PSIBLAST alignment of GI: 254780636 and protein with PDB id: 1d8y

>gi|6730276|pdb|1D8Y|A Chain A, Crystal Structure Of The Complex Of Dna Polymerase I Klenow Fragment With Dna Length = 605
 Score = 84.4 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 68/201 (33%), Gaps = 18/201 (8%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
                  A  T T  L      L  +  +   G    I +A    +AP+          L
Sbjct: 23  LEKAPVFAFATATDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERALELL 82

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L DEK  K+    ++D  +L           F T + S +  +   +H +    +  
Sbjct: 83  KPLLEDEKALKVGQNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRHDMDSLAERW 142

Query: 127 LGINISKAQQSSDWSADDLSDEQL------QYAASDVVHLHALRLQFTEKLQRL-GRSDL 179
           L       ++ +    + L+  Q+      +YAA D      L L+    LQ+  G  ++
Sbjct: 143 LKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLKMWPDLQKHKGPLNV 202

Query: 180 ATS-CCNFLMDRAELDLLGWE 199
             +     +   + ++  G +
Sbjct: 203 FENIEMPLVPVLSRIERNGVK 223