH---VYLLDAPQLQLSELWQALI-KVDVAIWHAC 127

Query: 83  RFDIAVLFYTFGVR-VRPVFCTKIA-SRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             D+ + +   G   +  +F T+IA S LT     Q G +  L E L ++I K Q  SDW
Sbjct: 128 GEDLGIFYLLSGCPPLTNIFDTQIALSYLTGQL--QMGYQQALDEQLDMHIDKEQSQSDW 185

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
               LSDEQ QYA  DV  L AL L     L+  G
Sbjct: 186 LQRPLSDEQEQYAIDDVRFLPALYLSLEYALKSQG 220


>gi|262372600|ref|ZP_06065879.1| ribonuclease D [Acinetobacter junii SH205]
 gi|262312625|gb|EEY93710.1| ribonuclease D [Acinetobacter junii SH205]
          Length = 380

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (55%), Gaps = 12/104 (11%)

Query: 71  VDEKREKIFHYGRFDIAVLF-YTFGVRVRPVFCTKIASRLTRTYTNQHGLK----DNLKE 125
           V E ++ IFH    DI +++ Y     ++ VF T++A          HGL+    + LK 
Sbjct: 68  VFEAQQNIFHACGEDIDLIYHYADQKPLKNVFDTQVAMAFLG-----HGLQVSYQNALKT 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHAL--RLQF 167
            L I+I K Q  SDW A  LS EQ+ YAA+DV++L+ L  RL+F
Sbjct: 123 CLNIDIDKDQTRSDWLARPLSQEQMSYAANDVLYLNKLAERLKF 166


>gi|325107025|ref|YP_004268093.1| ribonuclease D [Planctomyces brasiliensis DSM 5305]
 gi|324967293|gb|ADY58071.1| Ribonuclease D [Planctomyces brasiliensis DSM 5305]
          Length = 401

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 5/168 (2%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A DTE +     R RLC++Q    +  V +        +      ++ DE+ E I H G
Sbjct: 25  VAFDTEFVSEFTFRPRLCLLQFGTSEEKVAVDPFQLT--DLTPWWEIMADEQTEVIIHGG 82

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRL-TRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
           R +I   ++  G + + +   +I   L +R +   H     +++++   +   +  +DWS
Sbjct: 83  REEILFCWHAIGKKPQNLIDVQIVQGLLSRGFPLSHSAL--VQKVVRKKVHGKETRTDWS 140

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
              L+ +Q+ YA  DVVHL  +  +   +L++  R+  A   C   +D
Sbjct: 141 KRPLTTKQINYAIEDVVHLIDIAEKQKVRLKKTKRTTWADEECRQFVD 188


>gi|254508462|ref|ZP_05120581.1| ribonuclease D [Vibrio parahaemolyticus 16]
 gi|219548574|gb|EED25580.1| ribonuclease D [Vibrio parahaemolyticus 16]
          Length = 386

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 11/175 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR VD + +DTE +       +L ++QL  G+  + +I      +  P  V +L D    
Sbjct: 34  AREVDVVMLDTEFVRTRTFYPQLGLIQLFDGE-QLSLIDPTELDEMTP-FVELLQDTSVL 91

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL----LGINIS 132
           K+ H    D+ V   +FG    P+  T++ +         HGL      L    L + + 
Sbjct: 92  KVLHACGEDLEVFQNSFGCLPYPMVDTQVMAAFL-----GHGLSTGFASLVEHYLQVELD 146

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           K++  +DW A  L+D+QL YAA+DV +L  L  +    +   G  + A    + L
Sbjct: 147 KSESRTDWLARPLTDKQLDYAAADVFYLLPLYEKLLNAVTEAGWWEAAQQESDLL 201


>gi|225849884|ref|YP_002730118.1| DNA polymerase I [Persephonella marina EX-H1]
 gi|225644858|gb|ACO03044.1| DNA polymerase I [Persephonella marina EX-H1]
          Length = 584

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 6/131 (4%)

Query: 52  DIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRL-T 110
           D+ RI    ++   L+     E +  I H  +FDI  L   FG+  + VF T IAS+L +
Sbjct: 61  DMFRIPQFSEHLKELL-----ENKGVIGHNLKFDIKFLKTNFGIFPQIVFDTMIASQLLS 115

Query: 111 RTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEK 170
                +H L      L   ++ K+QQ S W   +L++EQL+YAA DV  L  +     ++
Sbjct: 116 EDSREKHSLSALSYRLTDNHLDKSQQRSPWGIKNLTEEQLRYAAKDVQVLREIFPVLRDE 175

Query: 171 LQRLGRSDLAT 181
           L R+     AT
Sbjct: 176 LNRIETPHKAT 186


>gi|15827504|ref|NP_301767.1| hypothetical protein ML1040 [Mycobacterium leprae TN]
 gi|221229981|ref|YP_002503397.1| hypothetical protein MLBr_01040 [Mycobacterium leprae Br4923]
 gi|699161|gb|AAA62926.1| u1764u [Mycobacterium leprae]
 gi|13093054|emb|CAC31421.1| conserved hypothetical protein [Mycobacterium leprae]
 gi|219933088|emb|CAR71135.1| conserved hypothetical protein [Mycobacterium leprae Br4923]
          Length = 429

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 79/168 (47%), Gaps = 9/168 (5%)

Query: 24  AVDTETLGLMPRRDRLCIVQLSPGD-GTVDIIRIAAGQKNAPNLVGMLVDE---KREKIF 79
           AVDTE        +R  ++Q+   + GTV I  ++ G  N P      V E   K E I 
Sbjct: 51  AVDTERASGFRYSNRAYLIQIRRANAGTVLIDPVSHG--NDPLTALRPVAEVISKDEWIL 108

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H    D+  L    G+R   ++ T++A RL     ++  L   ++ LLG  ++K   ++D
Sbjct: 109 HSADQDLPCLA-EVGMRPPALYDTELAGRLA--GFDRVNLATMVQRLLGFELAKGHGAAD 165

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           WS   L  + L YAA DV  L  LR   ++ L    ++D AT   N+L
Sbjct: 166 WSKRPLPSDWLNYAALDVELLIELRTAISKVLAEQDKTDWATQEFNYL 213


>gi|59712314|ref|YP_205090.1| ribonuclease D [Vibrio fischeri ES114]
 gi|59480415|gb|AAW86202.1| ribonuclease D [Vibrio fischeri ES114]
          Length = 373

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (46%), Gaps = 11/152 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           + +DTE +       RL ++Q+  G+    VD + I     +   L  +L +E   K+ H
Sbjct: 25  LMLDTEFVRTRTLYARLGLIQMFDGETLALVDPVEI----DDLTPLWDLLKNESVTKVLH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+ V  +  G    P+  T+I +     Y    G    + + LGI + K +  +DW
Sbjct: 81  ACGEDLEVFQHYAGCMPTPMIDTQIMAAFL-GYGLSTGFAKLVSDYLGIELDKGEARTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
            A  LSD+QL YAA+DV +L    L   EKLQ
Sbjct: 140 MARPLSDKQLHYAAADVHYL----LPLFEKLQ 167


>gi|289549017|ref|YP_003474005.1| DNA-directed DNA polymerase [Thermocrinis albus DSM 14484]
 gi|289182634|gb|ADC89878.1| DNA-directed DNA polymerase [Thermocrinis albus DSM 14484]
          Length = 575

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 77/150 (51%), Gaps = 11/150 (7%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI-AAGQKNAPNLVGMLVDEKREKIFHYGR 83
           +DTET G     DRL +VQL  G G + ++ +   G++    L  +L   ++  + H  +
Sbjct: 27  LDTETTG-----DRLRLVQLG-GQGEIFLLDLFELGERGVLFLKELL--SQKGVVGHNLK 78

Query: 84  FDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSAD 143
           FD+  L Y + +    VF T +AS+L     ++H L+      LG  + K+ Q SDW + 
Sbjct: 79  FDLKYL-YRYHIEPYAVFDTMVASQLL-AELDRHSLQSVAMHYLGQVLDKSLQLSDWGSR 136

Query: 144 DLSDEQLQYAASDVVHLHALRLQFTEKLQR 173
            L+  QL+YAA DVV +  L     EKL +
Sbjct: 137 VLTKAQLEYAALDVVVVRDLFPILLEKLNQ 166


>gi|326384419|ref|ZP_08206099.1| 3'-5' exonuclease [Gordonia neofelifaecis NRRL B-59395]
 gi|326196764|gb|EGD53958.1| 3'-5' exonuclease [Gordonia neofelifaecis NRRL B-59395]
          Length = 407

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 78/181 (43%), Gaps = 11/181 (6%)

Query: 13  AECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGMLV 71
           AE   R    IAVDTE         R  +VQL   G G+  I  I     + P+ +  L+
Sbjct: 40  AELIGRGTGPIAVDTERASGYRYSQRAYLVQLKRAGSGSFLIDPI-----SHPDALSPLI 94

Query: 72  D--EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           D  +  E I H    D+  L    G     +F T++A RL      +  L   + E L +
Sbjct: 95  DALDGPEWILHAADQDLPCL-RELGFTPTTLFDTELAGRLLNI--PKVNLAAMVAEFLHL 151

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            ++K   ++DWS   L D+ L YAA DV  L  LR    + L   GR + A     +++ 
Sbjct: 152 GLAKGHGAADWSRRPLPDDWLNYAALDVEVLVELRDAVADALSEAGRDEWAAQEFAYVLA 211

Query: 190 R 190
           R
Sbjct: 212 R 212


>gi|156089519|ref|XP_001612166.1| 3'-5' exonuclease domain containing protein [Babesia bovis]
 gi|154799420|gb|EDO08598.1| 3'-5' exonuclease domain containing protein [Babesia bovis]
          Length = 230

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (50%), Gaps = 5/122 (4%)

Query: 36  RDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG-MLVDEKREKIFHYGRFDIAVLFYTFG 94
           R R  ++Q++  D  +  +    G  + P+ V  +L D    KI H    D+ +++  FG
Sbjct: 80  RTRPAVIQIASNDICLVYLMYKIG--HLPSSVSHILSDPDILKISHGAPSDMRLMYRHFG 137

Query: 95  VRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAA 154
           VR R      + S           LK  ++ +LG+ +SK QQ S+W A +LS +Q++YAA
Sbjct: 138 VRSRSF--VDLQSVCEELQLRPCSLKSVVQRVLGLRLSKKQQCSNWEAAELSQQQIKYAA 195

Query: 155 SD 156
           +D
Sbjct: 196 TD 197


>gi|197335934|ref|YP_002156528.1| ribonuclease D [Vibrio fischeri MJ11]
 gi|197317424|gb|ACH66871.1| ribonuclease D [Vibrio fischeri MJ11]
          Length = 373

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (46%), Gaps = 11/152 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           + +DTE +       RL ++Q+  G+    VD + I     +   L  +L +E   K+ H
Sbjct: 25  LMLDTEFVRTRTLYARLGLIQMFDGETLALVDPVEI----DDLTPLWDLLKNESVTKVLH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+ V  +  G    P+  T+I +     Y    G    + + LGI + K +  +DW
Sbjct: 81  ACGEDLEVFQHYAGCMPTPMIDTQIMAAFL-GYGLSTGFAKLVSDYLGIELDKGEARTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
            A  LSD+QL YAA+DV +L    L   EKLQ
Sbjct: 140 MARPLSDKQLHYAAADVHYL----LPLFEKLQ 167


>gi|84624243|ref|YP_451615.1| ribonuclease D [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188576150|ref|YP_001913079.1| ribonuclease D [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84368183|dbj|BAE69341.1| ribonuclease D [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188520602|gb|ACD58547.1| ribonuclease D [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 363

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 78/173 (45%), Gaps = 6/173 (3%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  
Sbjct: 6   IHPSELTDRLQAARPARIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL---QRLG 175
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L    RLG
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPSQLEYAADDVRYLFAIHDELTRRLTEQNRLG 175


>gi|93005631|ref|YP_580068.1| 3'-5' exonuclease [Psychrobacter cryohalolentis K5]
 gi|92393309|gb|ABE74584.1| 3'-5' exonuclease [Psychrobacter cryohalolentis K5]
          Length = 380

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 75/166 (45%), Gaps = 8/166 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE +       RL ++QL+ G+    +  + A Q     L   L+ +    I+H  
Sbjct: 20  VALDTEFIKRDTYYPRLALIQLNTGN---HVYLLDAPQLQLSELWQALM-KVDVAIWHAC 75

Query: 83  RFDIAVLFYTFGVR-VRPVFCTKIA-SRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             D+ + +   G   +  +F T+IA S LT     Q G +  L E L ++I K Q  SDW
Sbjct: 76  GEDLGIFYLLSGCPPLTNIFDTQIALSYLTGQL--QMGYQQALDEQLDMHIDKEQSQSDW 133

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
               LSDEQ QYA  DV  L AL L     L+  G  +     C  
Sbjct: 134 LQRPLSDEQEQYAIDDVRFLPALYLSLEYALKSQGLYEYVWEDCQL 179


>gi|209694623|ref|YP_002262551.1| ribonuclease D (rnase d) [Aliivibrio salmonicida LFI1238]
 gi|208008574|emb|CAQ78749.1| ribonuclease D (rnase d) [Aliivibrio salmonicida LFI1238]
          Length = 374

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 72/152 (47%), Gaps = 11/152 (7%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           + +DTE +       RL ++Q+  G+    VD + I     +   L  +L +E   K+ H
Sbjct: 25  LMLDTEFVRTRTLYARLGLIQMFDGETLALVDPVEI----DDLTPLWDLLKNESVTKVLH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+ V  +  G    P+  T+I +     Y    G    + + LG+++ K +  +DW
Sbjct: 81  ACGEDLEVFQHYAGCMPTPMIDTQIMAAFL-GYGLSTGFAKLVSDYLGVDLDKGESRTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
            A  LSD+QL YAA+DV +L    L   EKLQ
Sbjct: 140 MARPLSDKQLDYAAADVHYL----LPLFEKLQ 167


>gi|294141241|ref|YP_003557219.1| ribonuclease D [Shewanella violacea DSS12]
 gi|293327710|dbj|BAJ02441.1| ribonuclease D [Shewanella violacea DSS12]
          Length = 369

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 3/159 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R  D + +DTE +        L ++Q   G     I  +A    N      +L +     
Sbjct: 21  RQSDLLVLDTEFVRTRTYYANLGLIQAYDGKTLALIDPVAIN--NLSEFWSLLTEPGITT 78

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V       +   +F ++IA+ L   + +  G    +++ L I++ K +  
Sbjct: 79  VLHSCSEDLEVFARNGACQPYNLFDSQIAAALC-GFGHGLGYAKLVEQTLDISLDKGESR 137

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           +DW    LS+ QL YAA+DV +L+ L  Q  EKLQ  GR
Sbjct: 138 TDWMKRPLSEAQLNYAANDVYYLYNLYPQLLEKLQEQGR 176


>gi|330445493|ref|ZP_08309145.1| ribonuclease D [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489684|dbj|GAA03642.1| ribonuclease D [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 375

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 81/177 (45%), Gaps = 7/177 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
           +A+   A+ +DTE +       RL ++QL  G+    +D + I     +   L  +L D+
Sbjct: 18  SAKTQAAVMLDTEFVRTRTLYPRLGLIQLFDGEHLSLIDPLEI----DDMEPLWALLRDQ 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+ H    D+ V  +  G    P+  T++ +     +    G    +KE +G+ + K
Sbjct: 74  SVIKVLHACGEDLEVFQHHAGCLPTPMLDTQLMAAFL-GHGISTGFGALVKEYVGVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +  ++W A  L+ +QL YAA+DV +L  L      K++  G  +     CN +M R
Sbjct: 133 GEARTNWLARPLTAKQLDYAAADVHYLKPLYETLLAKVEATGYMEALQQECNSVMLR 189


>gi|295394778|ref|ZP_06804993.1| ribonuclease D [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972374|gb|EFG48234.1| ribonuclease D [Brevibacterium mcbrellneri ATCC 49030]
          Length = 385

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 3/113 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E I H    D+  L    G+R   +F T++A+RL      + GL    +E++G+ ++K  
Sbjct: 83  EWILHAATQDLGCLAEK-GMRPDALFDTELAARLLNF--ERFGLASLTEEIMGVTLAKEH 139

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            + DWS   L  E L YAA DV  L+ LR +  ++L   G+ + A    + L+
Sbjct: 140 SAVDWSTRPLPHEWLAYAALDVEVLNHLRTELADRLHAQGKWEYARQEFDHLL 192


>gi|255569470|ref|XP_002525702.1| 3'-5' exonuclease, putative [Ricinus communis]
 gi|223535002|gb|EEF36685.1| 3'-5' exonuclease, putative [Ricinus communis]
          Length = 857

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 10/147 (6%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDII--RIAAGQKNAPNLVGMLVDE 73
           R V+  AVD E       +   C++Q+S    D  +D +  RI  G    P L  +  D 
Sbjct: 246 RAVNEFAVDLEHNQYRSFQGLTCLMQISTRTEDFIIDTLKLRIHVG----PYLREVFKDP 301

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
            + K+ H    DI  L   FG+ V  +F T  ASR+ +   N   L+  L+   GI  +K
Sbjct: 302 TKRKVMHGADRDIIWLQRDFGIYVCNLFDTGQASRVLKLERN--SLEHLLRHFCGITANK 359

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHL 160
             Q++DW    L+DE L+Y   D  +L
Sbjct: 360 EYQNADWRLRPLTDEMLRYGREDTHYL 386


>gi|27363618|ref|NP_759146.1| ribonuclease D [Vibrio vulnificus CMCP6]
 gi|27359734|gb|AAO08673.1| ribonuclease D [Vibrio vulnificus CMCP6]
          Length = 390

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 72/163 (44%), Gaps = 11/163 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  GD T+ +I       +      +L D    
Sbjct: 38  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGD-TLSLIDPTV-LTDMSAFTELLNDASVM 95

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL----LGINIS 132
           K+ H    D+ V     G    P+  T+I +         HGL      L    L + + 
Sbjct: 96  KVLHACGEDLEVFHNALGAIPVPMVDTQIMAAFL-----GHGLSTGFAALVEQYLNVELD 150

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           K++  +DW A  LSD+QL+YAA+DV +L  L     EK+   G
Sbjct: 151 KSESRTDWLARPLSDKQLEYAAADVHYLLPLYEILLEKVMEAG 193


>gi|302525782|ref|ZP_07278124.1| ribonuclease D [Streptomyces sp. AA4]
 gi|302434677|gb|EFL06493.1| ribonuclease D [Streptomyces sp. AA4]
          Length = 420

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 83/183 (45%), Gaps = 10/183 (5%)

Query: 2   TTIRVHEGDIPAECAARYV---DAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIA 57
           T   V + D  AE  AR      A+AVDTE         +  +VQL   G GTV I  IA
Sbjct: 32  TPPVVADPDALAEACARLAAGTGAVAVDTERASGYRYWPKAYLVQLRREGSGTVLIDPIA 91

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                AP L  +L D   E + H    D+  L     +R R +F T++A RL      + 
Sbjct: 92  LADDLAP-LRDVLNDT--EWVLHAASQDLPCLA-ELNLRPRSLFDTELAGRLA--GYERV 145

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            L   ++ LLG  + K   ++DWS   L  + L YAA DV  L+ LR +   +L   G+ 
Sbjct: 146 ALGTLVELLLGYTLEKGHSAADWSKRPLPVDWLNYAALDVELLNELREKLEAELTAQGKL 205

Query: 178 DLA 180
           + A
Sbjct: 206 EWA 208


>gi|90416003|ref|ZP_01223936.1| ribonuclease D [marine gamma proteobacterium HTCC2207]
 gi|90332377|gb|EAS47574.1| ribonuclease D [marine gamma proteobacterium HTCC2207]
          Length = 374

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 80/164 (48%), Gaps = 7/164 (4%)

Query: 1   MTTIR--VHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI 56
           MTTI   +      AE   +  DA  +A+DTE +       +L ++QLS G+    +I  
Sbjct: 1   MTTINHWIDNSQQLAELCEQLQDATELAIDTEFMRSDTFFAKLALIQLSDGEQCW-LIDT 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            A ++  P L  +L   +   +FH    D+ VL     VR + +F +++A+ +     + 
Sbjct: 60  PAIEQLQP-LTALLNGPQLTLVFHSCGEDLEVLDQVLSVRPKKLFDSQVAAGIVNIGYSM 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHL 160
            G    ++ +L I + K    SDW A  LSD Q +YAA DV++L
Sbjct: 119 -GYARLVENMLQIELGKEDTRSDWLARPLSDRQKRYAADDVLYL 161


>gi|58582365|ref|YP_201381.1| ribonuclease D [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58426959|gb|AAW75996.1| ribonuclease D [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 416

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 73/156 (46%), Gaps = 6/156 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           I +DTE +       +L +VQ++ G+  + I  +  G   A  L   L      K+ H  
Sbjct: 76  IGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA--LKEWLTATDIVKVMHSA 133

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+       GV  RP+F T+IA+ L          K  ++E+ G  ++K +  SDW  
Sbjct: 134 SEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEVTGTLLTKGETRSDWMR 192

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKL---QRLG 175
             LS  QL+YAA DV +L A+  + T +L    RLG
Sbjct: 193 RPLSPSQLEYAADDVRYLFAIHDELTRRLTEQNRLG 228


>gi|212635098|ref|YP_002311623.1| ribonuclease D [Shewanella piezotolerans WP3]
 gi|212556582|gb|ACJ29036.1| Ribonuclease D [Shewanella piezotolerans WP3]
          Length = 369

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 75/168 (44%), Gaps = 5/168 (2%)

Query: 13  AECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGML 70
           A   A+Y +A  + +DTE +       RL ++Q   G     I  +A    N      +L
Sbjct: 14  AALVAQYREAKLLVIDTEFVRTRTYYARLGLIQAYDGKTLALIDPLAV--TNLSLFWALL 71

Query: 71  VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGIN 130
            D    K+ H    D+ V       +   +F ++IA+ L        G    +++ L I 
Sbjct: 72  TDSSIIKLLHSCSEDLEVFAKNGACQPNKLFDSQIAAGLCGMGYG-LGYAKLVEQTLDIT 130

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           + K +  +DW    LS+ QL YAA+DV +L+ L  Q  +KL+  GR D
Sbjct: 131 LDKGESRTDWLKRPLSEAQLNYAANDVYYLYELYPQLVDKLESQGRLD 178


>gi|296171911|ref|ZP_06852975.1| ribonuclease D [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295893910|gb|EFG73681.1| ribonuclease D [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 430

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 85/188 (45%), Gaps = 7/188 (3%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTV--DIIRIAAG 59
           ++ V E +  AE   R     AVD E        +R  ++Q+   G GTV  D +   A 
Sbjct: 35  SVTVGEIEAAAELLGRGRGPFAVDAERASGFRYSNRAYLIQIRRAGAGTVLIDPVSHGAD 94

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
              A   V  ++DE  E I H    D+  L    G++   ++ T++A RL      +  L
Sbjct: 95  PLEALRPVAEVLDED-EWILHSADQDLPCL-AEVGLQPPALYDTELAGRLA--GFERVNL 150

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++ LLG  ++K   ++DWS   L +E L YAA DV  L  LR    + L + G++  
Sbjct: 151 ATMVERLLGSGLAKGHGAADWSKRPLPEEWLNYAALDVELLIELRGAIADVLAQQGKTGW 210

Query: 180 ATSCCNFL 187
           A    ++L
Sbjct: 211 AAEEFDYL 218


>gi|255075175|ref|XP_002501262.1| predicted protein [Micromonas sp. RCC299]
 gi|226516526|gb|ACO62520.1| predicted protein [Micromonas sp. RCC299]
          Length = 332

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 72/158 (45%), Gaps = 6/158 (3%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPG--DGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +AVD E       +   C++Q+S    D  VD + +    ++A  L  ++ D +  K+FH
Sbjct: 57  MAVDLEHHSYRSFQGFTCVIQVSTRRMDFVVDALELRGLIRDA--LGPVMADPRVMKVFH 114

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+  L   FG+ V  +F T  A+R+    +   GL   L     +   K  Q +DW
Sbjct: 115 GADMDVQWLQRDFGIYVVGMFDTGQAARVLELPSK--GLAYLLDHYCSVKADKRFQLADW 172

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               LS+E + YA  D  HL  +  +  ++L  +GR D
Sbjct: 173 RVRPLSEEMISYARGDTHHLLYVYDRLRQQLDAVGRGD 210


>gi|54308269|ref|YP_129289.1| ribonuclease D [Photobacterium profundum SS9]
 gi|46912697|emb|CAG19487.1| hypothetical ribonuclease D [Photobacterium profundum SS9]
          Length = 374

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    + +DTE +       +L ++Q+  GD  V I  I     +      +L D+   
Sbjct: 19  ARTHSVVMLDTEFVRTRTLYPKLGLIQMFDGDNLVLIDPIEID--DLTPFWDLLRDQSII 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  +  G    P+  T++ +     +    G    + E +G+++ K + 
Sbjct: 77  KVLHACGEDLEVFQHHAGCLPTPMIDTQLMAAFL-GHGVSAGFGSLVSEYVGVDLEKGEA 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            ++W A  L+D+QL YAA+DV +L  L     EK++  G  +     C  LM +
Sbjct: 136 RTNWLARPLTDKQLDYAAADVFYLLPLYETLLEKVKAKGWMEALELECAALMQK 189


>gi|317491812|ref|ZP_07950247.1| ribonuclease D [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920246|gb|EFV41570.1| ribonuclease D [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 371

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 8/179 (4%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLV 71
           E A+R+   IA+DTE +       +L ++QL  G+    +D + I   Q      V +L 
Sbjct: 17  EQASRHA-YIALDTEFVRTRTYYPQLGLIQLFDGETLTLIDPLPITDWQP----FVALLK 71

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           + +  K+ H    D+ V  + F     P+  T+I +  T    +  G    + + L + +
Sbjct: 72  NPEVTKLLHACSEDLEVFLHEFQTLPTPMIDTQILAAFTGRALS-CGFAAMVNDYLQVEL 130

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            K++  +DW A  L++ Q +YAA+DV +L  L  +   ++   G  D A   C  L  R
Sbjct: 131 DKSESRTDWLARPLTERQCEYAAADVFYLLPLADKLIAEVAEAGWLDAAKDDCLSLCRR 189


>gi|85712692|ref|ZP_01043738.1| Ribonuclease D [Idiomarina baltica OS145]
 gi|85693542|gb|EAQ31494.1| Ribonuclease D [Idiomarina baltica OS145]
          Length = 367

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 83/171 (48%), Gaps = 17/171 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPG------DGTVDIIRIAAGQKNAPNLVGML 70
           AR   + A+DTE +        L +VQL+        D  +DI   A  Q        ++
Sbjct: 9   ARLAGSFAIDTEFVRRKTYFANLGLVQLNVDGETFIIDPLIDIDLTALWQ--------LI 60

Query: 71  VDEKREKIFHYGRFDIAVLFY-TFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL-G 128
            D     + H G  DI + ++ + G + R VF T+IA+      ++  G    +++L  G
Sbjct: 61  ADPDVVTVLHAGGEDIELFYHQSNGQKPRAVFDTQIAAGFIGMGSS-LGYASLVEQLFDG 119

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           + + K+Q  +DW    LS+EQL YAA+DV +L+++     E++ +   +D+
Sbjct: 120 VTLDKSQSRTDWLKRPLSEEQLTYAAADVSYLNSMYPWLVEQVAQAHVADI 170


>gi|327484520|gb|AEA78927.1| Ribonuclease D [Vibrio cholerae LMA3894-4]
          Length = 348

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
            V +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++
Sbjct: 41  FVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQD 99

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 100 QLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDAA 154


>gi|50085406|ref|YP_046916.1| ribonuclease D, processes tRNA [Acinetobacter sp. ADP1]
 gi|49531382|emb|CAG69094.1| ribonuclease D, processes tRNA [Acinetobacter sp. ADP1]
          Length = 398

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 58/118 (49%), Gaps = 10/118 (8%)

Query: 75  REKIFHYGRFDIAVLF-YTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN----LKELLGI 129
           ++ +FH    DI +++ Y     +  VF T++           HGL+ +    LK +L I
Sbjct: 90  KQNVFHACGEDIDLIYHYAQQKFLENVFDTQVGLSFLG-----HGLQVSYQAALKLVLDI 144

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            I K Q  SDW A  LSDEQL+YAA+DV++L  L  Q   +LQ     D     C  L
Sbjct: 145 EIEKDQTRSDWLARPLSDEQLKYAANDVLYLLKLSDQIKHQLQEKQLYDYVLEDCRHL 202


>gi|254234416|ref|ZP_04927739.1| ribonuclease D [Pseudomonas aeruginosa C3719]
 gi|126166347|gb|EAZ51858.1| ribonuclease D [Pseudomonas aeruginosa C3719]
          Length = 374

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        +VQ+  GDG  + +      ++      +L DE+  K+ H  
Sbjct: 28  LALDTEFMRVDTSYPAAGLVQV--GDGRQEWLIDPLLIQDWSPFAELLEDERVVKVLHAC 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V     G    P+F T++A+       +  G    +KE+L I++ K +  SDW  
Sbjct: 86  SEDLEVFLRLTGSLPVPLFDTQLAAAYL-GMAHSMGYSKLVKEVLDIDLPKDETRSDWLQ 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
             L++ Q++YAA DV HL  + L    +L    R+ L
Sbjct: 145 RPLTEMQMRYAADDVQHLAQVYLALDARLSEEKRAWL 181


>gi|330879592|gb|EGH13741.1| ribonuclease D [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 377

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        ++Q+  GDG    +       N   L  +L +    K+ H  
Sbjct: 27  VALDTEFMRVDTFYPIAALLQI--GDGQSAWLIEPLLINNWAPLSALLENPDVIKVVHAC 84

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISKAQQSSD 139
             D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K +  SD
Sbjct: 85  SEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPKGETRSD 140

Query: 140 WSADDLSDEQLQYAASDVVHLHAL 163
           W    LSD Q+ YAA D VHL  L
Sbjct: 141 WLQRPLSDTQISYAAEDAVHLAEL 164


>gi|92113585|ref|YP_573513.1| ribonuclease D [Chromohalobacter salexigens DSM 3043]
 gi|91796675|gb|ABE58814.1| ribonuclease D [Chromohalobacter salexigens DSM 3043]
          Length = 375

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 66/150 (44%), Gaps = 2/150 (1%)

Query: 40  CIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRP 99
            +VQL  G   V ++   A   + P L  +L      K+ H    D+ VL     V V P
Sbjct: 46  ALVQLYAGGDAVYMVDPRAVSAS-PALQALLSVSGPLKLLHASGEDLEVLESWAEVGVAP 104

Query: 100 VFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVH 159
           +  T++A  L  T  +  G +  ++   G  + K +  SDW    LSD QLQYAA DVV+
Sbjct: 105 IADTQVAQSLLGTQASL-GYQRLVEHWTGDVLPKEETRSDWLQRPLSDAQLQYAALDVVY 163

Query: 160 LHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           L  +     + L R GR       C  L D
Sbjct: 164 LPRIWEAQRDALMREGRLAWLEEECARLCD 193


>gi|17229189|ref|NP_485737.1| hypothetical protein all1697 [Nostoc sp. PCC 7120]
 gi|17135517|dbj|BAB78063.1| all1697 [Nostoc sp. PCC 7120]
          Length = 302

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 75/156 (48%), Gaps = 15/156 (9%)

Query: 25  VDTETLGLMPRRDRLCIVQL--SPGDGTVDIIRIAAGQKNAPNLVG-----MLVDEKREK 77
           +DTE      R  RL ++Q+   P D + D + +     + P+LV      ++V+   EK
Sbjct: 25  IDTEVADYKSRNPRLSLIQVLDDPNDMSGDRVYLL-DVLDQPDLVADFVDKIMVNTNIEK 83

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCT-KIASRLTRTY--TNQHGLKDNLKELLGIN-ISK 133
           +FH   FD+ +L      + R + CT +IA ++         + L+   K L   N I K
Sbjct: 84  VFHNANFDVKLLG---NKQARNITCTLEIAKKIPYYLLPVQNYQLQSLAKLLCNFNNIDK 140

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTE 169
            +Q S+W    LS+EQ++YA  D ++L  +  +  E
Sbjct: 141 QEQGSNWGQRPLSEEQIEYAYLDCIYLAQIHRRLLE 176


>gi|262167934|ref|ZP_06035634.1| ribonuclease D [Vibrio cholerae RC27]
 gi|262023661|gb|EEY42362.1| ribonuclease D [Vibrio cholerae RC27]
          Length = 348

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
            V +L D    K+ H    D+ V    FG    P+  T+I +     Y    G    +++
Sbjct: 41  FVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFL-GYGLSTGFAALVQD 99

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D A
Sbjct: 100 QLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWDAA 154


>gi|330964859|gb|EGH65119.1| ribonuclease D [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 377

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        ++Q+  GDG    +       N   L  +L +    K+ H  
Sbjct: 27  VALDTEFMRVDTFYPIAALLQI--GDGQSAWLIDPLLINNWAPLSALLENPDVIKVVHAC 84

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISKAQQSSD 139
             D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K +  SD
Sbjct: 85  SEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPKGETRSD 140

Query: 140 WSADDLSDEQLQYAASDVVHLHAL 163
           W    LSD Q+ YAA D VHL  L
Sbjct: 141 WLQRPLSDTQISYAAEDAVHLAEL 164


>gi|227496242|ref|ZP_03926539.1| possible ribonuclease D [Actinomyces urogenitalis DSM 15434]
 gi|226834230|gb|EEH66613.1| possible ribonuclease D [Actinomyces urogenitalis DSM 15434]
          Length = 431

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 86/195 (44%), Gaps = 19/195 (9%)

Query: 4   IRVHEGDIP-----------AECAARYVDAIAVDTE-TLGLMPRRDRLCIVQLSPGDGTV 51
           +  HEG  P           A+C A     +AVD E   G    +D   I     G GT 
Sbjct: 31  VHPHEGLPPVTDSPELLSQAADCLAAGHGPVAVDAERASGFRYGQDAYLIQLRREGAGTF 90

Query: 52  DIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTR 111
            +  + AG  +A  L   L  +  E I H    D+  L    G+  R +F T++A+RL  
Sbjct: 91  LVDPVTAGDMSA--LAAAL--DGPEWILHAADQDLPCL-SALGLHPRSLFDTELAARLL- 144

Query: 112 TYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
               + GL   ++E LG+ ++K   ++DWS   L    L YAA DV  L  LR+    +L
Sbjct: 145 -GRARVGLGAVVEETLGLRLAKDHAAADWSTRPLPRTWLVYAALDVELLADLRVALGAEL 203

Query: 172 QRLGRSDLATSCCNF 186
           +  G+++ A    ++
Sbjct: 204 EEAGKAEWARQEFDY 218


>gi|54025710|ref|YP_119952.1| putative RNase D [Nocardia farcinica IFM 10152]
 gi|54017218|dbj|BAD58588.1| putative RNase D [Nocardia farcinica IFM 10152]
          Length = 424

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 51/106 (48%), Gaps = 3/106 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E + H    D+  L    G+R   +F T++  RL      + GL   ++ LLG  + K  
Sbjct: 102 EWVLHSADQDLPGL-AELGLRPARLFDTELGGRLA--GFERVGLAAMVERLLGRTLRKGH 158

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++DWS   L  E L YAA DV  L  LR     +LQR G+SD A 
Sbjct: 159 GAADWSTRPLPAEWLNYAALDVELLLELRDAVAAELQRQGKSDWAA 204


>gi|119511988|ref|ZP_01631084.1| hypothetical protein N9414_12428 [Nodularia spumigena CCY9414]
 gi|119463339|gb|EAW44280.1| hypothetical protein N9414_12428 [Nodularia spumigena CCY9414]
          Length = 871

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 75/164 (45%), Gaps = 31/164 (18%)

Query: 25  VDTETLGLMPRRDRLCIVQL--SPGDGT------VDIIRIAAGQKNAPNLV-----GMLV 71
           +DTE         RL ++Q+   P D T      +D++       + P+L       +++
Sbjct: 25  LDTEIADFTTHYPRLSLIQVLADPTDSTGVSAYLLDVL-------DKPDLAEYFINQIMI 77

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCT-KIASRLTRTYTNQHGLKDNLKELLG-- 128
           +   EK+FH   FD+  L       +    CT +IA ++TR       LK  LK L    
Sbjct: 78  NPNIEKVFHNAGFDLKYLGKKLAQNIT---CTYQIARKITRDRLKVSNLK--LKTLAAEL 132

Query: 129 ---INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTE 169
              +N+   + SSDW    LSD+Q++YAA D V+L A+  +  E
Sbjct: 133 CHFVNVDADEGSSDWGKRPLSDKQVKYAAMDTVYLAAVHRKLLE 176


>gi|330466515|ref|YP_004404258.1| 3'-5' exonuclease [Verrucosispora maris AB-18-032]
 gi|328809486|gb|AEB43658.1| 3'-5' exonuclease [Verrucosispora maris AB-18-032]
          Length = 438

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (46%), Gaps = 11/172 (6%)

Query: 13  AECAARYV---DAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVG 68
           AE  AR+      +A+D E         R  +VQL   G GT  I  +     +A  L  
Sbjct: 63  AEVVARFAAGSGPVALDAERASGYRYSQRAYLVQLRRSGAGTALIDPLPLPDLSA--LDA 120

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D   E + H    D+  L    G+R R +F T++A+RL      + GL    ++LLG
Sbjct: 121 VIADT--EWVLHAANQDLPCL-AELGLRPRRLFDTELAARLA--GFERVGLAALTEQLLG 175

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++ K   ++DWS+  L +  L YAA DV  L  LR     +L R G+S  A
Sbjct: 176 YSLEKHHSAADWSSRPLPESWLTYAALDVELLTDLRDALDAELTRQGKSQWA 227


>gi|254428623|ref|ZP_05042330.1| ribonuclease D [Alcanivorax sp. DG881]
 gi|196194792|gb|EDX89751.1| ribonuclease D [Alcanivorax sp. DG881]
          Length = 375

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +DTE +       +L +VQ+  G+    +D  R+     + P L  +   ++   + H  
Sbjct: 45  LDTEFMRERTFWPQLALVQVHDGEQIRLIDTTRV-----DGPTLSPVF--QQHTLVMHAC 97

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+  +    G     +  T+IA+ L+     Q G +  ++ LLG+++ K    ++W  
Sbjct: 98  SEDLEAIATFTGQYPAAIEDTQIAAALS-GEDMQWGYQKVVQMLLGVDLPKGATRTNWLK 156

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             LSDEQL YA  DV +L  +     E+L +LGR       C  L+++A
Sbjct: 157 RPLSDEQLHYAEDDVKYLPEVAAILAERLDKLGRRAWWQEECERLLNQA 205


>gi|320103484|ref|YP_004179075.1| ribonuclease D [Isosphaera pallida ATCC 43644]
 gi|319750766|gb|ADV62526.1| ribonuclease D [Isosphaera pallida ATCC 43644]
          Length = 396

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 67/151 (44%), Gaps = 3/151 (1%)

Query: 39  LCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVR 98
           LC++Q++     V +I   A    +P    +L D K E + H G  D+ +     G    
Sbjct: 45  LCLIQVATASKLV-VIDALAFSDLSPFWDAVL-DPKLEVVVHAGGEDLRICKIKTGRLPE 102

Query: 99  PVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVV 158
            VF  ++A+  T   +    L +  +E+LG+ +   +  +DW    LS  Q+ YA  DV 
Sbjct: 103 RVFDVQLAAGFT-GLSYPLSLTNLAREVLGVQLVGGESRTDWRKRPLSVAQMNYALEDVR 161

Query: 159 HLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           HL  L      KL+R+GR D         +D
Sbjct: 162 HLLDLADALRSKLERMGRLDWVIEETRAFLD 192


>gi|115767336|ref|XP_001198019.1| PREDICTED: similar to RE33408p, partial [Strongylocentrotus
           purpuratus]
 gi|115963545|ref|XP_001176068.1| PREDICTED: similar to RE33408p, partial [Strongylocentrotus
           purpuratus]
          Length = 228

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 86/195 (44%), Gaps = 20/195 (10%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV---DIIRIAAGQKNAPNLVGMLVD 72
           + R    I +D E + L   +  L +VQ+S  DG     D  +     K   +L  +L  
Sbjct: 25  STRQTVVIGLDCEGVRLGTAKGCLTLVQISTWDGKAFLFDAFKNPQLLKGNSSLKKILEH 84

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH-----GLKDNLKELL 127
               K+ H  + D   L + FGV+++ VF T IA R      N++     G K  L ELL
Sbjct: 85  NSILKVIHDCKSDTYGLHHGFGVKLKNVFDTSIAMRTIMEQVNRYRSYRVGFK-ALCELL 143

Query: 128 GIN--------ISKAQQSSD-WSADDLSDEQLQYAASDVVHL-HALRLQFTEKLQRLGRS 177
           G          + K  ++ D W    L++E + YAASD + L  ++ L+F   L  L R 
Sbjct: 144 GEGATHKDDDFVKKMLETPDFWKIRPLTEEMIYYAASDALCLIPSIYLKFNGMLTPLWR- 202

Query: 178 DLATSCCNFLMDRAE 192
           DL T  C   M+  +
Sbjct: 203 DLFTWSCKDTMESIQ 217


>gi|320093825|ref|ZP_08025670.1| ribonuclease D [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319979258|gb|EFW10756.1| ribonuclease D [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 412

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 90  FYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQ 149
               G+R   +F T+IA+RL      + GL    + +LG+ + K  Q++DWS   L  + 
Sbjct: 113 LRAVGLRCPELFDTEIAARLV--GMRRFGLASVAESVLGLALVKDHQAADWSVRPLPKDW 170

Query: 150 LQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
           L+YAA DV  L  L  + + +L  LGR + AT
Sbjct: 171 LRYAALDVELLTELHRRLSTRLHDLGRWEWAT 202


>gi|68075407|ref|XP_679621.1| POM1 [Plasmodium berghei strain ANKA]
 gi|56500410|emb|CAH98073.1| POM1, putative [Plasmodium berghei]
          Length = 1808

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 88/183 (48%), Gaps = 12/183 (6%)

Query: 24   AVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN--APNLVGMLVDEKREKIFHY 81
             +D ET GL    +++ ++Q+S  +  V I  +     N     L  +L DE   KI   
Sbjct: 1260 GLDMETTGLEVFGEKIRLIQISVENYPVIIYDMFNITNNNILDGLRKILNDENIVKIIQN 1319

Query: 82   GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN--LKELLGINISKAQQSSD 139
            G+FD   L Y     +  +F T IAS+L     N +G K N  +++ L + + K QQ+S 
Sbjct: 1320 GKFDTKFLLYN-NFNITNIFDTYIASKLLDKNKNMYGFKLNNIVEKYLSVYLDKQQQNSV 1378

Query: 140  WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR---SDLATSC----CNFLMDRAE 192
            W+   L++ QL YAA D   L  L  + +E+++       +D+   C    C+  ++  +
Sbjct: 1379 WNNSLLNNNQLFYAARDSSCLLKLYKKLSEQIKAENMQIVNDIENKCILPICDMELNGIK 1438

Query: 193  LDL 195
            +DL
Sbjct: 1439 VDL 1441


>gi|254518126|ref|ZP_05130182.1| DNA polymerase I [Clostridium sp. 7_2_43FAA]
 gi|226911875|gb|EEH97076.1| DNA polymerase I [Clostridium sp. 7_2_43FAA]
          Length = 532

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 68/139 (48%), Gaps = 9/139 (6%)

Query: 26  DTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFD 85
           DTET  L  R  ++ ++  S G   V +   +  ++    L  +L D+   K+FH  +FD
Sbjct: 10  DTETDSLDFRTGKIKLIAFSKGLNEV-VTTTSVDER----LKSILNDKNIIKVFHNAKFD 64

Query: 86  IAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD-WSADD 144
           +   F + G RV    CT + +++      +  LK   K+ L +++ K+ Q SD W   +
Sbjct: 65  VG-FFQSKGYRVNNYHCTLLMAQVLGE--EKLSLKALAKKYLDVDMDKSMQHSDNWQETE 121

Query: 145 LSDEQLQYAASDVVHLHAL 163
           ++ E + YA  DV H  AL
Sbjct: 122 ITQEHIDYAVKDVEHTRAL 140


>gi|87122723|ref|ZP_01078598.1| Ribonuclease D [Marinomonas sp. MED121]
 gi|86162020|gb|EAQ63310.1| Ribonuclease D [Marinomonas sp. MED121]
          Length = 387

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 9/141 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVDTE +          ++Q+S G+  V +  +A    N   L+ ++ ++   K+FH  
Sbjct: 39  IAVDTEFIRRTTFYPITGLIQISEGEHAVLVDPLAIS--NWQPLIDLMTNQSVVKVFHAC 96

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG---INISKAQQSSD 139
             D+ V     GV   P + T++A      Y +       +K +L    I I+K +  SD
Sbjct: 97  SEDLEVFDRLLGVVPSPFYDTQVAE----AYVSGQWSLSYVKLILAYKNIEIAKDETRSD 152

Query: 140 WSADDLSDEQLQYAASDVVHL 160
           W    L++ Q +YAA DV+HL
Sbjct: 153 WLKRPLTEAQKRYAALDVIHL 173


>gi|297805136|ref|XP_002870452.1| hypothetical protein ARALYDRAFT_355577 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297316288|gb|EFH46711.1| hypothetical protein ARALYDRAFT_355577 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 867

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDI--IRIAAGQKNAPNLVGMLVDE 73
           R V+  AVD E       +   C++Q+S    D  VD   +RI  G    P L  +  D 
Sbjct: 273 RGVEEFAVDLEHNQYRSFQGLTCLMQISTRTEDYIVDTFKLRIHIG----PYLREIFKDP 328

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K++KI H    DI  L   FG+ V  +F T  ASR+     N   L+  L+   G+  +K
Sbjct: 329 KKKKIMHGADRDIIWLQRDFGIYVCNLFDTGQASRVLNLGRN--SLEFLLQHFCGVTANK 386

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             Q++DW    L +E  +YA  D  +L  +      +L+R+ + D  T
Sbjct: 387 EYQNADWRIRPLPEEMTRYAREDTHYLLYIYDVMRLELERMAKDDEHT 434


>gi|213022814|ref|ZP_03337261.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
          Length = 182

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 3/133 (2%)

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQH 117
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I A+   R  +   
Sbjct: 22  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLS--W 79

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G  
Sbjct: 80  GFASMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWL 139

Query: 178 DLATSCCNFLMDR 190
             A   C  +  R
Sbjct: 140 PAALDECRLMQQR 152


>gi|307107266|gb|EFN55509.1| hypothetical protein CHLNCDRAFT_133914 [Chlorella variabilis]
          Length = 1092

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 42/138 (30%), Positives = 58/138 (42%), Gaps = 2/138 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +AVD E       +   C++QLS     + I  +A      P L  +  D    K+ H  
Sbjct: 270 LAVDLEAHSYRSFQGFCCLMQLSTRSEDLVIDTLALRAHVGPALAPIFADPGVVKVLHGA 329

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+A L   FG+ +  +F T  A+R+       HGL   L    G    K  Q +DW  
Sbjct: 330 DSDVAWLQRDFGLFLANLFDTGQAARVLGM--RGHGLAHLLDFYCGFKADKRFQLADWRV 387

Query: 143 DDLSDEQLQYAASDVVHL 160
             L+ E L YA SD  HL
Sbjct: 388 RPLTPEMLHYARSDTHHL 405


>gi|238919524|ref|YP_002933039.1| ribonuclease D [Edwardsiella ictaluri 93-146]
 gi|238869093|gb|ACR68804.1| ribonuclease D, putative [Edwardsiella ictaluri 93-146]
          Length = 371

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 80/171 (46%), Gaps = 9/171 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IA+DTE +       +L +VQL  G+    +D + I+  Q      V +L + +  K+ H
Sbjct: 26  IALDTEFVRTRTYYPQLGLVQLYDGEMLSLIDPLTISDWQP----FVDLLRNPQVVKLLH 81

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLT-RTYTNQHGLKDNLKELLGINISKAQQSSD 139
               D+ V  + F    +P+  T+I +  + R  ++  G    +   L +++ K++  +D
Sbjct: 82  ASSEDLEVFLHDFQTLPQPLIDTQILAAFSGRPLSS--GFAAMVSAYLQVDLDKSESRTD 139

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           W A  LS+ Q  YAA+DV +L  +  +   +++  G    A   C  L  R
Sbjct: 140 WLARPLSERQCDYAAADVYYLLPMAHKLLAEVEACGWLPSALDECQALCRR 190


>gi|229820453|ref|YP_002881979.1| 3'-5' exonuclease [Beutenbergia cavernae DSM 12333]
 gi|229566366|gb|ACQ80217.1| 3'-5' exonuclease [Beutenbergia cavernae DSM 12333]
          Length = 416

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 80/171 (46%), Gaps = 14/171 (8%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLSP-GDGTVDIIRIAAGQKNAPNLVGM--- 69
           E  AR   A+AVD E         R  +VQ+   G GT  I  IA      P+L G+   
Sbjct: 29  EAVARADGAVAVDAERASGYRYGQRAYLVQIRRLGAGTALIDPIAC-----PDLSGLSAA 83

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           L D   E + H    D+  L    G+  R VF T++A RL      + GL   +++ LG+
Sbjct: 84  LGDA--EWVLHAANQDLPCLA-EVGLVPRHVFDTELAGRLL--GRERVGLAAIVEQELGL 138

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++K   + DWS   L ++ L+YAA DV  L  LR      L R G+++ A
Sbjct: 139 TLAKEHSAVDWSTRPLREDWLRYAALDVEVLVELRDALERDLVRAGKAEWA 189


>gi|115661808|ref|XP_001202523.1| PREDICTED: similar to RE33408p [Strongylocentrotus purpuratus]
 gi|115689950|ref|XP_001201160.1| PREDICTED: similar to RE33408p [Strongylocentrotus purpuratus]
          Length = 234

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 86/195 (44%), Gaps = 20/195 (10%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV---DIIRIAAGQKNAPNLVGMLVD 72
           + R    I +D E + L   +  L +VQ+S  DG     D  +     K   +L  +L  
Sbjct: 31  STRQTVVIGLDCEGVRLGTAKGCLTLVQISTWDGKAFLFDAFKNPQLLKGNSSLKKILEH 90

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH-----GLKDNLKELL 127
               K+ H  + D   L + FGV+++ VF T IA R      N++     G K  L ELL
Sbjct: 91  NSILKVIHDCKSDTYGLHHGFGVKLKNVFDTSIAMRTIMEQVNRYRSYRVGFK-ALCELL 149

Query: 128 GIN--------ISKAQQSSD-WSADDLSDEQLQYAASDVVHL-HALRLQFTEKLQRLGRS 177
           G          + K  ++ D W    L++E + YAASD + L  ++ L+F   L  L R 
Sbjct: 150 GEGATHKDDDFVKKMLETPDFWKIRPLTEEMIYYAASDALCLIPSIYLKFNGMLTPLWR- 208

Query: 178 DLATSCCNFLMDRAE 192
           DL T  C   M+  +
Sbjct: 209 DLFTWSCKDTMESIQ 223


>gi|315604318|ref|ZP_07879384.1| ribonuclease D [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315314024|gb|EFU62075.1| ribonuclease D [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 414

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 100 VFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVH 159
           +F T+IA+RL      + GL    +++LG+ + K  Q+SDWS   L  E L+YAA DV  
Sbjct: 123 LFDTEIAARLV--GLERFGLAAVAEQVLGLGLVKDHQASDWSLRPLPPEWLRYAALDVEL 180

Query: 160 LHALRLQFTEKLQRLGRSDLA 180
           L  L  + +++L ++GR + A
Sbjct: 181 LTELYYRLSKRLDQMGRWEWA 201


>gi|238063529|ref|ZP_04608238.1| 3'-5' exonuclease [Micromonospora sp. ATCC 39149]
 gi|237885340|gb|EEP74168.1| 3'-5' exonuclease [Micromonospora sp. ATCC 39149]
          Length = 442

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E + H    D+  L    G+R R +F T++A+RL      + GL    ++LLG ++ K  
Sbjct: 126 EWVLHAASQDLPCL-AEVGLRPRRLFDTELAARLA--GFERVGLAALTEQLLGFSLEKHH 182

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++DWS+  L +  L YAA DV  L  LR     +L R G+S  A
Sbjct: 183 SAADWSSRPLPESWLTYAALDVELLTDLRDALDAELARQGKSAWA 227


>gi|107100745|ref|ZP_01364663.1| hypothetical protein PaerPA_01001773 [Pseudomonas aeruginosa PACS2]
          Length = 380

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        +VQ+  GDG  + +      ++      +L DE+  K+ H  
Sbjct: 34  LALDTEFMRVDTFYPAAGLVQV--GDGRQEWLIDPLLIQDWSPFAELLEDERVVKVLHAC 91

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V     G    P+F T++A+       +  G    +KE+L I++ K +  SDW  
Sbjct: 92  SEDLEVFLRLTGSLPVPLFDTQLAAAYL-GMAHSMGYSKLVKEVLDIDLPKDETRSDWLQ 150

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
             L++ Q++YAA DV HL  + L    +L    R+ L
Sbjct: 151 RPLTEMQMRYAADDVQHLAQVYLALDTRLSEEKRAWL 187


>gi|313106280|ref|ZP_07792525.1| ribonuclease D [Pseudomonas aeruginosa 39016]
 gi|310879027|gb|EFQ37621.1| ribonuclease D [Pseudomonas aeruginosa 39016]
          Length = 374

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        +VQ+  GDG  + +      ++      +L DE+  K+ H  
Sbjct: 28  LALDTEFMRVDTFYPAAGLVQV--GDGRQEWLIDPLLIQDWSPFAELLEDERVVKVLHAC 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V     G    P+F T++A+       +  G    +KE+L I++ K +  SDW  
Sbjct: 86  SEDLEVFLRLTGSLPVPLFDTQLAAAYL-GMAHSMGYSKLVKEVLDIDLPKDETRSDWLQ 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
             L++ Q++YAA DV HL  + L    +L    R+ L
Sbjct: 145 RPLTEMQMRYAADDVQHLAQVYLALDARLSEEKRAWL 181


>gi|146306804|ref|YP_001187269.1| ribonuclease D [Pseudomonas mendocina ymp]
 gi|145575005|gb|ABP84537.1| ribonuclease D [Pseudomonas mendocina ymp]
          Length = 377

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 10/161 (6%)

Query: 15  CAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CAA R +  +A+DTE + +        ++Q+S GD    I  +         L  +L  +
Sbjct: 18  CAAWRALPFVALDTEFMRVDTFYPIAGLLQVSGGDKAYLIDPLCIDDWRP--LAELLQAQ 75

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGIN 130
              K+ H    D+ V     G    P+F T++A+     Y N     G    ++ LLGI 
Sbjct: 76  TVVKVLHSCSEDLEVFLRLTGSLPVPLFDTQVAA----GYLNLGFSMGYSRLVQTLLGIE 131

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
           + K +  SDW    LS  Q+ YAA DV+HL  +    T++L
Sbjct: 132 LPKGETRSDWLQRPLSATQISYAAEDVLHLVEVYQALTQRL 172


>gi|296117768|ref|ZP_06836352.1| putative ribonuclease D [Corynebacterium ammoniagenes DSM 20306]
 gi|295969499|gb|EFG82740.1| putative ribonuclease D [Corynebacterium ammoniagenes DSM 20306]
          Length = 411

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 85/188 (45%), Gaps = 16/188 (8%)

Query: 5   RVHEGDIPA--------ECAARYV----DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVD 52
           RV EG IP         E AAR +      IA+DTE        DR  ++QL   D  + 
Sbjct: 6   RVPEGGIPTVVSTRAGVEDAARILAQGSGPIAIDTERASSFRYDDRAFLIQLRRADTPIF 65

Query: 53  IIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT 112
           ++     + +   ++  +V+ ++  + H    D+  L +  G+    +F T++A RL   
Sbjct: 66  LVAPEGIRDDVREVLAPVVNGEK-WVVHAAVTDLTSLAW-LGLYPGSLFDTEVAGRLLGI 123

Query: 113 YTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
                 L    +E LGI + K   ++DWS   LS  QL YAA DV  L  L  +   +L+
Sbjct: 124 --QNPNLASVTEEFLGIELDKGYGATDWSRFPLSKAQLIYAALDVDTLLELADEMAYELE 181

Query: 173 RLGRSDLA 180
           +  +++ A
Sbjct: 182 QEDKTEWA 189


>gi|218892602|ref|YP_002441471.1| ribonuclease D [Pseudomonas aeruginosa LESB58]
 gi|254239667|ref|ZP_04932989.1| ribonuclease D [Pseudomonas aeruginosa 2192]
 gi|126193045|gb|EAZ57108.1| ribonuclease D [Pseudomonas aeruginosa 2192]
 gi|218772830|emb|CAW28624.1| ribonuclease D [Pseudomonas aeruginosa LESB58]
          Length = 374

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        +VQ+  GDG  + +      ++      +L DE+  K+ H  
Sbjct: 28  LALDTEFMRVDTFYPAAGLVQV--GDGRQEWLIDPLLIQDWSPFAELLEDERVVKVLHAC 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V     G    P+F T++A+       +  G    +KE+L I++ K +  SDW  
Sbjct: 86  SEDLEVFLRLTGSLPVPLFDTQLAAAYL-GMAHSMGYSKLVKEVLDIDLPKDETRSDWLQ 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
             L++ Q++YAA DV HL  + L    +L    R+ L
Sbjct: 145 RPLTEMQMRYAADDVQHLAQVYLALDARLSEEKRAWL 181


>gi|116049246|ref|YP_791951.1| ribonuclease D [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296390324|ref|ZP_06879799.1| ribonuclease D [Pseudomonas aeruginosa PAb1]
 gi|115584467|gb|ABJ10482.1| ribonuclease D [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 374

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        +VQ+  GDG  + +      ++      +L DE+  K+ H  
Sbjct: 28  LALDTEFMRVDTFYPAAGLVQV--GDGRQEWLIDPLLIQDWSPFAELLEDERVVKVLHAC 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V     G    P+F T++A+       +  G    +KE+L I++ K +  SDW  
Sbjct: 86  SEDLEVFLRLTGSLPVPLFDTQLAAAYL-GMAHSMGYSKLVKEVLDIDLPKDETRSDWLQ 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
             L++ Q++YAA DV HL  + L    +L    R+ L
Sbjct: 145 RPLTEMQMRYAADDVQHLAQVYLALDARLSEEKRAWL 181


>gi|331019018|gb|EGH99074.1| ribonuclease D [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 377

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 49/101 (48%), Gaps = 7/101 (6%)

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDN 122
           L  +L +    K+ H    D+ VL    G    P+F T++A+     Y N     G    
Sbjct: 68  LSALLENPAVIKVVHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRL 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
           ++E+L I++ K +  SDW    LSD Q+ YAA D VHL  L
Sbjct: 124 VQEVLNIDLPKGETRSDWLQRPLSDTQISYAAEDAVHLAEL 164


>gi|322514433|ref|ZP_08067476.1| ribonuclease D [Actinobacillus ureae ATCC 25976]
 gi|322119681|gb|EFX91739.1| ribonuclease D [Actinobacillus ureae ATCC 25976]
          Length = 371

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 3/139 (2%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           A+ +DTE + +     +L ++QL  G+  V +I        AP  + +L +++  K+ H 
Sbjct: 28  AVTLDTEFIRIRTYYPKLGLIQLFDGE-QVSLIDPTKIDDFAP-FIELLANQQVVKVLHA 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+ V  + F     P+  T+I +       +  G    +   L I + K    +DW 
Sbjct: 86  CGEDLEVFQHRFKQLPTPLVDTQIMADFAGIGVSM-GFAKLVAHYLQIELDKGASRTDWL 144

Query: 142 ADDLSDEQLQYAASDVVHL 160
           A  LS+EQLQYAA+DV +L
Sbjct: 145 ARPLSEEQLQYAAADVWYL 163


>gi|33152538|ref|NP_873891.1| ribonuclease D [Haemophilus ducreyi 35000HP]
 gi|33148762|gb|AAP96280.1| ribonuclease D [Haemophilus ducreyi 35000HP]
          Length = 373

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 7/171 (4%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
           AIA+DTE +       +  ++QL  G+ T  +D   I+    +    + +L +    K+ 
Sbjct: 28  AIALDTEFIRTRSYYPKFGLIQLFDGEQTSLIDPTTIS----DFLPFIDLLANPNIVKVL 83

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H    D+ +  + F   + P+  T+I +  +    +  G    +   L I + K    +D
Sbjct: 84  HACSEDLEIFQHQFNQALTPLIDTQIMAAFSGLGLS-IGFAKLVNHYLNIELDKGASRTD 142

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           W A  L++ QLQYAA+DV +L  +  +   +L +    +     C  L+++
Sbjct: 143 WLARPLTETQLQYAAADVYYLLPIYQKLQAELAQTNWQEAVNQECQLLVNK 193


>gi|15596491|ref|NP_249985.1| ribonuclease D [Pseudomonas aeruginosa PAO1]
 gi|9947230|gb|AAG04683.1|AE004559_2 ribonuclease D [Pseudomonas aeruginosa PAO1]
          Length = 374

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 3/157 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           +A+DTE + +        +VQ+  GDG  + +      ++      +L DE+  K+ H  
Sbjct: 28  LALDTEFMRVDTFYPAAGLVQV--GDGRQEWLIDPLLIQDWSPFAELLEDERVVKVLHAC 85

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V     G    P+F T++A+       +  G    +KE+L I++ K +  SDW  
Sbjct: 86  SEDLEVFLRLTGSLPVPLFDTQLAAAYL-GMAHSMGYSKLVKEVLDIDLPKDETRSDWLQ 144

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
             L++ Q++YAA DV HL  + L    +L    R+ L
Sbjct: 145 RPLTEMQMRYAADDVQHLAQVYLALDTRLSEEKRAWL 181


>gi|223041446|ref|ZP_03611649.1| ribonuclease D [Actinobacillus minor 202]
 gi|223017704|gb|EEF16111.1| ribonuclease D [Actinobacillus minor 202]
          Length = 373

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 83/171 (48%), Gaps = 12/171 (7%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           AIA+DTE + +     +L ++QL  G+  V +I  ++ +  +P  + +L +    K+ H 
Sbjct: 28  AIALDTEFIRIRSFYPQLGLIQLFDGE-QVSLIDPSSIEDFSP-FIALLANPDVIKVLHA 85

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              D+ V  Y F     P+  T++ A  L R  +   G    ++  L I + K    +DW
Sbjct: 86  CSEDLEVFEYRFKQLPTPLVDTQVVAGFLNRGISI--GFAKLVEHYLHIELDKGASRTDW 143

Query: 141 SADDLSDEQLQYAASDVVHL----HALRLQFTEKLQRLGRSDLATSCCNFL 187
            A  LS+ Q QYAA+DV +L    H ++ + +E   R  ++ +   C  FL
Sbjct: 144 LARPLSEIQCQYAAADVFYLLPVYHKMQKELSEN--RWQKA-VEEECQKFL 191


>gi|28871074|ref|NP_793693.1| ribonuclease D [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28854324|gb|AAO57388.1| ribonuclease D [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 377

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K
Sbjct: 79  KVVHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
            +  SDW    LSD Q+ YAA D VHL  L
Sbjct: 135 GETRSDWLQRPLSDTQISYAAEDAVHLAEL 164


>gi|41408900|ref|NP_961736.1| hypothetical protein MAP2802 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41397259|gb|AAS05119.1| hypothetical protein MAP_2802 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 428

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 81/182 (44%), Gaps = 9/182 (4%)

Query: 14  ECAARYVD----AIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVG 68
           E AAR +D      AVD E        +R  ++Q+   G GTV I  ++ G      L  
Sbjct: 37  EDAARRLDRGRGPFAVDAERASGFRYSNRAYLIQIRRAGAGTVLIDPVSHGADPVRALRP 96

Query: 69  ML-VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
           +  V    E I H    D+  L    G+R   ++ T++A RL      +  L   ++ LL
Sbjct: 97  VAEVLGSDEWILHSADQDLPCL-AEVGMRPPALYDTELAGRLA--GFERVNLATMVERLL 153

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G  ++K   ++DWS   L  E L YAA DV  L  LR    + L   G++D A    ++L
Sbjct: 154 GFGLAKGHGAADWSKRPLPAEWLNYAALDVELLIELRAAIADVLAEQGKTDWAAQEFDYL 213

Query: 188 MD 189
            +
Sbjct: 214 RE 215


>gi|213969693|ref|ZP_03397828.1| ribonuclease D [Pseudomonas syringae pv. tomato T1]
 gi|301383544|ref|ZP_07231962.1| ribonuclease D [Pseudomonas syringae pv. tomato Max13]
 gi|302062110|ref|ZP_07253651.1| ribonuclease D [Pseudomonas syringae pv. tomato K40]
 gi|302130100|ref|ZP_07256090.1| ribonuclease D [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213925501|gb|EEB59061.1| ribonuclease D [Pseudomonas syringae pv. tomato T1]
          Length = 377

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K
Sbjct: 79  KVVHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
            +  SDW    LSD Q+ YAA D VHL  L
Sbjct: 135 GETRSDWLQRPLSDTQISYAAEDAVHLAEL 164


>gi|184201057|ref|YP_001855264.1| putative ribonuclease D [Kocuria rhizophila DC2201]
 gi|183581287|dbj|BAG29758.1| putative ribonuclease D [Kocuria rhizophila DC2201]
          Length = 420

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 74/174 (42%), Gaps = 18/174 (10%)

Query: 13  AECAARYVDAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGML- 70
           AE  A     +AVDTE         R  +VQL   G GTV I          P  VG L 
Sbjct: 37  AEQLAAAHGPVAVDTERASGFRYGQRAFLVQLRREGAGTVLI---------DPEAVGSLA 87

Query: 71  -VDEKR---EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
            VDE     E + H    D+  L     +    +F T++  RL      + GL    +EL
Sbjct: 88  EVDEALRGVEWVLHAATQDMPCL-AELDMHPDELFDTELGGRLL--GLRKVGLASMTEEL 144

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           LG  +SK   + DWS   L  + L YAA DV  L  LR    E+L R G+ D A
Sbjct: 145 LGFTLSKEHSAVDWSQRPLPVDWLNYAALDVEVLVQLRWATEERLARAGKLDWA 198


>gi|269126003|ref|YP_003299373.1| 3'-5' exonuclease [Thermomonospora curvata DSM 43183]
 gi|268310961|gb|ACY97335.1| 3'-5' exonuclease [Thermomonospora curvata DSM 43183]
          Length = 437

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 74/158 (46%), Gaps = 14/158 (8%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGM---LVDEKREKI 78
           +AVD E         R  ++QL   G GT  I  IA      P+L G+   L D   E +
Sbjct: 70  VAVDAERASGYRYGQRAYLIQLRRQGAGTALIDPIAC-----PDLSGLDAALADA--EMV 122

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
            H    D+  L    G+R R +F T++A RL      + GL   ++ +LG  + K   + 
Sbjct: 123 LHAANQDLPCL-AEVGLRPRRLFDTELAGRLL--GHPKVGLGSMVENVLGFVLEKGHSAV 179

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           DWS   L ++ L+YAA DV  L  LR     +L+R G+
Sbjct: 180 DWSTRPLPEDWLRYAALDVELLIELRDALHAELERAGK 217


>gi|239983036|ref|ZP_04705560.1| ribonuclease D [Streptomyces albus J1074]
 gi|291454868|ref|ZP_06594258.1| ribonuclease D [Streptomyces albus J1074]
 gi|291357817|gb|EFE84719.1| ribonuclease D [Streptomyces albus J1074]
          Length = 348

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 79/173 (45%), Gaps = 13/173 (7%)

Query: 13  AECAARYV---DAIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVG 68
           AE  ARY      +AVD E         R  +VQL   G GT  I  +A      P+L G
Sbjct: 56  AETVARYAAGSGPLAVDAERASGYRYGQRAYLVQLRREGAGTALIDPVAC-----PDLSG 110

Query: 69  M-LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
           +  V E  E + H    D+  L    G+  + +F T++A RL      + GL   ++ +L
Sbjct: 111 LGEVVEDAEWLLHAATQDLPCL-RDIGMVPQRLFDTELAGRLA--GFARVGLGAMVENVL 167

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           G ++ K   + DWS   L +  L+YAA DV  L  LR    E+L   G+ D A
Sbjct: 168 GYSLEKGHSAVDWSTRPLPEPWLRYAALDVELLADLRDALEEELAGQGKLDWA 220


>gi|227875468|ref|ZP_03993609.1| ribonuclease D [Mobiluncus mulieris ATCC 35243]
 gi|227844022|gb|EEJ54190.1| ribonuclease D [Mobiluncus mulieris ATCC 35243]
          Length = 397

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 77/175 (44%), Gaps = 6/175 (3%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           E  A    ++A+DTE  G         +VQL   D    +I   A     P  +G  +  
Sbjct: 24  ELVAAGSGSVALDTERAGAFRYFQGAYLVQLRREDTGTFLIDPTAFPDLEP--LGAAIG- 80

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K E I H    D+  L    G+R + +F T++A++L      + GL    +++LGI + K
Sbjct: 81  KAEWILHDATTDMPWL-AEIGMRPKLLFDTELAAKLLNF--ERFGLGSLTEQVLGIMLEK 137

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
              ++DWS   L    L+YAA DV  L  LR     +L   G+ D A      L+
Sbjct: 138 EHSAADWSTRPLPQSWLEYAALDVEFLVDLRQALWLQLGEAGKDDWAEQEFEHLL 192


>gi|89094008|ref|ZP_01166952.1| ribonuclease D [Oceanospirillum sp. MED92]
 gi|89081682|gb|EAR60910.1| ribonuclease D [Oceanospirillum sp. MED92]
          Length = 397

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 68/143 (47%), Gaps = 8/143 (5%)

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
           +L  +  DE   K+ H    D+ +     G    P+F T+IA+ L   +    GL+  L+
Sbjct: 81  SLSTLFKDEGVVKVMHAATEDLELFHKEIGALPVPLFDTQIAAALI-NWGFSMGLQRMLE 139

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHAL-RLQFTEKLQRLGRSDLATSC 183
             L + + K + +S+W    L+  Q +YAA DV +L A+  +Q  E L R G        
Sbjct: 140 SCLSVQLEKHETTSNWLQRPLTSSQEKYAALDVAYLPAIYEIQRQELLSR-GHFHWVEQE 198

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
           C+ ++  A +D     +VD FS+
Sbjct: 199 CSAMLADAAID-----DVDGFSY 216


>gi|323499349|ref|ZP_08104325.1| ribonuclease D [Vibrio sinaloensis DSM 21326]
 gi|323315534|gb|EGA68569.1| ribonuclease D [Vibrio sinaloensis DSM 21326]
          Length = 371

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 83/194 (42%), Gaps = 16/194 (8%)

Query: 4   IRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQ 60
           I     ++ A C  AR  D + +DTE +       +L ++QL  G+    +D   +    
Sbjct: 5   IVTQTSELVAVCKQARESDVVMLDTEFVRTRTFYPQLGLIQLFDGEHLSLIDPTEL---- 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           ++    V +L D    K+ H    D+ V   +FG    P+  T++ +         HGL 
Sbjct: 61  EDMTAFVQLLQDTSVLKVLHACGEDLEVFHNSFGCLPYPMVDTQLMAAFL-----GHGLS 115

Query: 121 DNLKEL----LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
                L    L + + K++  +DW A  L+D+QL YAA+DV +L  L  +    +   G 
Sbjct: 116 TGFAALVDHYLQVELDKSESRTDWLARPLTDKQLDYAAADVFYLWPLYEKLLAAVTEAGW 175

Query: 177 SDLATSCCNFLMDR 190
            + A    + L  +
Sbjct: 176 WEAAQQESDLLASK 189


>gi|288817697|ref|YP_003432044.1| DNA polymerase I [Hydrogenobacter thermophilus TK-6]
 gi|288787096|dbj|BAI68843.1| DNA polymerase I [Hydrogenobacter thermophilus TK-6]
 gi|308751295|gb|ADO44778.1| DNA-directed DNA polymerase [Hydrogenobacter thermophilus TK-6]
          Length = 576

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 66/133 (49%), Gaps = 9/133 (6%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRF 84
           +DTET+      +++ +VQL   +    +     G      L  +LVD  +  + H  ++
Sbjct: 27  LDTETVS-----EKIRLVQLGNNEDVFIVDLFETGSYGVDFLKDLLVD--KGIVGHNLKY 79

Query: 85  DIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADD 144
           D+  L Y +G+    VF T IAS+L     ++H L+      LG  + K+ Q S+W    
Sbjct: 80  DLKFL-YRYGIEPYAVFDTMIASQLLGE-LDRHSLQKVAMHYLGEVLDKSLQMSNWGRAV 137

Query: 145 LSDEQLQYAASDV 157
           LS EQL+YAA DV
Sbjct: 138 LSKEQLEYAALDV 150


>gi|307544648|ref|YP_003897127.1| ribonuclease D [Halomonas elongata DSM 2581]
 gi|307216672|emb|CBV41942.1| ribonuclease D [Halomonas elongata DSM 2581]
          Length = 395

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 58/125 (46%), Gaps = 1/125 (0%)

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           L+ E   K+ H    D+ V  +  GV V P+  T+IA  L        G +  ++  +G 
Sbjct: 91  LLGEGPVKLLHASSEDLEVFLHWAGVTVSPLVDTQIAQALL-GEVPAMGYQKLVEFWVGE 149

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            + K +  S+W    LS+ Q  YAA DV++L  +     + L+R GR       C  L+D
Sbjct: 150 TLPKDETRSNWLERPLSETQTTYAALDVIYLLEVWQVQRDALERYGRLGWLEEECRKLVD 209

Query: 190 RAELD 194
           +A  D
Sbjct: 210 QAARD 214


>gi|118463563|ref|YP_882753.1| ribonuclease D [Mycobacterium avium 104]
 gi|118164850|gb|ABK65747.1| ribonuclease D [Mycobacterium avium 104]
          Length = 428

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 81/182 (44%), Gaps = 9/182 (4%)

Query: 14  ECAARYVD----AIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVG 68
           E AAR +D      AVD E        +R  ++Q+   G GTV I  ++ G      L  
Sbjct: 37  EDAARRLDRGRGPFAVDAERASGFRYSNRAYLIQIRRAGAGTVLIDPVSHGADPVRALRP 96

Query: 69  ML-VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
           +  V    E I H    D+  L    G+R   ++ T++A RL      +  L   ++ LL
Sbjct: 97  VAEVLGSDEWILHSADQDLPCL-AEVGMRPPALYDTELAGRLA--GFERVNLATMVERLL 153

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G  ++K   ++DWS   L  E L YAA DV  L  LR    + L   G++D A    ++L
Sbjct: 154 GFGLAKGHGAADWSKRPLPAEWLNYAALDVELLIELRAAIADVLAEQGKTDWAAQEFDYL 213

Query: 188 MD 189
            +
Sbjct: 214 RE 215


>gi|239946745|ref|ZP_04698498.1| ribonuclease D [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921021|gb|EER21045.1| ribonuclease D [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 281

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 75/169 (44%), Gaps = 7/169 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           +++DTE         +L I+Q+   +  G +D    A    +      +L D    KIFH
Sbjct: 23  LSIDTEFERRYTYYAQLSIIQVKAEEYCGIID----ALSNLDLNIFNKLLADNNITKIFH 78

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
             R D+ + +  F +    VF  +IA+ +   +  Q    D   +L+GI I K  Q S+W
Sbjct: 79  APREDLEIFYNLFKILPSNVFDIQIAANIC-GFGKQLSYNDLCYKLIGITIDKTHQKSNW 137

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
               ++ + L YA  DV +L+ +  +    + R   ++   +  + L+D
Sbjct: 138 LKRPITSDMLNYAMLDVEYLYKIYKELNNIIIRNNLTNKYQTTLSSLLD 186


>gi|306818778|ref|ZP_07452500.1| ribonuclease D [Mobiluncus mulieris ATCC 35239]
 gi|304648464|gb|EFM45767.1| ribonuclease D [Mobiluncus mulieris ATCC 35239]
          Length = 422

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 77/175 (44%), Gaps = 6/175 (3%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           E  A    ++A+DTE  G         +VQL   D    +I   A     P  +G  +  
Sbjct: 49  ELVAAGSGSVALDTERAGAFRYFQGAYLVQLRREDTGTFLIDPTAFPDLEP--LGTAIG- 105

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K E I H    D+  L    G+R + +F T++A++L      + GL    +++LGI + K
Sbjct: 106 KAEWILHDATTDMPWL-AEIGMRPKLLFDTELAAKLLNF--ERFGLGSLTEQVLGIMLEK 162

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
              ++DWS   L    L+YAA DV  L  LR     +L   G+ D A      L+
Sbjct: 163 EHSAADWSTRPLPQSWLEYAALDVEFLVDLRQALWLQLGEAGKDDWAEQEFEHLL 217


>gi|114562909|ref|YP_750422.1| ribonuclease D [Shewanella frigidimarina NCIMB 400]
 gi|114334202|gb|ABI71584.1| ribonuclease D [Shewanella frigidimarina NCIMB 400]
          Length = 370

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 71/151 (47%), Gaps = 7/151 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTE +       +L ++Q   G  T+ +I   A    +P    +L D+   K+ H  
Sbjct: 26  LVLDTEFVRTRTYYAKLGLIQAYDGK-TLALIDPVAITDLSP-FWQLLTDQNIVKLVHSC 83

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL--KDNLKELLGINISKAQQSSDW 140
             D+ V  +    +  P+F ++IA+         HGL     +   L + I K +  +DW
Sbjct: 84  SEDLEVFAHYGECQPSPLFDSQIAASFAGL---GHGLGYAKLVDACLQVEIDKGESRTDW 140

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
               LSD QLQYAA+DV +L+ L  Q  +KL
Sbjct: 141 MNRPLSDAQLQYAANDVFYLYQLYPQLQQKL 171


>gi|110834629|ref|YP_693488.1| ribonuclease D [Alcanivorax borkumensis SK2]
 gi|110647740|emb|CAL17216.1| ribonuclease D [Alcanivorax borkumensis SK2]
          Length = 357

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 80/180 (44%), Gaps = 9/180 (5%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRF 84
           +DTE +       +L +VQ+  G   V I  I   + + P L+ +   +    + H    
Sbjct: 27  LDTEFMRERTFWPQLALVQVHDG---VRIRLIDTTEVDGPTLLPVF--QNHTLVMHACSE 81

Query: 85  DIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADD 144
           D+  +    G     +  T+IA+ L+     Q G +  ++ LLG+++ K    ++W    
Sbjct: 82  DLEAIATFTGQYPAAIEDTQIAAALS-GEDMQWGYQKVVQMLLGVDLPKGATRTNWLKRP 140

Query: 145 LSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL---GWENV 201
           LSDEQL YA  DV +L  +     E+L  LGR       C  L+ +A   +L    W NV
Sbjct: 141 LSDEQLHYAEDDVKYLPEVAGILAERLDGLGRRAWWEEECARLLKQARSQVLPQDAWRNV 200


>gi|255319565|ref|ZP_05360778.1| ribonuclease D, processes tRNA [Acinetobacter radioresistens SK82]
 gi|262379863|ref|ZP_06073019.1| ribonuclease D [Acinetobacter radioresistens SH164]
 gi|255303363|gb|EET82567.1| ribonuclease D, processes tRNA [Acinetobacter radioresistens SK82]
 gi|262299320|gb|EEY87233.1| ribonuclease D [Acinetobacter radioresistens SH164]
          Length = 380

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 75  REKIFHYGRFDIAVLFYTFG-VRVRPVFCTKIA-SRLTRTYTNQHGLKDNLKELLGINIS 132
           ++ IFH    DI ++++  G   +  VF T++  S L +    Q   ++ LK +L I+I 
Sbjct: 72  QQNIFHACSEDIDLIYHYAGPYSLSNVFDTQVGLSFLGQGL--QVSYQNALKLVLDIDIE 129

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           K Q  SDW A  L+DEQL YAA+DV++L  L  Q   +L++    +     C  L
Sbjct: 130 KDQTRSDWLARPLTDEQLHYAANDVLYLGQLAEQIKTELKQKNLYECVLEDCKHL 184


>gi|196232584|ref|ZP_03131436.1| 3'-5' exonuclease [Chthoniobacter flavus Ellin428]
 gi|196223346|gb|EDY17864.1| 3'-5' exonuclease [Chthoniobacter flavus Ellin428]
          Length = 352

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 73/165 (44%), Gaps = 10/165 (6%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PG-DGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           I +DTE   L    ++LC++Q+S PG D  +D +   + Q       G      +E I H
Sbjct: 24  IPIDTEADSLHCYFEKLCLIQISVPGHDLLIDPLAGISLQPLFEAFAG------KELIIH 77

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
              +D+ +L         PVF T IA+RL      +  L   +K    + ++KA Q ++W
Sbjct: 78  GADYDLRLLRRVGFTVTAPVFDTMIAARLC--GIEEFSLAALIKRYFDVALTKASQKANW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +   LS +   YA  D  +L  +      +L RL R +     C+
Sbjct: 136 ARRPLSPQMADYAVKDTHYLLEIAGILEAELTRLDRMEWFRQSCD 180


>gi|269977281|ref|ZP_06184254.1| ribonuclease D [Mobiluncus mulieris 28-1]
 gi|307701108|ref|ZP_07638133.1| putative ribonuclease D [Mobiluncus mulieris FB024-16]
 gi|269934584|gb|EEZ91145.1| ribonuclease D [Mobiluncus mulieris 28-1]
 gi|307614103|gb|EFN93347.1| putative ribonuclease D [Mobiluncus mulieris FB024-16]
          Length = 422

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 77/175 (44%), Gaps = 6/175 (3%)

Query: 14  ECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           E  A    ++A+DTE  G         +VQL   D    +I   A     P  +G  +  
Sbjct: 49  ELVAAGSGSVALDTERAGAFRYFQGAYLVQLRREDTGTFLIDPTAFPDLEP--LGAAIG- 105

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           K E I H    D+  L    G+R + +F T++A++L      + GL    +++LGI + K
Sbjct: 106 KAEWILHDATTDMPWL-AEIGMRPKLLFDTELAAKLLNF--ERFGLGSLTEQVLGIMLEK 162

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
              ++DWS   L    L+YAA DV  L  LR     +L   G+ D A      L+
Sbjct: 163 EHSAADWSTRPLPQSWLEYAALDVEFLVDLRQALWLQLGEAGKDDWAEQEFEHLL 217


>gi|118618645|ref|YP_906977.1| hypothetical protein MUL_3315 [Mycobacterium ulcerans Agy99]
 gi|183982048|ref|YP_001850339.1| hypothetical protein MMAR_2035 [Mycobacterium marinum M]
 gi|118570755|gb|ABL05506.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99]
 gi|183175374|gb|ACC40484.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 435

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 80/180 (44%), Gaps = 9/180 (5%)

Query: 14  ECAARYVD----AIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVG 68
           E AA  +D      AVD E        +R  ++Q+   G GTV I  ++ G      L  
Sbjct: 41  EAAATLLDRGSGPFAVDAERASGFRYSNRAYLIQIRRAGAGTVLIDPVSHGGDPLTVLQP 100

Query: 69  ML-VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
           +  V  K E I H    D+  L    G+R   ++ T++A RL     ++  L   ++ LL
Sbjct: 101 LAEVLAKDEWILHSADQDLPCL-AEVGMRPSALYDTELAGRLA--GYDRVNLATMVERLL 157

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G+ + K   ++DWS   L  + L YAA DV  L  LR   +  L   G+SD A     +L
Sbjct: 158 GMGLVKGHGAADWSKRPLPSDWLNYAALDVELLIELRSAISGVLAEQGKSDWAAQEFEYL 217


>gi|148272845|ref|YP_001222406.1| putative ribonuclease D [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830775|emb|CAN01715.1| putative ribonuclease D [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 496

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E + H    D+A L    G+  + +F T++ASRL      + GL   ++ELLGI+++K  
Sbjct: 175 EWVLHAASQDLACL-REVGLDPQRIFDTELASRLL--GLPRVGLGTVVEELLGIHLAKEH 231

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++DWS   L    L YAA DV  L  +R +   +L+  G++ +A
Sbjct: 232 SAADWSTRPLPRAWLVYAALDVELLVDVRDEIARRLEEQGKTGIA 276


>gi|226487924|emb|CAX75627.1| Exosome component 10 [Schistosoma japonicum]
          Length = 860

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 9/153 (5%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IAVD E           C++Q+S  D T  II   A   +   L  +  D K  K+FH  
Sbjct: 280 IAVDLEHHSYRSFLGITCLIQISTLD-TDYIIDALALHDHLSILNEVFTDPKIVKVFHGS 338

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG---LKDNLKELLGINISKAQQSSD 139
             D+  L   FGV V  +F T +A+RL      QHG   L   L+  + IN +K  Q +D
Sbjct: 339 DSDLMWLQRDFGVYVVNLFDTGVAARLL-----QHGRFSLSYLLQRYVNINPNKKYQLAD 393

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
           W    L +E ++YA +D  +L  +  +   +LQ
Sbjct: 394 WRIRPLPNELIEYARTDTHYLLHIASRMCRELQ 426


>gi|290475404|ref|YP_003468292.1| RNase D, processes tRNA [Xenorhabdus bovienii SS-2004]
 gi|289174725|emb|CBJ81524.1| RNase D, processes tRNA precursor [Xenorhabdus bovienii SS-2004]
          Length = 385

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 68/143 (47%), Gaps = 7/143 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           IA+DTE +       +L ++QL  G+    +D + I+  Q        +L D    K  H
Sbjct: 35  IALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPLDISEWQP----FRELLTDRDVLKFIH 90

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V + +F     P+  T++ +     +    G    + + L + + K++  +DW
Sbjct: 91  AGSEDLEVFWNSFQCLPTPMIDTQVLAAFI-GHPMSCGFATLVAQYLHVELDKSESRTDW 149

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
            A  LS++Q +YAA+DV +L  L
Sbjct: 150 LARPLSEKQCEYAAADVYYLLPL 172


>gi|187735079|ref|YP_001877191.1| 3'-5' exonuclease [Akkermansia muciniphila ATCC BAA-835]
 gi|187425131|gb|ACD04410.1| 3'-5' exonuclease [Akkermansia muciniphila ATCC BAA-835]
          Length = 352

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 83/178 (46%), Gaps = 10/178 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT--VDIIRIAAGQKNAPNLVGMLVDE 73
           AA+    + +D E   L   ++++C++Q +   G+  +D + I   +   P    +   +
Sbjct: 16  AAQPAGRVVLDLEADSLHRYQEKICLIQYADETGSCLIDPLSI---EDMGPFYNWL---K 69

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           + E   H   +D+++    +      ++ T+ A+RL      Q GL   ++   GI +SK
Sbjct: 70  ETEVWMHGADYDMSLFQNAWETLPAMIWDTQTAARLLGF--RQFGLAALVEHFHGITLSK 127

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           + Q +DW+   LS   + YA +DV ++  +  + T  L++ GR       C   M+RA
Sbjct: 128 SSQKADWARRPLSPTMVTYALNDVNYMLDMADKLTAALRKKGRMGWFEEICRHSMERA 185


>gi|27462176|gb|AAO15360.1| thermostable DNA polymerase [Aquifex pyrophilus]
          Length = 574

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 70/143 (48%), Gaps = 16/143 (11%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTET G     +R+ +VQL   + T  +I +       P  +  L+ EK   I H  
Sbjct: 25  LYLDTETTG-----NRIRLVQLGDDEKTY-VIDLYEIHDITP--LRELISEKG-VIGHNL 75

Query: 83  RFDIAVLFYTFGVRVRPV--FCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           +FD   L Y    ++ P+  F T IAS L      +H L   +  LLG  + K+ Q SDW
Sbjct: 76  KFD---LHYLMNYQIEPLATFDTMIASFLLGY--ERHSLNHLVGNLLGYTLDKSYQLSDW 130

Query: 141 SADDLSDEQLQYAASDVVHLHAL 163
            A  LSD QL+YAA DV  L  L
Sbjct: 131 GAPVLSDAQLKYAAKDVDVLREL 153


>gi|24374123|ref|NP_718166.1| ribonuclease D [Shewanella oneidensis MR-1]
 gi|24348616|gb|AAN55610.1|AE015699_8 ribonuclease D [Shewanella oneidensis MR-1]
          Length = 367

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 7/105 (6%)

Query: 77  KIFHYGRFDIAVLFYTFGVR-VRPVFCTKIASRLTRTYTNQHGL--KDNLKELLGINISK 133
           K+ H    D+ V F  +G R   P+F ++IA+ L       HGL     ++  LG  I K
Sbjct: 76  KLVHSCSEDLEV-FAHYGQRQPTPLFDSQIAASLCGM---GHGLGYAKLVETCLGEVIDK 131

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            +  +DW    L+D QL YAA+DV++L+ L  Q  EKLQ   R D
Sbjct: 132 GESRTDWMRRPLTDAQLSYAANDVLYLYQLYPQLAEKLQTQDRLD 176


>gi|115665303|ref|XP_001177704.1| PREDICTED: similar to RE33408p [Strongylocentrotus purpuratus]
 gi|115976409|ref|XP_001186302.1| PREDICTED: similar to RE33408p [Strongylocentrotus purpuratus]
          Length = 579

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 72/160 (45%), Gaps = 18/160 (11%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV---DIIRIAAGQKNAPNLVGMLVDEK 74
           R    I +D E +GL      L +VQ+S  DG     D  +     K   +L  +L    
Sbjct: 387 RETVVIGLDCEGVGLGRAGGCLTLVQISTWDGKAFLFDAFKNPQLLKGNSSLKKILEHNS 446

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASR-----LTRTYTNQHGLKDNLKELLGI 129
             K+ H  + D   L++ FGV+++ VF T IA R     L R  + Q G K  L ELLG 
Sbjct: 447 ILKVIHDCKSDAYSLYHGFGVKLKNVFDTSIAMRTIMEQLNRNRSYQVGFK-ALCELLGE 505

Query: 130 N--------ISKAQQSSD-WSADDLSDEQLQYAASDVVHL 160
                    + K  ++ D W    L++E + YAASD + L
Sbjct: 506 GASHKDDDFVKKMLETPDFWKIRPLTEEMIYYAASDALCL 545


>gi|300864534|ref|ZP_07109398.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300337492|emb|CBN54546.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 880

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 79/179 (44%), Gaps = 18/179 (10%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQL--SPGDGTVDIIRIAAGQKNAPNLVGMLVD-----E 73
           + I  DTE         RL ++Q+   P D T D   I     + P LV   +D      
Sbjct: 21  EIIWADTEVADWQTPNPRLSLIQILADPNDLTGDFAYIL-DVLDKPELVENFIDLIMANP 79

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCT-KIASRLT--RTYTNQHGLKDNLKELLGIN 130
             EK+FH   +D+  L  T   + + V CT KIA +L+  R       LK     L    
Sbjct: 80  TIEKVFHNSSYDLRYLGKT---QAKNVTCTWKIAQKLSLERLQVPNRQLKTLAAGLCKFT 136

Query: 131 -ISKAQQSSDWSADDLSDEQLQYAASDVVHL---HALRLQFTEKLQRLGRSDLATSCCN 185
            I+K +Q+SDW    L+ +QL YA  D V+L   H   L+ T +   + +S+++    N
Sbjct: 137 EINKQEQTSDWGRRPLTQKQLDYAKMDTVYLAGVHRRLLELTNQKHLIIKSNISMPPAN 195


>gi|224123860|ref|XP_002319182.1| predicted protein [Populus trichocarpa]
 gi|222857558|gb|EEE95105.1| predicted protein [Populus trichocarpa]
          Length = 858

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 10/147 (6%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDII--RIAAGQKNAPNLVGMLVDE 73
           R V+  AVD E       +   C++Q+S    D  VD +  RI  G    P L  +  D 
Sbjct: 250 RGVNEFAVDLEHNQYRSFQGLTCLMQISTRTEDFIVDTLKLRIHVG----PYLREVFKDP 305

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
            + K+ H    D+  L   FG+ +  +F T  ASR+ +   N   L+  L    G+  +K
Sbjct: 306 AKRKVMHGADRDVVWLQRDFGIYICNLFDTGQASRVLKLERN--SLEHLLHHFCGVTANK 363

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHL 160
             Q++DW    L DE ++YA  D  +L
Sbjct: 364 EYQNADWRLRPLPDEMIRYAREDTHYL 390


>gi|294790936|ref|ZP_06756094.1| putative ribonuclease D [Scardovia inopinata F0304]
 gi|294458833|gb|EFG27186.1| putative ribonuclease D [Scardovia inopinata F0304]
          Length = 433

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 90  FYTFGVRVRPVFCTKIASRLTRTYTNQH-GLKDNLKELLGINISKAQQSSDWSADDLSDE 148
           +Y  G+R   +F T+ A+RL     N H GL    ++ LG+ ++K   ++DWS   L+ +
Sbjct: 102 YYALGMRPSRLFDTERAARL---LGNAHFGLAAVTEKYLGLTLAKEHSAADWSYRPLNRD 158

Query: 149 QLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
              YAA DV  L  LR   + +L+R G+ + A     FL+ + 
Sbjct: 159 MRNYAALDVEVLIELRNTLSAELRRSGKEEWAQEDFAFLLKKG 201


>gi|289706235|ref|ZP_06502598.1| putative ribonuclease D [Micrococcus luteus SK58]
 gi|289557074|gb|EFD50402.1| putative ribonuclease D [Micrococcus luteus SK58]
          Length = 416

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 3/101 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E I H    D+  L    G+R   +F T++A+R+      + GL   L+ELLG+ ++K  
Sbjct: 98  EWILHAASQDLPCLAEQ-GLRPDRLFDTELAARVA--GLPRVGLAAVLEELLGVTLAKEH 154

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            ++DWS   L +  L YAA DV  L  LR     +L+  G+
Sbjct: 155 SAADWSVRPLPEAMLAYAALDVELLVPLREALIARLEADGK 195


>gi|170782038|ref|YP_001710370.1| putative ribonuclease [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169156606|emb|CAQ01757.1| putative ribonuclease [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 443

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E + H    D+A L    G+  + +F T++ASRL      + GL   ++ELLGI+++K  
Sbjct: 122 EWVLHAASQDLACL-REVGLDPQRIFDTELASRLL--GLPRVGLGTVVEELLGIHLAKEH 178

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++DWS   L    L YAA DV  L  +R +   +L+  G++ +A
Sbjct: 179 SAADWSTRPLPRAWLVYAALDVELLVDVRDEIARRLEEQGKTAIA 223


>gi|240169721|ref|ZP_04748380.1| hypothetical protein MkanA1_10437 [Mycobacterium kansasii ATCC
           12478]
          Length = 433

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 85/187 (45%), Gaps = 11/187 (5%)

Query: 1   MTTIRVHEGDIPAECAARYVD----AIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIR 55
           M  + V  G I  E AA  +D      AVD E        +R  ++Q+   G GTV I  
Sbjct: 30  MPDLSVTVGQI--EAAAELLDRGRGPFAVDAERASGFRYSNRAYLIQIRRAGAGTVLIDP 87

Query: 56  IAAGQKNAPNLVGML-VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
           ++ G + A  L  +  V  + E I H    D+  L    G+R   ++ T++A RL     
Sbjct: 88  VSHGGEPATALQPVAEVLRQDEWILHSADQDLPCL-AEVGMRPSALYDTELAGRLA--GF 144

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           ++  L   ++ LLG+ ++K   ++DWS   L    L YAA DV  L  LR   ++ L   
Sbjct: 145 DRVNLATMVERLLGLGLAKGHGAADWSKRPLPPAWLNYAALDVELLIELRAAISQVLTEQ 204

Query: 175 GRSDLAT 181
           G++  A 
Sbjct: 205 GKTGWAA 211


>gi|254776017|ref|ZP_05217533.1| ribonuclease D [Mycobacterium avium subsp. avium ATCC 25291]
          Length = 416

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 81/182 (44%), Gaps = 9/182 (4%)

Query: 14  ECAARYVD----AIAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVG 68
           E AAR +D      AVD E        +R  ++Q+   G GTV I  ++ G      L  
Sbjct: 25  EDAARRLDRGRGPFAVDAERASGFRYSNRAYLIQIRRAGAGTVLIDPVSHGADPVRALRP 84

Query: 69  ML-VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
           +  V    E I H    D+  L    G+R   ++ T++A RL      +  L   ++ LL
Sbjct: 85  VAEVLGSDEWILHSADQDLPCL-AEVGMRPPALYDTELAGRLA--GFERVNLATMVERLL 141

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G  ++K   ++DWS   L  E L YAA DV  L  LR    + L   G++D A    ++L
Sbjct: 142 GFGLAKGHGAADWSKRPLPAEWLNYAALDVELLIELRAAIADVLAGQGKTDWAAQEFDYL 201

Query: 188 MD 189
            +
Sbjct: 202 RE 203


>gi|37526051|ref|NP_929395.1| ribonuclease D [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36785481|emb|CAE14428.1| Ribonuclease D (RNase D) [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 375

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 76/177 (42%), Gaps = 7/177 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDE 73
            A+    +A+DTE +       +L ++QL  G+    +D + I   Q        ++   
Sbjct: 18  GAKKYSKVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLNITNWQP----FRELITHP 73

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           +  K+ H G  D+ V    F     P+  T++ +     +    G    + E + + + K
Sbjct: 74  QILKLLHAGSEDLEVFLNAFQCLPEPMIDTQVLAAFI-GHPLSCGFAALVAEYIHVELDK 132

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           ++  +DW A  LS++Q +YAA+DV +L  L         + G  + AT  C  +  R
Sbjct: 133 SESRTDWLARPLSEKQCEYAAADVYYLLPLADILMTATAQAGYMEAATGECRLISRR 189


>gi|323495020|ref|ZP_08100109.1| ribonuclease D [Vibrio brasiliensis LMG 20546]
 gi|323310677|gb|EGA63852.1| ribonuclease D [Vibrio brasiliensis LMG 20546]
          Length = 346

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 67/148 (45%), Gaps = 19/148 (12%)

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN--- 122
            V +L D    K+ H    D+ V   +FG    P+  T++ +         HGL      
Sbjct: 41  FVHLLQDTSVLKVLHACGEDLEVFQNSFGCLPYPMVDTQLMAAFL-----GHGLSTGFAA 95

Query: 123 -LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            + E L + + K++  +DW A  L+D+QL+YAA+DV +L  L  Q  E + + G    A 
Sbjct: 96  LVNEYLNVELDKSESRTDWLARPLTDKQLEYAAADVYYLLPLYEQLFENITQAGWWQAAQ 155

Query: 182 SCCNFLM---------DRAELDLLG-WE 199
              + +          +RA LD+ G W+
Sbjct: 156 QESDLIASKRIKTVNPERAYLDVKGAWQ 183


>gi|167623763|ref|YP_001674057.1| ribonuclease D [Shewanella halifaxensis HAW-EB4]
 gi|167353785|gb|ABZ76398.1| ribonuclease D [Shewanella halifaxensis HAW-EB4]
          Length = 369

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 78/162 (48%), Gaps = 11/162 (6%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           D + +DTE +       RL ++Q   G     I  +A    N      +L  E   K+ H
Sbjct: 24  DLLVLDTEFVRTRTYYARLGLIQAYDGKTLALIDPLAVS--NLELFWQLLNKESSVKLLH 81

Query: 81  YGRFDIAVLFYTFGVRVRP--VFCTKIASRLTRTYTNQHGL--KDNLKELLGINISKAQQ 136
               D+ V F  +G + +P  +F ++IA+ L       HGL     +++ L +++ K + 
Sbjct: 82  SCSEDLEV-FARYG-QCQPTNLFDSQIAAGLAGM---GHGLGYAKLVEQTLEVSLDKGES 136

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            +DW    L++ QL YAA+DV +L+ L  Q  +KL+  GR D
Sbjct: 137 RTDWLKRPLTEAQLNYAANDVYYLYKLYPQLVDKLKEQGRLD 178


>gi|327479994|gb|AEA83304.1| ribonuclease D [Pseudomonas stutzeri DSM 4166]
          Length = 374

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (44%), Gaps = 10/161 (6%)

Query: 15  CAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CA  R +  +AVDTE + +        +VQ+  GDG    +      ++      +L D 
Sbjct: 18  CAEWRQLPFVAVDTEFMRVDTFYPIAGLVQV--GDGRRAYLIDPLAVRDWHPFATLLDDA 75

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGIN 130
              K+ H    D+ VL    G   +P+F T++A+     Y N     G    ++ +LGI 
Sbjct: 76  AVVKVLHACSEDLEVLLRLTGSLPQPLFDTQLAA----GYLNIGFSMGYSRLVQAVLGIE 131

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
           + K +  SDW    LS+ Q++YAA D  HL  L      KL
Sbjct: 132 LPKGETRSDWLQRPLSEMQVRYAAEDAQHLAELYEALLPKL 172


>gi|325924432|ref|ZP_08185961.1| ribonuclease D [Xanthomonas gardneri ATCC 19865]
 gi|325545080|gb|EGD16405.1| ribonuclease D [Xanthomonas gardneri ATCC 19865]
          Length = 364

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 77/173 (44%), Gaps = 6/173 (3%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
            H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  
Sbjct: 6   THPSELTQRLHAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E
Sbjct: 64  LGEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL---QRLG 175
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + + +L    RLG
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELSRRLTEQDRLG 175


>gi|169630071|ref|YP_001703720.1| hypothetical protein MAB_2988 [Mycobacterium abscessus ATCC 19977]
 gi|169242038|emb|CAM63066.1| Conserved hypothetical protein (putative exonuclease)
           [Mycobacterium abscessus]
          Length = 400

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 5/121 (4%)

Query: 62  NAPNLVGMLVDE--KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           N P  +G +VD     E I H    D+  L     ++   ++ T++A RL      +  L
Sbjct: 79  NVPGSLGPIVDALGADEWILHAADQDLPCL-AELAMKPPSLYDTELAGRLA--GFEKVNL 135

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +  LLG+ ++K   ++DWS   L D+ L YAA DV  L  LR +  E L   G+++ 
Sbjct: 136 ASMVHRLLGLGLAKGHGAADWSKRPLPDDWLNYAALDVEVLVELRDKIAEVLAEQGKTEW 195

Query: 180 A 180
           A
Sbjct: 196 A 196


>gi|311898875|dbj|BAJ31283.1| putative ribonuclease D [Kitasatospora setae KM-6054]
          Length = 411

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 75/162 (46%), Gaps = 14/162 (8%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGM---LVDEKREKI 78
           +AVD E         R  ++QL   G GT  I  IA      P+L G+   L D   E +
Sbjct: 48  VAVDAERASGYRYGQRAYLIQLRRQGAGTALIDPIAC-----PDLTGLNAALADT--EWV 100

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
            H    D+  LF   G+    +F T++A RL      + GL    + +LG++++K   + 
Sbjct: 101 VHAATQDLPCLF-EVGMHPGVLFDTELAGRLA--GFPRVGLGPMTENVLGLSLAKEHSAV 157

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           DWS   L +  L+YAA DV  L  LR     +L R G+ D A
Sbjct: 158 DWSTRPLPEPWLRYAALDVEVLVDLRDALEAELDRQGKLDWA 199


>gi|330941897|gb|EGH44622.1| ribonuclease D [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 377

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K
Sbjct: 79  KVLHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLDIDLPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
            +  SDW    LS+ Q+ YAA D VHL  L
Sbjct: 135 GETRSDWLQRPLSETQISYAAEDAVHLAEL 164


>gi|284031654|ref|YP_003381585.1| 3'-5' exonuclease [Kribbella flavida DSM 17836]
 gi|283810947|gb|ADB32786.1| 3'-5' exonuclease [Kribbella flavida DSM 17836]
          Length = 422

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           E I H    D+A L    G+  R VF T++A RL      + GL   + E+LG  + K  
Sbjct: 104 EWIIHAANQDLACL-AEVGMVPRQVFDTELAGRLL--GYPKVGLASLVSEVLGYRMRKEH 160

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            ++DWS   L    L YAA DV  L  LR    ++L+R G+ + A
Sbjct: 161 SAADWSTRPLPGPWLVYAALDVEMLIELRDAIEQELRREGKWEWA 205


>gi|146281747|ref|YP_001171900.1| ribonuclease D [Pseudomonas stutzeri A1501]
 gi|145569952|gb|ABP79058.1| ribonuclease D [Pseudomonas stutzeri A1501]
          Length = 401

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (44%), Gaps = 10/161 (6%)

Query: 15  CAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           CA  R +  +AVDTE + +        +VQ+  GDG    +      ++      +L D 
Sbjct: 45  CAEWRQLPFVAVDTEFMRVDTFYPIAGLVQV--GDGRRAYLIDPLAVRDWHPFATLLDDA 102

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGIN 130
              K+ H    D+ VL    G   +P+F T++A+     Y N     G    ++ +LGI 
Sbjct: 103 AVVKVLHACSEDLEVLLRLTGSLPQPLFDTQLAA----GYLNIGFSMGYSRLVQAVLGIE 158

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
           + K +  SDW    LS+ Q++YAA D  HL  L      KL
Sbjct: 159 LPKGETRSDWLQRPLSEMQVRYAAEDAQHLAELYEALLPKL 199


>gi|289628944|ref|ZP_06461898.1| ribonuclease D [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651074|ref|ZP_06482417.1| ribonuclease D [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298486131|ref|ZP_07004194.1| Ribonuclease D [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298159138|gb|EFI00196.1| Ribonuclease D [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330868058|gb|EGH02767.1| ribonuclease D [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 377

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K
Sbjct: 79  KVVHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
            +  SDW    LS+ Q+ YAA D VHL  L
Sbjct: 135 GETRSDWLQRPLSETQISYAAEDAVHLAEL 164


>gi|168702958|ref|ZP_02735235.1| DNA polymerase I (PolI) [Gemmata obscuriglobus UQM 2246]
          Length = 203

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 65/129 (50%), Gaps = 12/129 (9%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGD--GTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           +   +AVDTET GL P RDR+ ++Q++ G     +D+   A    +   L   L D  +E
Sbjct: 47  WAGPVAVDTETTGLDPARDRVRLIQVAAGQDVALIDVFAFADPVADLRPLFAALAD--KE 104

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT----RTYTN---QHGLKDNLKELLGI 129
           ++ H  +FD+  L   F      VF T +ASR+     R  +N   +HGL D     LG 
Sbjct: 105 QVGHNLQFDLRFL-APFEFVPGKVFDTILASRVRHAGDRAESNGRFRHGLGDAAARELGR 163

Query: 130 NISKAQQSS 138
           ++ K++Q+ 
Sbjct: 164 SLDKSEQTP 172


>gi|330959294|gb|EGH59554.1| ribonuclease D [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 377

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K
Sbjct: 79  KVVHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
            +  SDW    LS+ Q+ YAA D VHL  L
Sbjct: 135 GETRSDWLQRPLSETQISYAAEDAVHLAEL 164


>gi|307946769|ref|ZP_07662104.1| ribonuclease D [Roseibium sp. TrichSKD4]
 gi|307770433|gb|EFO29659.1| ribonuclease D [Roseibium sp. TrichSKD4]
          Length = 330

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 22/137 (16%)

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK----- 124
           + D    K+FH  R D+ ++++   +   P+F +++A+ +        G  D++      
Sbjct: 1   MADRNVTKVFHAARQDVEIVYHLGKLIPAPLFDSQVAAMVC-------GFGDSISYDQLV 53

Query: 125 -ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ++ G  I K+ + +DWS   L+ +QL+YA +DV HL  +       L   GRS      
Sbjct: 54  YKVTGAQIDKSSRFTDWSRRPLTQKQLEYALADVTHLRDVYQFLKANLAEQGRS------ 107

Query: 184 CNFLMDRAELDLLGWEN 200
            +++ D  E+++L  EN
Sbjct: 108 -HWVQD--EMEILTSEN 121


>gi|256375684|ref|YP_003099344.1| 3'-5' exonuclease [Actinosynnema mirum DSM 43827]
 gi|255919987|gb|ACU35498.1| 3'-5' exonuclease [Actinosynnema mirum DSM 43827]
          Length = 414

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 75/159 (47%), Gaps = 7/159 (4%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLS-PGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           +AVDTE         R  +VQL   G GTV +  IA G +  P LV  L  E  E + H 
Sbjct: 50  VAVDTERASGYRYSQRAYLVQLRREGAGTVLVDPIALGGRLDP-LVEAL--EGTEWVLHA 106

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
              D+  L    G+    +F T++A RL      +  L   ++ LLG  + K   ++DWS
Sbjct: 107 ASQDLPCL-AELGLTPSALFDTELAGRLA--GFERVALGTLVELLLGYRLEKGHGAADWS 163

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              L  + L YAA DV  L  LR    E+L++ G+ + A
Sbjct: 164 RRPLPADWLNYAALDVELLVQLRDVLEEELRQQGKLEWA 202


>gi|70953922|ref|XP_746033.1| POM1 [Plasmodium chabaudi chabaudi]
 gi|56526532|emb|CAH77590.1| POM1, putative [Plasmodium chabaudi chabaudi]
          Length = 1429

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 46/152 (30%), Positives = 75/152 (49%), Gaps = 5/152 (3%)

Query: 24   AVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN--APNLVGMLVDEKREKIFHY 81
             +D ET GL    +++ ++Q++  +  V I  +     N     L  +L DE   KI   
Sbjct: 1246 GLDMETTGLEVFGEKIRLIQIAVENYPVIIYDMFNITNNNILDGLRKILNDENIVKIIQN 1305

Query: 82   GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN--LKELLGINISKAQQSSD 139
            G+FD   L Y     +  +F T IAS+L     N +G K N  +++ L + + K QQ+S 
Sbjct: 1306 GKFDTKFLLYN-NFNITNIFDTYIASKLLDKNKNMYGFKLNNIVEKYLSVYLDKQQQNSV 1364

Query: 140  WSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
            W+   L++ QL YAA D   L  L  + +E++
Sbjct: 1365 WNNSLLNNNQLFYAARDSSCLLKLYKKLSEQI 1396


>gi|330894750|gb|EGH27411.1| ribonuclease D [Pseudomonas syringae pv. mori str. 301020]
          Length = 377

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K
Sbjct: 79  KVVHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
            +  SDW    LS+ Q+ YAA D VHL  L
Sbjct: 135 GETRSDWLQRPLSETQISYAAEDAVHLAEL 164


>gi|157375657|ref|YP_001474257.1| ribonuclease D [Shewanella sediminis HAW-EB3]
 gi|157318031|gb|ABV37129.1| ribonuclease D [Shewanella sediminis HAW-EB3]
          Length = 369

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 70/156 (44%), Gaps = 3/156 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           + +DTE +       RL ++Q   G     I  IA G  N      +L + +   + H  
Sbjct: 26  LVLDTEFVRTRTYYARLGLIQAYDGKTLALIDPIAVG--NLSEFWSLLTEPEITTVLHSC 83

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ V       +   +F ++IA+ L   + +  G    +++ L I + K +  +DW  
Sbjct: 84  SEDLEVFARNGQCQPIRLFDSQIAASLC-GFGHGLGYAKLVEQTLNIALDKGESRTDWMK 142

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             LS  QL YAA+DV +L+ L  Q  +KL+   R D
Sbjct: 143 RPLSKAQLTYAANDVYYLYELYPQLIQKLEDTDRLD 178


>gi|300867748|ref|ZP_07112393.1| 3'-5' exonuclease (modular protein) [Oscillatoria sp. PCC 6506]
 gi|300334331|emb|CBN57565.1| 3'-5' exonuclease (modular protein) [Oscillatoria sp. PCC 6506]
          Length = 433

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT---NQHGLKDNLKELLGI-NI 131
           EK+ H   +DI  L      R + + CT   +R    Y      H LK  ++ L GI N+
Sbjct: 81  EKVMHNASYDIRFLG---NDRAQNITCTLKLARKIPYYVLPLPNHKLKTLIEALCGIPNV 137

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHL 160
            KA+Q  DW    L+++QL+YA  DVV+L
Sbjct: 138 DKAEQGGDWGKRPLTEKQLEYAKMDVVYL 166


>gi|257483935|ref|ZP_05637976.1| ribonuclease D [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|320325216|gb|EFW81283.1| ribonuclease D [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327790|gb|EFW83798.1| ribonuclease D [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330989388|gb|EGH87491.1| ribonuclease D [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331013134|gb|EGH93190.1| ribonuclease D [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 377

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN---QHGLKDNLKELLGINISK 133
           K+ H    D+ VL    G    P+F T++A+     Y N     G    ++E+L I++ K
Sbjct: 79  KVVHACSEDLEVLLRLTGSLPVPLFDTQLAA----AYLNLGFSMGYSRLVQEVLNIDLPK 134

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHAL 163
            +  SDW    LS+ Q+ YAA D VHL  L
Sbjct: 135 GETRSDWLQRPLSETQISYAAEDAVHLAEL 164


>gi|71735861|ref|YP_273799.1| ribonuclease D [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71556414|gb|AAZ35625.1| ribonuclease D [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 377

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query