BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780636|ref|YP_003065049.1| ribonuclease D [Candidatus
Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|86136835|ref|ZP_01055413.1| exonuclease, putative [Roseobacter sp. MED193]
 gi|85826159|gb|EAQ46356.1| exonuclease, putative [Roseobacter sp. MED193]
          Length = 204

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 106/207 (51%), Positives = 146/207 (70%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P +        +A+D ET+GL P RDRLC++QLS GDG   I+++A GQ
Sbjct: 1   MAN-HLYQNDLPDDLKLG--PVVAIDCETMGLNPHRDRLCVIQLSDGDGNAHIVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D +  K+FH+GRFDIA +++ FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  TEAPNLCAMLEDPETLKLFHFGRFDIAAMYHAFGALTAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +EL+G++ISK QQ SDW A  L++ QL YAASDV++LH LR    ++L+R GR ++A
Sbjct: 118 NLTQELIGVDISKQQQMSDWGAKVLTEAQLDYAASDVLYLHRLREALNKRLEREGRMEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW   DIF+HS
Sbjct: 178 QACFDFLPMRAKLDLAGWPETDIFAHS 204


>gi|21328703|gb|AAM48709.1| 3'- 5' exonuclease family protein [uncultured marine
           proteobacterium]
          Length = 204

 Score =  203 bits (517), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 116/207 (56%), Positives = 149/207 (71%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   V++GD+P          +A+D ET+GL P+RDRLC+VQLS GDG   ++++A GQ
Sbjct: 1   MTN-HVYKGDLPDGLELG--PIVAIDCETMGLNPKRDRLCVVQLSSGDGHAHLVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    K+FH+GRFDIA +   FG    PV+CTKIASR+TRTYT++HGLK
Sbjct: 58  TAAPNLCRMLEDPNVLKLFHFGRFDIAAMKEAFGALTAPVYCTKIASRMTRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+ELL ++ISK QQSSDW A DL+  Q++YAASDV++LHALR +  E L R GR +LA
Sbjct: 118 NLLQELLCVDISKQQQSSDWGAADLTKAQVEYAASDVLYLHALRERLNEMLIREGRMELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            SC +FL  RAELDL GW + DIF+HS
Sbjct: 178 QSCFDFLPTRAELDLAGWPDSDIFAHS 204


>gi|56695010|ref|YP_165357.1| exonuclease, putative [Ruegeria pomeroyi DSS-3]
 gi|56676747|gb|AAV93413.1| exonuclease, putative [Ruegeria pomeroyi DSS-3]
          Length = 204

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 109/207 (52%), Positives = 144/207 (69%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ
Sbjct: 1   MAN-HLYKNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVIQMSGGDGNTHIVQVEKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML + +  K+FH+GRFDIA L++ FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  TAAPNLCAMLENPEVLKLFHFGRFDIAALYHAFGALTAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +ELLG++ISK QQ SDW A+ LS+ QL YAASDV++LH LR     +L R GR+DLA
Sbjct: 118 NLCQELLGVDISKQQQMSDWGAETLSEAQLDYAASDVLYLHRLREALDGRLAREGRADLA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            SC +FL  RA LDL+GW   DIF+HS
Sbjct: 178 QSCFDFLPTRARLDLVGWPETDIFAHS 204


>gi|254466427|ref|ZP_05079838.1| 3'-5' exonuclease [Rhodobacterales bacterium Y4I]
 gi|206687335|gb|EDZ47817.1| 3'-5' exonuclease [Rhodobacterales bacterium Y4I]
          Length = 204

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 108/207 (52%), Positives = 146/207 (70%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ
Sbjct: 1   MAN-HLYKNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVIQMSGGDGNAHIVQVEKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    K+FH+GRFDIA +++ FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  TEAPNLCRMLEDPNVLKLFHFGRFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +ELLGI+ISK QQ SDW A++L++ QL YAASDV+HLH LR    ++L R GRS++A
Sbjct: 118 NLTQELLGIDISKQQQMSDWGAEELTEAQLDYAASDVLHLHKLREALDKRLAREGRSEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW  +DIF+HS
Sbjct: 178 QACFDFLPMRAKLDLAGWPEIDIFAHS 204


>gi|90421943|ref|YP_530313.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB18]
 gi|90103957|gb|ABD85994.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB18]
          Length = 204

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 119/206 (57%), Positives = 154/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY D++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 1   MTIRLHRGDLPD--LSRYTDSVAIDTETMGLNPHRDRLCVVQLSNGDGSADVVQIPVGHS 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+ RFD+A L+   GV  +PV+CTKIASRLTRTYT++HGLKD
Sbjct: 59  DAPNLKKLLGDPAITKIFHFARFDLAALYNALGVMPQPVYCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++E+LG+++SK QQSSDW A  LSD QL YAASDV+HLH LR +    L R GR++LA 
Sbjct: 119 LVREVLGVDLSKQQQSSDWGAQSLSDAQLAYAASDVLHLHGLRTRLDAMLAREGRTELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL GW   DIF+HS
Sbjct: 179 ACFDFLPTRAKLDLSGWAEQDIFAHS 204


>gi|126738420|ref|ZP_01754125.1| exonuclease, putative [Roseobacter sp. SK209-2-6]
 gi|126720219|gb|EBA16925.1| exonuclease, putative [Roseobacter sp. SK209-2-6]
          Length = 204

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 109/207 (52%), Positives = 147/207 (71%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P +        +A+D ET+GL P RDRLC++Q+S GDG   II++A GQ
Sbjct: 1   MAN-HLYQNDLPDDLKLG--PVVAIDCETMGLNPHRDRLCVIQMSDGDGNAHIIQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D +  K+FH+GRFDIA ++  FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  SEAPNLCRLLEDPETLKLFHFGRFDIAAMYNAFGALSAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +ELLGI+ISK QQ SDW A+ L+D QL YAASDV+HLH LR    ++L+R GR+++A
Sbjct: 118 NLTQELLGIDISKQQQMSDWGAEILTDAQLDYAASDVLHLHKLRKALNKRLEREGRTEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW   DIF+HS
Sbjct: 178 QACFDFLPMRAKLDLAGWPETDIFAHS 204


>gi|294675670|ref|YP_003576285.1| ribonuclease D [Rhodobacter capsulatus SB 1003]
 gi|294474490|gb|ADE83878.1| ribonuclease D-1 [Rhodobacter capsulatus SB 1003]
          Length = 204

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 146/206 (70%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI +H+ D+P          +A+DTET+GL PRRDRLC+VQ+S GDG   +++IA GQ 
Sbjct: 1   MTIHLHQNDLPEGLDLG--PVVAIDTETMGLDPRRDRLCLVQMSSGDGHAHLVQIAKGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            AP L  ML D K EK+FH+ RFDIA L+  FGV   PVFCTKIAS++ RT+T++HGLK 
Sbjct: 59  EAPRLCAMLADPKVEKLFHFARFDIAALYNAFGVVTAPVFCTKIASKMVRTFTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L++L+G+++SK QQ+SDW A +L+  QL YAASDV++LH L+     +L R GR++LA 
Sbjct: 119 LLQDLVGVDVSKQQQTSDWGAAELTAAQLDYAASDVLYLHQLKAALVTRLAREGRTELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
           +C +FL  RA LDL+GWE   DIF H
Sbjct: 179 ACFDFLPARARLDLMGWEEPNDIFHH 204


>gi|260431736|ref|ZP_05785707.1| 3'-5' exonuclease [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415564|gb|EEX08823.1| 3'-5' exonuclease [Silicibacter lacuscaerulensis ITI-1157]
          Length = 204

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 106/207 (51%), Positives = 144/207 (69%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ
Sbjct: 1   MAN-HLYKNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVIQMSGGDGHSHIVQVEKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML + +  K+FH+GRFDIA L++ FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  TEAPNLCAMLENPEVLKLFHFGRFDIAALYHAFGALAAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +ELLGI+ISK QQ SDW A+ L++ QL YAASDV++LH LR     +L+R GR+++A
Sbjct: 118 NLCQELLGIDISKQQQMSDWGAETLTEAQLDYAASDVLYLHQLRAALDARLEREGRTEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LDL GW   DIF+HS
Sbjct: 178 QACFDFLPMRARLDLAGWPETDIFAHS 204


>gi|27375830|ref|NP_767359.1| hypothetical protein blr0719 [Bradyrhizobium japonicum USDA 110]
 gi|27348968|dbj|BAC45984.1| blr0719 [Bradyrhizobium japonicum USDA 110]
          Length = 204

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 117/206 (56%), Positives = 155/206 (75%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+R+H GD+P    +RY  A+A+DTET+GL P RDRLC+VQLSPGDG+ D+++I  G  
Sbjct: 1   MTVRLHRGDLPD--LSRYTGAVAIDTETMGLNPHRDRLCVVQLSPGDGSADVVQIPKGHT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L +    KIFH+ RFD+AVL+ +FGV   P++CTKIASRLTRTYT++HGLKD
Sbjct: 59  DAPNLKALLANPAITKIFHFARFDVAVLYQSFGVMTGPIYCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++E+L +++SK QQSSDW +D L++ QL YAASDV+HLHALR +    L R GR+ LA 
Sbjct: 119 LVREVLNVDLSKQQQSSDWGSDSLTEPQLAYAASDVLHLHALRERLDAMLVREGRTGLAK 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL GW   DIF+HS
Sbjct: 179 ACFDFLPTRALLDLQGWAEEDIFAHS 204


>gi|84500657|ref|ZP_00998906.1| exonuclease, putative [Oceanicola batsensis HTCC2597]
 gi|84391610|gb|EAQ03942.1| exonuclease, putative [Oceanicola batsensis HTCC2597]
          Length = 204

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 111/207 (53%), Positives = 149/207 (71%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   +++ D+P          +A+D ET+GL P RDRLC+VQ+S GDG   I+++A GQ
Sbjct: 1   MTN-HLYKQDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVVQMSGGDGDAHIVQVAIGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  ML D K  K+FH+GRFDIA ++  FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  DSAPNLCAMLTDPKVLKLFHFGRFDIAAMYNAFGALAAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +ELLGI++SK QQSSDW A++LS  QL+YAASDV++LH LR +   +L R GR+++A
Sbjct: 118 NLTQELLGIDLSKQQQSSDWGAEELSAAQLEYAASDVLYLHRLREELDARLAREGRTEIA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LDL+GW   DIF+HS
Sbjct: 178 QACFDFLPVRARLDLMGWPETDIFAHS 204


>gi|254470791|ref|ZP_05084194.1| 3'-5' exonuclease [Pseudovibrio sp. JE062]
 gi|211959933|gb|EEA95130.1| 3'-5' exonuclease [Pseudovibrio sp. JE062]
          Length = 206

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 112/206 (54%), Positives = 148/206 (71%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+ D+P        DA+AVDTETLGL P RDRLC+VQLS GDG+ D+++I  GQ 
Sbjct: 1   MTIRYHKNDLPDLSNYSSADAVAVDTETLGLNPHRDRLCVVQLSSGDGSADVVQIERGQL 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +  D  + KIFH+ RFD+A+L     + V PV+CTKIAS+L RTYT++HGLKD
Sbjct: 61  AAPNLQALFEDASKPKIFHFARFDVAILKEYLDISVSPVWCTKIASKLVRTYTDRHGLKD 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL+G+++SK QQSSDW+A+ L+D QL YAASDV+HLH L+ +    L+R  R+++A 
Sbjct: 121 ICRELIGVDLSKQQQSSDWAAEKLTDAQLAYAASDVLHLHKLKERLEFMLEREERTEIAQ 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
            C +FL  RA+LDL GW   DIF+HS
Sbjct: 181 KCFDFLPTRAQLDLAGWPETDIFAHS 206


>gi|126732863|ref|ZP_01748654.1| 3'-5' exonuclease [Sagittula stellata E-37]
 gi|126706639|gb|EBA05713.1| 3'-5' exonuclease [Sagittula stellata E-37]
          Length = 204

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 110/207 (53%), Positives = 146/207 (70%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M   ++H+GD+P          +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ
Sbjct: 1   MAN-QLHQGDLPDNLDLG--PVVAIDCETMGLHPHRDRLCVVQLSAGDGNAHLVQVARGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D    K+FHYGRFDIA ++  FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  TEAPNLSRLLTDPDVLKLFHYGRFDIAAMYNAFGALAAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +ELLG++ISK QQSSDW A+ L+D Q  YAASDV+HLH LR      L+R GR+++A
Sbjct: 118 NLTQELLGVDISKQQQSSDWGAETLTDAQKDYAASDVLHLHRLRTALNAMLEREGRTEIA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW + DIF+H+
Sbjct: 178 QACFDFLPARAKLDLAGWPDTDIFAHA 204


>gi|209883609|ref|YP_002287466.1| 3'-5' exonuclease [Oligotropha carboxidovorans OM5]
 gi|209871805|gb|ACI91601.1| 3'-5' exonuclease [Oligotropha carboxidovorans OM5]
          Length = 204

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 153/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY  ++A+DTETLGL P RDRLC+VQLS GDGT D+++I AG  
Sbjct: 1   MTIRLHRGDLPD--LSRYTHSVAIDTETLGLNPHRDRLCVVQLSNGDGTADVVQIPAGHT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    K+FH+ RFDIAVL + FGV  +P++CTKIAS+L RTYT++HGLKD
Sbjct: 59  DAPNLKKLLADPMVTKLFHFARFDIAVLEHAFGVMTQPIYCTKIASKLVRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG+ ISK QQSSDW A+ LS+ QL YAASDV+HLHALR +    L R  R DLA 
Sbjct: 119 LVRELLGVEISKQQQSSDWGAEKLSEAQLTYAASDVLHLHALREKLDTMLARENRMDLAK 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           SC  FL  RA LDL GW+  DIF+HS
Sbjct: 179 SCFEFLPTRARLDLQGWDETDIFAHS 204


>gi|254510165|ref|ZP_05122232.1| 3'-5' exonuclease [Rhodobacteraceae bacterium KLH11]
 gi|221533876|gb|EEE36864.1| 3'-5' exonuclease [Rhodobacteraceae bacterium KLH11]
          Length = 204

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 106/207 (51%), Positives = 144/207 (69%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC++Q+S GDG   I+++  GQ
Sbjct: 1   MAN-HLYKNDLPDGLDMG--PIVAIDCETMGLNPHRDRLCVIQMSGGDGDCHIVQVEKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  ML D    K+FH+GRFDIA +++ FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  ASAPNLCAMLEDPNILKLFHFGRFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +ELLG++ISK QQ SDW A+ L+D QL YAASDV++LH LR     +L R GR+++A
Sbjct: 118 NLCQELLGVDISKQQQMSDWGAETLTDAQLDYAASDVLYLHRLREALDGRLAREGRTEVA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW   DIF+HS
Sbjct: 178 QACFDFLPTRAKLDLAGWPETDIFAHS 204


>gi|148251746|ref|YP_001236331.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           BTAi1]
 gi|146403919|gb|ABQ32425.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           BTAi1]
          Length = 204

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 155/206 (75%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+R+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLSPGDG+ D+++I  G  
Sbjct: 1   MTVRLHRGDLPD--LSRYTSSVAIDTETMGLNPHRDRLCVVQLSPGDGSADVVQIPKGHT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L +    KIFH+ RFD+A LF+TFGV  +PV+CTKIASRL RTYT++HGLKD
Sbjct: 59  DAPNLKALLANPAITKIFHFARFDVATLFHTFGVMPQPVYCTKIASRLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELL +++SK QQSSDW AD+LS+ QL YAASDV+HLHALR +    L R GR  LA 
Sbjct: 119 LVRELLNVDLSKQQQSSDWGADNLSEPQLAYAASDVLHLHALREKLDVMLAREGRLGLAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL G+E  DIF+HS
Sbjct: 179 ACFAFLPHRATLDLGGFEAEDIFAHS 204


>gi|254476761|ref|ZP_05090147.1| 3'-5' exonuclease [Ruegeria sp. R11]
 gi|214031004|gb|EEB71839.1| 3'-5' exonuclease [Ruegeria sp. R11]
          Length = 204

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 108/207 (52%), Positives = 144/207 (69%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC++Q+S GDG   I+++A GQ
Sbjct: 1   MAN-HLYQNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVIQMSGGDGNAHIVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    K+FH+GRFDIA +++ FG    PV+CTKIASRL RTYT++HGLK
Sbjct: 58  TEAPNLCRMLEDPNVLKLFHFGRFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +EL+G++ISK QQ SDW A  LSD QL YAASDV+HLH LR    ++L R GR+++A
Sbjct: 118 NLTQELIGVDISKQQQMSDWGAAQLSDAQLDYAASDVLHLHRLRAALDKRLDREGRTEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW   DIF+HS
Sbjct: 178 QACFDFLPMRAKLDLAGWPETDIFAHS 204


>gi|299133324|ref|ZP_07026519.1| 3'-5' exonuclease [Afipia sp. 1NLS2]
 gi|298593461|gb|EFI53661.1| 3'-5' exonuclease [Afipia sp. 1NLS2]
          Length = 204

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 121/206 (58%), Positives = 152/206 (73%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY  ++A+DTETLGL P RDRLC+VQLS GDG+ D+++I AG  
Sbjct: 1   MTIRLHRGDLPD--LSRYTHSVAIDTETLGLNPHRDRLCVVQLSNGDGSADVVQIPAGHT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    K+FH+ RFDIAVL++ FGV  +PV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  DAPNLKKLLGDPAITKLFHFARFDIAVLYHAFGVMAQPVYCTKIASKLVRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++E+LG+ ISK QQSSDW A  LS+ QL YAASDV+HLHALR +    L R  R  LA 
Sbjct: 119 LVREMLGVEISKQQQSSDWGAASLSEAQLSYAASDVLHLHALRDKLDAMLAREDREPLAK 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL GWE  DIF+HS
Sbjct: 179 ACFEFLPTRARLDLQGWEETDIFAHS 204


>gi|296446798|ref|ZP_06888736.1| 3'-5' exonuclease [Methylosinus trichosporium OB3b]
 gi|296255673|gb|EFH02762.1| 3'-5' exonuclease [Methylosinus trichosporium OB3b]
          Length = 204

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 122/205 (59%), Positives = 149/205 (72%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H+GD+P          +A+DTETLGL P RDRLC+VQLS G+G  D++RIA GQ 
Sbjct: 1   MTIRLHQGDLPDGADLG--PVVAIDTETLGLNPHRDRLCLVQLSGGNGDADLVRIAPGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L +    K+FH+GRFDIAV+  TFGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  RAPNLEALLANPNVLKLFHFGRFDIAVMAKTFGVMAEPVYCTKIASKLIRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLG+ ISK QQSSDW AD LSD QL YAASDV++LHALR +    L R  R+DLA 
Sbjct: 119 LVRELLGVEISKQQQSSDWGADTLSDAQLSYAASDVLYLHALREKLDVMLAREHRTDLAA 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C  FL  RA LDL GW  +DIFSH
Sbjct: 179 ACFAFLPMRARLDLAGWPEIDIFSH 203


>gi|260428903|ref|ZP_05782880.1| 3'-5' exonuclease [Citreicella sp. SE45]
 gi|260419526|gb|EEX12779.1| 3'-5' exonuclease [Citreicella sp. SE45]
          Length = 204

 Score =  199 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 108/207 (52%), Positives = 144/207 (69%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M+   +++GD+P          +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ
Sbjct: 1   MSN-HLYKGDLPDGLDLG--PVVAIDCETMGLDPHRDRLCVVQLSGGDGNAHLVQVARGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L DE   K+FH+GRFDIA +++ FG    PV+CTKIASR+ RTYT++HGLK
Sbjct: 58  TEAPNLCRLLRDETVLKLFHFGRFDIAAMYHAFGALAAPVYCTKIASRMVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              +ELL ++ISK QQSSDW A DL+  QL YAASDV++LH LR +    L+R GR+ LA
Sbjct: 118 ALTQELLSVDISKQQQSSDWGAADLTAAQLDYAASDVLYLHQLRDRLNGMLEREGRTALA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LDL GW   DIF+H+
Sbjct: 178 QACFDFLPTRALLDLEGWPETDIFAHA 204


>gi|149912958|ref|ZP_01901492.1| exonuclease, putative [Roseobacter sp. AzwK-3b]
 gi|149813364|gb|EDM73190.1| exonuclease, putative [Roseobacter sp. AzwK-3b]
          Length = 203

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 103/206 (50%), Positives = 140/206 (67%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC+VQ+S GDG   +++I  GQ
Sbjct: 1   MANY-LYKNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVVQMSGGDGNAYLVQIDKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L +    K+FH+GRFDIA +F  FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TEAPNLAALLENPDILKLFHFGRFDIAAMFNAFGALAAPVYCTKIASKLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELL  +ISK QQSSDW A  L++ QL YAASDV++LH LR +    L R GR ++A
Sbjct: 118 NLMQELLDKDISKQQQSSDWGAPKLTEAQLDYAASDVLYLHQLRDELNRMLAREGRVEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW  +DIF+H
Sbjct: 178 QACFDFLPIRAKLDLAGWPEIDIFAH 203


>gi|13472866|ref|NP_104433.1| hypothetical protein mll3296 [Mesorhizobium loti MAFF303099]
 gi|14023613|dbj|BAB50219.1| mll3296 [Mesorhizobium loti MAFF303099]
          Length = 206

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 125/207 (60%), Positives = 157/207 (75%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+ D+P   +   V A+A+DTETLGL P RDRLC+VQ+SPGDG+ D+I+IA GQ
Sbjct: 1   MADIRFHKHDLPD-LSHYNVGAVAIDTETLGLNPHRDRLCLVQISPGDGSADVIQIAPGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L +    K+FH+GRFD+AVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 60  KKAPNLVSLLRNRSVTKLFHFGRFDLAVLYNAFGVMPEPVFCTKIASRLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D   ELLG+ +SKAQQSSDW+A+ LS EQL+YAASDV++LH LR     +L R GR+  A
Sbjct: 120 DICFELLGVGLSKAQQSSDWAAETLSPEQLEYAASDVLYLHRLRDVLAGRLAREGRTKEA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GW+  DIF+HS
Sbjct: 180 DACFRFLPTRAKLDLMGWDEEDIFAHS 206


>gi|146337290|ref|YP_001202338.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           ORS278]
 gi|146190096|emb|CAL74088.1| putative 3'-5' exonuclease family protein [Bradyrhizobium sp.
           ORS278]
          Length = 204

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 121/206 (58%), Positives = 154/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+R+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLSPGDG+ D+++I  G  
Sbjct: 1   MTVRLHRGDLPD--LSRYTSSVAIDTETMGLNPHRDRLCVVQLSPGDGSADVVQIPKGHT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L +    KIFH+ RFD+A LF+TFGV  +PV+CTKIASRL RTYT++HGLKD
Sbjct: 59  DAPNLKTLLGNTAITKIFHFARFDVATLFHTFGVMPQPVYCTKIASRLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELL I++SK QQSSDW AD LS+ QL YAASDV+HLHALR +    L R GR  LA 
Sbjct: 119 LVRELLNIDLSKQQQSSDWGADSLSEPQLAYAASDVLHLHALREKLDVMLAREGRLALAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL G+E  DIF+HS
Sbjct: 179 ACFAFLPHRATLDLGGFEADDIFAHS 204


>gi|89067364|ref|ZP_01154877.1| exonuclease, putative [Oceanicola granulosus HTCC2516]
 gi|89046933|gb|EAR52987.1| exonuclease, putative [Oceanicola granulosus HTCC2516]
          Length = 203

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 108/206 (52%), Positives = 145/206 (70%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC+VQ+S GDG   ++++A GQ
Sbjct: 1   MAN-HLYKNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVVQMSGGDGHAHLVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV ML +    K+FH+GRFDIA L   FG R  PV+CTKIAS+L RT+T++HGLK
Sbjct: 58  TSAPNLVAMLENPDVLKLFHFGRFDIAALMNAFGARTAPVYCTKIASKLVRTFTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L++L+G+++SK QQ SDW A+ LSD QL YAASDV+HLH LR +  E L R GR+ +A
Sbjct: 118 VLLQDLVGVDVSKHQQQSDWGAETLSDAQLDYAASDVLHLHRLREKLDEMLAREGRTMIA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW + DIFSH
Sbjct: 178 QACFDFLPTRAQLDLAGWPDQDIFSH 203


>gi|114797270|ref|YP_758935.1| putative exonuclease [Hyphomonas neptunium ATCC 15444]
 gi|114737444|gb|ABI75569.1| putative exonuclease [Hyphomonas neptunium ATCC 15444]
          Length = 204

 Score =  197 bits (502), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 101/207 (48%), Positives = 141/207 (68%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  I +H+GD+P   +      IAVDTE +GL   RD L +VQ+S GDGT  ++++    
Sbjct: 1   MNQITLHKGDLPEGLSLG--PVIAVDTEAMGLNAMRDNLTLVQVSSGDGTAHLVQLTRD- 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            + PNL  +L D K  KIFH+ RFD+ ++    G+   P++CTKIASRL RTYT++HGLK
Sbjct: 58  YDCPNLKALLTDPKVLKIFHFARFDVVMMKRWMGITCAPIWCTKIASRLARTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +E+ G+++SKAQQSSDW  D L+D Q+QYAASDV++LH ++      L+R GR +LA
Sbjct: 118 DVAREVAGVDMSKAQQSSDWGQDKLTDAQIQYAASDVLYLHQIKAGLEAMLEREGRLELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW + DIF+HS
Sbjct: 178 QACFDFLPIRADLDLAGWPDEDIFAHS 204


>gi|310817096|ref|YP_003965060.1| 3'-5' exonuclease [Ketogulonicigenium vulgare Y25]
 gi|308755831|gb|ADO43760.1| 3'-5' exonuclease [Ketogulonicigenium vulgare Y25]
          Length = 227

 Score =  197 bits (501), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 142/206 (68%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P +        IA+D ET+GL P RDRLC+VQ+S GDG   +I+I+ GQ
Sbjct: 25  MANF-LYQNDLPDDLDLG--PVIAIDCETMGLNPHRDRLCLVQISGGDGNAHMIQISPGQ 81

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           ++APNL  ML D    K+FHYGRFDIA +++ FG   +PV+CTKIAS++ RTYT +HGLK
Sbjct: 82  RSAPNLARMLEDANILKLFHYGRFDIAAMYHAFGALAQPVYCTKIASKMVRTYTERHGLK 141

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L++L+G++ISK QQ SDW A  L+  QL YAASDV++LH LR      L R GR+ LA
Sbjct: 142 FLLQDLIGVDISKHQQQSDWGAASLTPAQLDYAASDVLYLHRLRAHLDALLAREGRTGLA 201

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LDL GW+  DIF+H
Sbjct: 202 QACFDFLPTRARLDLEGWQENDIFAH 227


>gi|255262197|ref|ZP_05341539.1| 3'-5' exonuclease [Thalassiobium sp. R2A62]
 gi|255104532|gb|EET47206.1| 3'-5' exonuclease [Thalassiobium sp. R2A62]
          Length = 203

 Score =  197 bits (501), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 102/206 (49%), Positives = 142/206 (68%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC++Q+S GD    II+++ GQ
Sbjct: 1   MAN-HLYQNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVIQMSGGDSNAHIIQVSKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML +    K+FH+GRFDIA +   FG    PV+CTKIAS++ RTYT++HGLK
Sbjct: 58  TEAPNLTAMLTNPDVLKLFHFGRFDIAAMQNAFGAVTAPVYCTKIASKMVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+EL+G++ISK QQSSDW +  L++ QL YAASDV++LH LR +   +L R GR ++A
Sbjct: 118 NLLQELIGVDISKQQQSSDWGSQTLTNAQLDYAASDVLYLHKLRTELNARLVREGRMEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW  +DIFSH
Sbjct: 178 QACFDFLPMRAQLDLEGWPEIDIFSH 203


>gi|115522454|ref|YP_779365.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisA53]
 gi|115516401|gb|ABJ04385.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisA53]
          Length = 204

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 117/206 (56%), Positives = 152/206 (73%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY D++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 1   MTIRLHRGDLPD--LSRYTDSVAIDTETMGLNPHRDRLCVVQLSNGDGSADVVQIPLGHT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D    KIFH+ RFD++ L    GV  +P++CTKIASRL RTYT++HGLKD
Sbjct: 59  EAPNLKKLLGDPAVTKIFHFARFDLSALSNALGVMPQPIYCTKIASRLCRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++E+LGI++SK QQSSDW A +L+D QL YAASDV+HLHALR +    L R GR+ +A 
Sbjct: 119 LVREVLGIDLSKQQQSSDWGAQNLTDAQLAYAASDVLHLHALRARLDAMLAREGRTAMAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL GW N DIF+HS
Sbjct: 179 ACFDFLPTRAMLDLSGWNNEDIFAHS 204


>gi|319781433|ref|YP_004140909.1| 3'-5' exonuclease [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167321|gb|ADV10859.1| 3'-5' exonuclease [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 206

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 126/207 (60%), Positives = 157/207 (75%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+ D+P   +   V A+A+DTETLGL P RDRLC+VQ+SPGDG+ D+I+IA GQ
Sbjct: 1   MADIRFHKNDLPD-LSHYNVGAVAIDTETLGLNPHRDRLCVVQISPGDGSADVIQIAPGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L +    K+FHYGRFD+AVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 60  KKAPNLVSLLRNRGVTKLFHYGRFDLAVLYNAFGVMPEPVFCTKIASRLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D   ELLG+ +SKAQQSSDW+A+ LS EQL+YAASDV++LH LR     +L R GR+  A
Sbjct: 120 DICFELLGVGLSKAQQSSDWAAETLSPEQLEYAASDVLYLHRLRDVLAGRLARDGRTKEA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GW+  DIF+HS
Sbjct: 180 DACFRFLPTRAKLDLMGWDEEDIFAHS 206


>gi|254505241|ref|ZP_05117392.1| 3'-5' exonuclease, putative [Labrenzia alexandrii DFL-11]
 gi|222441312|gb|EEE47991.1| 3'-5' exonuclease, putative [Labrenzia alexandrii DFL-11]
          Length = 223

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 154/206 (74%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+GD+P   A     A+AVD+ETLGL P RDRLC+VQLSPGDG+ D+++IA GQ 
Sbjct: 18  MTIRYHKGDLPDLSAYETASAVAVDSETLGLNPHRDRLCVVQLSPGDGSADVVQIARGQT 77

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +  D  + KIFH+ RFD+AVL +  G+ V PV+CTKIAS+L RTYT++HGLKD
Sbjct: 78  EAPNLAALFTDAAKPKIFHFARFDVAVLRHYLGIHVTPVWCTKIASKLVRTYTDRHGLKD 137

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+ +SK QQSSDW+A+ LSD QL YAASDV+HLH L+ +    L+R  R+++A 
Sbjct: 138 ITRELLGVELSKQQQSSDWAAETLSDAQLAYAASDVLHLHDLKAKLEMMLEREERTNIAE 197

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RAELDL GWE  DIF+HS
Sbjct: 198 ACFSFLPVRAELDLKGWEENDIFAHS 223


>gi|91974656|ref|YP_567315.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB5]
 gi|91681112|gb|ABE37414.1| 3'-5' exonuclease [Rhodopseudomonas palustris BisB5]
          Length = 204

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 118/206 (57%), Positives = 152/206 (73%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY +++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 1   MTIRLHRGDLPD--LSRYTNSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGHS 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+ RFD+A L+  FGV  +PV+CTKIASRLTRTYT++HGLKD
Sbjct: 59  DAPNLKKLLGDPTVVKIFHFARFDLAALYNAFGVMPQPVYCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELL +++SK QQSSDW A+ LSD QL YAASDV+HLH LR +    L R  R+DLA 
Sbjct: 119 LVRELLNVDLSKQQQSSDWGAETLSDAQLAYAASDVLHLHGLREKLDAMLARENRTDLAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ LDL GW   DIF+HS
Sbjct: 179 ACFGFLPHRSRLDLDGWSEEDIFAHS 204


>gi|323136907|ref|ZP_08071987.1| 3'-5' exonuclease [Methylocystis sp. ATCC 49242]
 gi|322397668|gb|EFY00190.1| 3'-5' exonuclease [Methylocystis sp. ATCC 49242]
          Length = 204

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 117/205 (57%), Positives = 147/205 (71%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H+GD+PA  A      +A+DTETLGL  RRDRLC+VQLS GDG  ++++IA GQ 
Sbjct: 1   MTIRLHQGDLPAGVAV--APIVAIDTETLGLNHRRDRLCVVQLSIGDGDAELVQIAKGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            A NLV +LVD K  K+FH+ RFD+ +L  TFGV   PV+CTKIAS+LTRTYT++HGLKD
Sbjct: 59  QAENLVKLLVDPKVLKLFHFARFDMGILAKTFGVMPAPVYCTKIASKLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL G+ ISK QQSSDW A  L+D Q  YAASDV++LH L+ +    L R GR++LA 
Sbjct: 119 LARELAGVEISKQQQSSDWGAATLTDAQQAYAASDVLYLHQLKEKLDAMLAREGRTELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +FL  R  LDL GW   DIFSH
Sbjct: 179 ACFDFLPTRTRLDLAGWPESDIFSH 203


>gi|118589455|ref|ZP_01546861.1| 3'-5' exonuclease [Stappia aggregata IAM 12614]
 gi|118438155|gb|EAV44790.1| 3'-5' exonuclease [Stappia aggregata IAM 12614]
          Length = 206

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 121/206 (58%), Positives = 156/206 (75%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+GD+P   A    +A+AVD+ETLGL P RDRLC+VQLSPGDG+ D+++IA GQ 
Sbjct: 1   MTIRYHKGDLPDLKAYETANAVAVDSETLGLNPHRDRLCVVQLSPGDGSADVVQIARGQS 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  ++ D  + KIFH+ RFD+AVL +   +RV PV+CTKIAS+L RTYT++HGLKD
Sbjct: 61  EAPNLAALMTDTSKPKIFHFARFDVAVLQHYLNIRVSPVWCTKIASKLVRTYTDRHGLKD 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+ +SK QQSSDW+A+ LSD QL YAASDV+HLHAL+ +    L+R  R+ +A 
Sbjct: 121 ITRELLGVELSKQQQSSDWAAETLSDAQLAYAASDVLHLHALKERLEMMLEREERTHIAE 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RAELDL GWE  DIF+HS
Sbjct: 181 ACFDFLPTRAELDLKGWEENDIFAHS 206


>gi|114568663|ref|YP_755343.1| 3'-5' exonuclease [Maricaulis maris MCS10]
 gi|114339125|gb|ABI64405.1| 3'-5' exonuclease [Maricaulis maris MCS10]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 143/206 (69%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+  H+GD+PA+        +AVDTETLGL   RD LC+VQLS GDG   ++++     
Sbjct: 1   MTVHYHKGDLPADIDLG--PIVAVDTETLGLSLTRDMLCVVQLSAGDGDAHVVQMNRADY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  +L D   EKI H+ RFD+A++    GV + PVFCTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKRVLADPAVEKILHFARFDVAMVDKYLGVTMAPVFCTKIASKLVRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL+G  ++K QQSSDW AD+LS  QL YAASDV+HLH LR +    L+R GR+DLA 
Sbjct: 119 VTRELVGAEMNKQQQSSDWGADELSPAQLDYAASDVLHLHKLREKLGMMLEREGRTDLAK 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL GW  +DIF+HS
Sbjct: 179 ACFDFLPTRAKLDLAGWPEIDIFAHS 204


>gi|83855386|ref|ZP_00948916.1| exonuclease, putative [Sulfitobacter sp. NAS-14.1]
 gi|83941910|ref|ZP_00954372.1| exonuclease, putative [Sulfitobacter sp. EE-36]
 gi|83843229|gb|EAP82396.1| exonuclease, putative [Sulfitobacter sp. NAS-14.1]
 gi|83847730|gb|EAP85605.1| exonuclease, putative [Sulfitobacter sp. EE-36]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 111/207 (53%), Positives = 140/207 (67%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   V++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ
Sbjct: 1   MTN-TVYQNDLPDGLNLG--PMVAIDCETMGLHPHRDRLCVVQLSGGDGNAHLVQIAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D    K+FHYGRFDIA L  TFG +  PV+CTKIASRL RTYT++HGL 
Sbjct: 58  TEAPNLCALLEDPHVLKLFHYGRFDIAALLNTFGAKAAPVYCTKIASRLVRTYTDRHGLA 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              +ELL ++ISK QQSSDW A+ L+  Q+ YAASDV+HLH LR    + L R GR +LA
Sbjct: 118 KLCQELLSVDISKQQQSSDWGAETLTKAQIDYAASDVLHLHKLRDVLNQMLIREGRIELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL GW   DIF+H+
Sbjct: 178 QACFEFLPTRAQLDLDGWPETDIFAHA 204


>gi|150398650|ref|YP_001329117.1| 3'-5' exonuclease [Sinorhizobium medicae WSM419]
 gi|150030165|gb|ABR62282.1| 3'-5' exonuclease [Sinorhizobium medicae WSM419]
          Length = 208

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 149/206 (72%), Positives = 170/206 (82%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR HEGDI    AARY  AIA+DTETLGL+PRRDRLC+VQLS GDGT D+IRIAAGQK
Sbjct: 3   NTIRFHEGDISEADAARYRGAIAIDTETLGLVPRRDRLCVVQLSSGDGTADVIRIAAGQK 62

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV ML D  R+KIFH+GRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKD
Sbjct: 63  QAPNLVAMLSDPARQKIFHFGRFDIAVLFHTFGVTASPVFCTKIASRLARTYTDRHGLKD 122

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
           NLKELL ++ISK QQSSDW+AD LS  QL+YAASDV+HLHALR + T +L R GR +LA 
Sbjct: 123 NLKELLDVDISKQQQSSDWAADILSPAQLEYAASDVLHLHALRDKLTARLLRDGRMELAE 182

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDLLGWE  DIF+HS
Sbjct: 183 ACFSFLPTRAKLDLLGWEETDIFAHS 208


>gi|92115811|ref|YP_575540.1| 3'-5' exonuclease [Nitrobacter hamburgensis X14]
 gi|91798705|gb|ABE61080.1| 3'-5' exonuclease [Nitrobacter hamburgensis X14]
          Length = 206

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 150/206 (72%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P +   RY  + A+DTET+GL P RDRLC+VQ+SPGDG+ D+I+IA GQ+
Sbjct: 1   MTIRLHRGDLPDQDLKRYTHSAAIDTETMGLNPHRDRLCVVQMSPGDGSADVIQIAQGQR 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D    KIFH+ RFD+A L   FGV  +PV+CTKIASRL RTYT++HGLKD
Sbjct: 61  EAPNLKQLLADPTIVKIFHFARFDLAALSNAFGVMPQPVYCTKIASRLIRTYTDRHGLKD 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELL I +SK QQSSDW A  LSD QL YAASDV+HLHALR +    L R  R+ +A 
Sbjct: 121 LVRELLNIELSKQQQSSDWGAQTLSDAQLAYAASDVLHLHALRDKLDAMLARENRTGMAQ 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA+LDL GW   DIF+H+
Sbjct: 181 ACFEFLPTRAKLDLSGWGAEDIFAHA 206


>gi|114706944|ref|ZP_01439843.1| hypothetical protein FP2506_02794 [Fulvimarina pelagi HTCC2506]
 gi|114537494|gb|EAU40619.1| hypothetical protein FP2506_02794 [Fulvimarina pelagi HTCC2506]
          Length = 207

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 119/206 (57%), Positives = 149/206 (72%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIRVH+GD+P     RY   +A+DTETLGL   RDRLC+VQLSPGDGT D+++IA GQ 
Sbjct: 1   MTIRVHKGDLPD--LDRYTGPVAIDTETLGLNTMRDRLCVVQLSPGDGTADVVQIAKGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APN+  +L D  + KIFHY RFD+A L++ FG     +FCTKIASRLTRTYT++HGLKD
Sbjct: 59  EAPNISALLADASKTKIFHYARFDVAALYHAFGAMTEGIFCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL+G+++SK QQSSDW+ + LS  QL YAASDV++LH +     ++L+R  R DLA 
Sbjct: 119 LARELVGVDLSKQQQSSDWAVETLSPAQLDYAASDVLYLHDIMGALYKRLEREDRMDLAR 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
            C  FL  R  LDL GWEN DIFSHS
Sbjct: 179 ECFRFLPMRVRLDLAGWENEDIFSHS 204


>gi|190889732|ref|YP_001976274.1| ribonuclease III protein [Rhizobium etli CIAT 652]
 gi|190695011|gb|ACE89096.1| ribonuclease III protein [Rhizobium etli CIAT 652]
          Length = 208

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 147/205 (71%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL+RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLSRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISK QQSSDW A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDVDISKTQQSSDWGAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|217976351|ref|YP_002360498.1| 3'-5' exonuclease [Methylocella silvestris BL2]
 gi|217501727|gb|ACK49136.1| 3'-5' exonuclease [Methylocella silvestris BL2]
          Length = 204

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 121/205 (59%), Positives = 153/205 (74%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H+GD+P   A  +  A+A+DTET+GL+P RDRLC+VQLS GDG+ D+++IA  Q 
Sbjct: 1   MTIRLHKGDLPEGEA--FSGAVAIDTETMGLVPGRDRLCLVQLSRGDGSADLVQIAPAQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D   EK+FH+ RFDIAVL+ TFGV   P++CTKIAS+L RTYT++HGLKD
Sbjct: 59  AAPNLTRLLADPAVEKLFHFARFDIAVLYKTFGVMTGPIYCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLGI +SK QQSSDW  D LS+ QL YAASDV+HLHALR +    L+R GR  LA 
Sbjct: 119 LARELLGIELSKQQQSSDWGGDILSEAQLAYAASDVLHLHALRTKLDAMLEREGRRALAE 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +   FL  RA+LDL+GW + DIFSH
Sbjct: 179 ASFAFLPTRAKLDLMGWGDSDIFSH 203


>gi|86747785|ref|YP_484281.1| 3'-5' exonuclease [Rhodopseudomonas palustris HaA2]
 gi|86570813|gb|ABD05370.1| 3'-5' exonuclease [Rhodopseudomonas palustris HaA2]
          Length = 204

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 150/206 (72%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P     RY D++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 1   MTIRLHRGDLPD--LTRYNDSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGHS 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+ RFD+A L    GV  +PV+CTKIASRLTRTYT++HGLKD
Sbjct: 59  DAPNLKKLLGDPNILKIFHFARFDLAALSNALGVMPQPVYCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELL +++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L R  R++LA 
Sbjct: 119 LVRELLNVDLSKQQQSSDWGADTLSDAQLAYAASDVLHLHALRDKLDAMLARENRTELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL GW   DIF+HS
Sbjct: 179 ACFGFLPHRARLDLGGWSEEDIFAHS 204


>gi|23009303|ref|ZP_00050402.1| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 209

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 111/206 (53%), Positives = 146/206 (70%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P +   +   AIA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHRGDLPPDF--QPGSAIAIDTETLGLNPHRDRLCVVQISRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF   GV   PV+CTK+AS+L RTYT++HGLKD
Sbjct: 64  EPVRLKAILADPGVLKIFHFARFDLAVLFRALGVMPAPVYCTKVASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A+ LS  Q+ YAASDV+HLHA R +    L R GRS++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAETLSQAQIDYAASDVLHLHAARERLDLMLAREGRSEMAR 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL GW   DIF+HS
Sbjct: 184 ACFDFLPTRARLDLAGWPETDIFAHS 209


>gi|195970213|ref|NP_384368.2| hypothetical protein SMc00342 [Sinorhizobium meliloti 1021]
 gi|307306427|ref|ZP_07586171.1| 3'-5' exonuclease [Sinorhizobium meliloti BL225C]
 gi|307319314|ref|ZP_07598743.1| 3'-5' exonuclease [Sinorhizobium meliloti AK83]
 gi|187904130|emb|CAC41699.2| Probable ribonuclease D [Sinorhizobium meliloti 1021]
 gi|306895150|gb|EFN25907.1| 3'-5' exonuclease [Sinorhizobium meliloti AK83]
 gi|306902269|gb|EFN32866.1| 3'-5' exonuclease [Sinorhizobium meliloti BL225C]
          Length = 208

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 149/206 (72%), Positives = 170/206 (82%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR HEGDI    AARY  AIA+DTETLGL+PRRDRLC+VQLS GDGT D+IRI+AGQK
Sbjct: 3   NTIRFHEGDISETDAARYTGAIAIDTETLGLVPRRDRLCVVQLSSGDGTADVIRISAGQK 62

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV ML D  R+KIFH+GRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKD
Sbjct: 63  QAPNLVSMLADPTRQKIFHFGRFDIAVLFHTFGVTASPVFCTKIASRLARTYTDRHGLKD 122

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
           NLKELL I+ISK QQSSDW+AD LS  QL+YAASDV+HLHALR + T +L R GR +LA 
Sbjct: 123 NLKELLDIDISKQQQSSDWAADILSPAQLEYAASDVLHLHALRDKLTARLLRDGRMELAE 182

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDLLGWE  DIF+HS
Sbjct: 183 ACFSFLPTRAKLDLLGWEEADIFAHS 208


>gi|192288480|ref|YP_001989085.1| 3'-5' exonuclease [Rhodopseudomonas palustris TIE-1]
 gi|192282229|gb|ACE98609.1| 3'-5' exonuclease [Rhodopseudomonas palustris TIE-1]
          Length = 204

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 154/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY +++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 1   MTIRLHRGDLPD--LSRYTNSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGAT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+ RFD+A L+  FGV  +PV+CTKIASRLTRTYT++HGLKD
Sbjct: 59  DAPNLKKLLGDPAVVKIFHFARFDLAALYKAFGVMPQPVYCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLGI++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L R  R+DLA 
Sbjct: 119 LVRELLGIDLSKQQQSSDWGADSLSDAQLAYAASDVLHLHALRDKLDTMLARENRTDLAA 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL GW   DIF+HS
Sbjct: 179 ACFGFLPIRARLDLDGWSEEDIFAHS 204


>gi|154244026|ref|YP_001414984.1| 3'-5' exonuclease [Xanthobacter autotrophicus Py2]
 gi|154158111|gb|ABS65327.1| 3'-5' exonuclease [Xanthobacter autotrophicus Py2]
          Length = 206

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 150/208 (72%), Gaps = 4/208 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+PA+  A     +A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 1   MTIRLHRGDLPADFVA--APVVAIDTETMGLNPFRDRLCLVQLSNGDGSADLVQIPQGAD 58

Query: 62  N--APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
              APNL  +L D    K+FH+GRFDIAVL +TF V  +PV+CTKIASRL RTYT++HGL
Sbjct: 59  ATTAPNLTRLLADPAITKLFHFGRFDIAVLQHTFHVMPQPVWCTKIASRLVRTYTDRHGL 118

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           KD L+E + ++ISK QQSSDW A DLSD QL YAASDV+HLHA++ +  E L R  R+ L
Sbjct: 119 KDLLRETINVDISKQQQSSDWGAKDLSDAQLAYAASDVLHLHAVKAKLEEMLARENRTGL 178

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSHS 207
           A +C  FL  RA LDL GW   DIF+HS
Sbjct: 179 AAACFAFLPARAALDLSGWAEEDIFAHS 206


>gi|110677766|ref|YP_680773.1| 3'- 5' exonuclease family protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453882|gb|ABG30087.1| 3'- 5' exonuclease family protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 248

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 111/206 (53%), Positives = 144/206 (69%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T  V++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +I+IA GQ 
Sbjct: 45  MTHNVYKNDLPDGLDLG--PMVAIDCETMGLHPHRDRLCVVQLSGGDGKAHLIQIAKGQT 102

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D K  K+FH+GRFDIA +   FG    PV+CTKIASRL RTYT++HGL  
Sbjct: 103 EAPNLCKLLEDPKVLKLFHFGRFDIAAMLNAFGATAAPVYCTKIASRLVRTYTDRHGLAK 162

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L+ELL I+ISK QQSSDW A+ L+D Q++YAASDV++LH LR    + L+R GR + A 
Sbjct: 163 LLQELLAIDISKQQQSSDWGAETLTDAQIEYAASDVLYLHQLREALNKMLEREGRMETAQ 222

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL+GW + DIF+HS
Sbjct: 223 ACFDFLPMRAKLDLMGWPDTDIFAHS 248


>gi|254487503|ref|ZP_05100708.1| ribonuclease D [Roseobacter sp. GAI101]
 gi|214044372|gb|EEB85010.1| ribonuclease D [Roseobacter sp. GAI101]
          Length = 204

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 105/206 (50%), Positives = 138/206 (66%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   V++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +++I  GQ
Sbjct: 1   MTN-TVYQNDLPDGLDLG--PIVAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQIGKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D +  K+FH+GRFDIA +   FG +  PV+CTKIASRL RT+T++HGL 
Sbjct: 58  TEAPNLCALLEDPEVLKLFHFGRFDIAAMQNAFGAKTAPVYCTKIASRLVRTFTDRHGLA 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              +ELLG +ISK QQSSDW A  L+  Q+ YAASDV++LH LR +    L R  R D+A
Sbjct: 118 KLCQELLGTDISKQQQSSDWGAAQLTQAQIDYAASDVLYLHQLRDKLNAMLIREDRMDIA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW + DIF+H
Sbjct: 178 QACFDFLPMRAQLDLAGWPDTDIFAH 203


>gi|103487824|ref|YP_617385.1| 3'-5' exonuclease [Sphingopyxis alaskensis RB2256]
 gi|98977901|gb|ABF54052.1| 3'-5' exonuclease [Sphingopyxis alaskensis RB2256]
          Length = 205

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 107/207 (51%), Positives = 140/207 (67%), Gaps = 3/207 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ- 60
            ++  HE D+P +       A+AVDTET+GL P RDRLC+VQ+S G G   ++R   G  
Sbjct: 1   MSVYFHEEDLPEDVL--GPGAVAVDTETMGLNPLRDRLCLVQISDGSGDEHLVRFRPGSS 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +AP L  +L D +R K+FH+ RFDIA L    GV   PV+CTKIAS+L RTYT++HGLK
Sbjct: 59  YDAPVLKAILADPERLKLFHFARFDIAALQQALGVVTTPVYCTKIASKLVRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG  +SK QQSSDW A +LS+ Q  YAASDV  LHA++     +L R GR++LA
Sbjct: 119 ELVRELLGQEVSKQQQSSDWGAAELSEAQRDYAASDVRFLHAMKEILDARLAREGRTELA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LDL GW  VDIF+HS
Sbjct: 179 QACFDFLPTRAALDLAGWPEVDIFAHS 205


>gi|119385336|ref|YP_916392.1| 3'-5' exonuclease [Paracoccus denitrificans PD1222]
 gi|119375103|gb|ABL70696.1| 3'-5' exonuclease [Paracoccus denitrificans PD1222]
          Length = 204

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 114/206 (55%), Positives = 150/206 (72%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI ++  D+P +        +A+DTET+GL PRRDRLC+VQLS GDG   +++IA GQ+
Sbjct: 1   MTITLYRNDLPDDLDLG--PVVAIDTETMGLDPRRDRLCLVQLSSGDGNAHLVQIAKGQR 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  ML D K  K+FH+GRFDIA L   FGV  +PV+CTKIAS++ RTYT++HGLK 
Sbjct: 59  EAPNLARMLADPKVLKLFHFGRFDIAALEAAFGVVTKPVWCTKIASKMVRTYTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L EL+G++ISK QQ+SDW A +LS+ QL+YAASDV++LHAL+ +  ++L R GR  LA 
Sbjct: 119 LLSELVGVDISKQQQTSDWGAAELSEAQLEYAASDVLYLHALKAELEKRLAREGRLGLAQ 178

Query: 182 SCCNFLMDRAELDLLGWEN-VDIFSH 206
           +C +FL  RA LDLLGW +  DIF H
Sbjct: 179 ACFDFLPARAHLDLLGWGDENDIFHH 204


>gi|149201444|ref|ZP_01878419.1| exonuclease, putative [Roseovarius sp. TM1035]
 gi|149145777|gb|EDM33803.1| exonuclease, putative [Roseovarius sp. TM1035]
          Length = 203

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 107/206 (51%), Positives = 140/206 (67%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +++++ GQ
Sbjct: 1   MAN-HLYQNDLPDGLDLG--PVVAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQVSKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L +    K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TTAPNLARLLENPDVLKLFHFGRFDIAAMQNAFGALAAPVYCTKIASKLIRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L+ELL I+ISK QQSSDW AD LS  QL YAASDV++LH LR +   +L R GR +LA
Sbjct: 118 YLLQELLNIDISKQQQSSDWGADSLSAAQLDYAASDVLYLHRLRDELNARLIREGRMELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LDL GW  +DIF+H
Sbjct: 178 QACFDFLPQRALLDLAGWPEIDIFAH 203


>gi|85714031|ref|ZP_01045020.1| 3'-5' exonuclease [Nitrobacter sp. Nb-311A]
 gi|85699157|gb|EAQ37025.1| 3'-5' exonuclease [Nitrobacter sp. Nb-311A]
          Length = 206

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 152/206 (73%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P +  ARY  + A+DTET+GL P RDRLC+VQ+SPGDG+ D+I+IA GQ 
Sbjct: 1   MTIRLHRGDLPDQDLARYTGSAAIDTETMGLKPHRDRLCVVQMSPGDGSADVIQIARGQH 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+ RFD+A L   FGV  RPV+CTKIASRLTRTYT++HGLKD
Sbjct: 61  DAPNLKKLLGDPAIVKIFHFARFDLAALHNAFGVMPRPVYCTKIASRLTRTYTDRHGLKD 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++E L I++SK QQSSDW +  LSD QL YAASDV+HLHALR +    L R  R+ LA 
Sbjct: 121 LVREALSIDLSKQQQSSDWGSLALSDAQLAYAASDVLHLHALRDKLDAMLAREDRTGLAQ 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL GW+  DIF+HS
Sbjct: 181 ACFEFLPARAMLDLSGWDAEDIFAHS 206


>gi|316931442|ref|YP_004106424.1| 3'-5' exonuclease [Rhodopseudomonas palustris DX-1]
 gi|315599156|gb|ADU41691.1| 3'-5' exonuclease [Rhodopseudomonas palustris DX-1]
          Length = 211

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 154/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 8   MTIRLHRGDLPD--LSRYTHSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPLGAT 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+ RFD+A L+  FGV  +PV+CTKIASRLTRTYT++HGLKD
Sbjct: 66  DAPNLKKLLGDPAVVKIFHFARFDLAALYKAFGVMPQPVYCTKIASRLTRTYTDRHGLKD 125

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLGI++SK QQSSDW A+ LSD QL YAASDV+HLHALR +    L R GR+DLA 
Sbjct: 126 LVRELLGIDLSKQQQSSDWGAESLSDAQLAYAASDVLHLHALRDKLDTMLAREGRTDLAA 185

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL GW   DIF+HS
Sbjct: 186 ACFGFLPVRARLDLDGWSEEDIFAHS 211


>gi|163742520|ref|ZP_02149906.1| exonuclease, putative [Phaeobacter gallaeciensis 2.10]
 gi|161384105|gb|EDQ08488.1| exonuclease, putative [Phaeobacter gallaeciensis 2.10]
          Length = 226

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 108/203 (53%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 5   RVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
            +++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ  AP
Sbjct: 26  HLYQNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVVQLSGGDGNAHMVQIAKGQSEAP 83

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
           NL  ML D    K+FH+GRFDIA +++ FG    PV+CTKIASRL RTYT++HGL++  +
Sbjct: 84  NLCAMLEDLNVLKLFHFGRFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLRNLTQ 143

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           EL+G++ISK QQ SDW A  LSD QL YAASDV+HLH LR    ++L R  RS++A +C 
Sbjct: 144 ELIGVDISKQQQMSDWGAAQLSDAQLDYAASDVLHLHRLRAALDKRLDREDRSEMAQACF 203

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
           +FL  RA+LDL GW + DIF+HS
Sbjct: 204 DFLPMRAKLDLAGWSDTDIFAHS 226


>gi|17988111|ref|NP_540745.1| ribonuclease D [Brucella melitensis bv. 1 str. 16M]
 gi|62289101|ref|YP_220894.1| 3-5 exonuclease family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699039|ref|YP_413613.1| 3'-5' exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|148559185|ref|YP_001258158.1| 3'-5' exonuclease family protein [Brucella ovis ATCC 25840]
 gi|189023376|ref|YP_001934144.1| 3'-5' exonuclease [Brucella abortus S19]
 gi|225626663|ref|ZP_03784702.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|225851660|ref|YP_002731893.1| hypothetical protein BMEA_A0127 [Brucella melitensis ATCC 23457]
 gi|237814593|ref|ZP_04593591.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|254690430|ref|ZP_05153684.1| hypothetical protein Babob68_09714 [Brucella abortus bv. 6 str.
           870]
 gi|254694918|ref|ZP_05156746.1| hypothetical protein Babob3T_09702 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696124|ref|ZP_05157952.1| hypothetical protein Babob28_00020 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700933|ref|ZP_05162761.1| hypothetical protein Bsuib55_08749 [Brucella suis bv. 5 str. 513]
 gi|254707182|ref|ZP_05169010.1| hypothetical protein BpinM_09468 [Brucella pinnipedialis
           M163/99/10]
 gi|254709273|ref|ZP_05171084.1| hypothetical protein BpinB_03206 [Brucella pinnipedialis B2/94]
 gi|254713304|ref|ZP_05175115.1| hypothetical protein BcetM6_08117 [Brucella ceti M644/93/1]
 gi|254716342|ref|ZP_05178153.1| hypothetical protein BcetM_07890 [Brucella ceti M13/05/1]
 gi|254731461|ref|ZP_05190039.1| hypothetical protein Babob42_09744 [Brucella abortus bv. 4 str.
           292]
 gi|256030796|ref|ZP_05444410.1| hypothetical protein BpinM2_09123 [Brucella pinnipedialis
           M292/94/1]
 gi|256045912|ref|ZP_05448786.1| hypothetical protein Bmelb1R_15494 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060264|ref|ZP_05450439.1| hypothetical protein Bneo5_07870 [Brucella neotomae 5K33]
 gi|256112626|ref|ZP_05453547.1| hypothetical protein Bmelb3E_08085 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158817|ref|ZP_05456678.1| hypothetical protein BcetM4_08038 [Brucella ceti M490/95/1]
 gi|256254202|ref|ZP_05459738.1| hypothetical protein BcetB_07895 [Brucella ceti B1/94]
 gi|256258682|ref|ZP_05464218.1| hypothetical protein Babob9C_15316 [Brucella abortus bv. 9 str.
           C68]
 gi|256264829|ref|ZP_05467361.1| 3'-5' exonuclease [Brucella melitensis bv. 2 str. 63/9]
 gi|256368584|ref|YP_003106090.1| 3'-5' exonuclease family protein [Brucella microti CCM 4915]
 gi|260169700|ref|ZP_05756511.1| 3'-5' exonuclease family protein [Brucella sp. F5/99]
 gi|260546398|ref|ZP_05822138.1| 3'-5' exonuclease [Brucella abortus NCTC 8038]
 gi|260563197|ref|ZP_05833683.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. 16M]
 gi|260755977|ref|ZP_05868325.1| 3'-5' exonuclease [Brucella abortus bv. 6 str. 870]
 gi|260759201|ref|ZP_05871549.1| 3'-5' exonuclease [Brucella abortus bv. 4 str. 292]
 gi|260760489|ref|ZP_05872835.1| 3'-5' exonuclease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884998|ref|ZP_05896612.1| 3'-5' exonuclease [Brucella abortus bv. 9 str. C68]
 gi|261215252|ref|ZP_05929533.1| 3'-5' exonuclease [Brucella abortus bv. 3 str. Tulya]
 gi|261218123|ref|ZP_05932404.1| 3'-5' exonuclease [Brucella ceti M13/05/1]
 gi|261221350|ref|ZP_05935631.1| 3'-5' exonuclease [Brucella ceti B1/94]
 gi|261314663|ref|ZP_05953860.1| 3'-5' exonuclease [Brucella pinnipedialis M163/99/10]
 gi|261316779|ref|ZP_05955976.1| 3'-5' exonuclease [Brucella pinnipedialis B2/94]
 gi|261321030|ref|ZP_05960227.1| 3'-5' exonuclease [Brucella ceti M644/93/1]
 gi|261324237|ref|ZP_05963434.1| 3'-5' exonuclease [Brucella neotomae 5K33]
 gi|261751448|ref|ZP_05995157.1| 3'-5' exonuclease [Brucella suis bv. 5 str. 513]
 gi|261759236|ref|ZP_06002945.1| 3'-5' exonuclease [Brucella sp. F5/99]
 gi|265987850|ref|ZP_06100407.1| 3'-5' exonuclease [Brucella pinnipedialis M292/94/1]
 gi|265992324|ref|ZP_06104881.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994066|ref|ZP_06106623.1| 3'-5' exonuclease [Brucella melitensis bv. 3 str. Ether]
 gi|265997310|ref|ZP_06109867.1| 3'-5' exonuclease [Brucella ceti M490/95/1]
 gi|294851524|ref|ZP_06792197.1| ribonuclease D [Brucella sp. NVSL 07-0026]
 gi|297247517|ref|ZP_06931235.1| 3'-5' exonuclease [Brucella abortus bv. 5 str. B3196]
 gi|306842591|ref|ZP_07475240.1| 3'-5' exonuclease [Brucella sp. BO2]
 gi|17983864|gb|AAL53009.1| ribonuclease d [Brucella melitensis bv. 1 str. 16M]
 gi|62195233|gb|AAX73533.1| 3-5 exonuclease family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615140|emb|CAJ10073.1| 3'-5' exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|148370442|gb|ABQ60421.1| 3'-5' exonuclease family protein [Brucella ovis ATCC 25840]
 gi|189018948|gb|ACD71670.1| 3'-5' exonuclease [Brucella abortus S19]
 gi|225618320|gb|EEH15363.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|225640025|gb|ACN99938.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237789430|gb|EEP63640.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|255998742|gb|ACU47141.1| 3'-5' exonuclease family protein [Brucella microti CCM 4915]
 gi|260096505|gb|EEW80381.1| 3'-5' exonuclease [Brucella abortus NCTC 8038]
 gi|260153213|gb|EEW88305.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. 16M]
 gi|260669519|gb|EEX56459.1| 3'-5' exonuclease [Brucella abortus bv. 4 str. 292]
 gi|260670924|gb|EEX57745.1| 3'-5' exonuclease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676085|gb|EEX62906.1| 3'-5' exonuclease [Brucella abortus bv. 6 str. 870]
 gi|260874526|gb|EEX81595.1| 3'-5' exonuclease [Brucella abortus bv. 9 str. C68]
 gi|260916859|gb|EEX83720.1| 3'-5' exonuclease [Brucella abortus bv. 3 str. Tulya]
 gi|260919934|gb|EEX86587.1| 3'-5' exonuclease [Brucella ceti B1/94]
 gi|260923212|gb|EEX89780.1| 3'-5' exonuclease [Brucella ceti M13/05/1]
 gi|261293720|gb|EEX97216.1| 3'-5' exonuclease [Brucella ceti M644/93/1]
 gi|261296002|gb|EEX99498.1| 3'-5' exonuclease [Brucella pinnipedialis B2/94]
 gi|261300217|gb|EEY03714.1| 3'-5' exonuclease [Brucella neotomae 5K33]
 gi|261303689|gb|EEY07186.1| 3'-5' exonuclease [Brucella pinnipedialis M163/99/10]
 gi|261739220|gb|EEY27216.1| 3'-5' exonuclease [Brucella sp. F5/99]
 gi|261741201|gb|EEY29127.1| 3'-5' exonuclease [Brucella suis bv. 5 str. 513]
 gi|262551778|gb|EEZ07768.1| 3'-5' exonuclease [Brucella ceti M490/95/1]
 gi|262765047|gb|EEZ10968.1| 3'-5' exonuclease [Brucella melitensis bv. 3 str. Ether]
 gi|263003390|gb|EEZ15683.1| 3'-5' exonuclease [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095285|gb|EEZ18912.1| 3'-5' exonuclease [Brucella melitensis bv. 2 str. 63/9]
 gi|264660047|gb|EEZ30308.1| 3'-5' exonuclease [Brucella pinnipedialis M292/94/1]
 gi|294820113|gb|EFG37112.1| ribonuclease D [Brucella sp. NVSL 07-0026]
 gi|297174686|gb|EFH34033.1| 3'-5' exonuclease [Brucella abortus bv. 5 str. B3196]
 gi|306287236|gb|EFM58724.1| 3'-5' exonuclease [Brucella sp. BO2]
 gi|326408140|gb|ADZ65205.1| 3'-5' exonuclease [Brucella melitensis M28]
 gi|326537851|gb|ADZ86066.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 205

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 155/206 (75%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK
Sbjct: 1   MTIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQK 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 60  KAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A 
Sbjct: 120 ICSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ELDL+GW   DIF+HS
Sbjct: 180 ACFKFLPTRSELDLMGWAESDIFAHS 205


>gi|126463573|ref|YP_001044687.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17029]
 gi|126105237|gb|ABN77915.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17029]
          Length = 204

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 111/206 (53%), Positives = 146/206 (70%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI +H  D+P   A      +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ 
Sbjct: 1   MTIHLHRNDLPDGLALG--PVVAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK 
Sbjct: 59  SAPNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA 
Sbjct: 119 LLLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
            C +FL  RAELDL+GW+   DIF H
Sbjct: 179 RCFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|89052719|ref|YP_508170.1| 3'-5' exonuclease [Jannaschia sp. CCS1]
 gi|88862268|gb|ABD53145.1| 3'-5' exonuclease [Jannaschia sp. CCS1]
          Length = 203

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 107/206 (51%), Positives = 148/206 (71%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   +++ D+P +        +A+D ET+GL P RDRLC++QLS GDG   ++++A GQ
Sbjct: 1   MTN-TLYQTDLPDDLELG--PIVAIDCETMGLHPHRDRLCVIQLSDGDGNAHLVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D    K+FH+GRFDIA +++ FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TAAPNLCALLEDPNTLKLFHFGRFDIAAMYHAFGALTAPVYCTKIASKLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+ELLGI+ISK QQSSDW AD L++ Q+ YAASDV++LH ++ +    L R GR++LA
Sbjct: 118 NLLQELLGIDISKQQQSSDWGADSLTEAQVDYAASDVLYLHGVKDKLDVMLAREGRTELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW  +DIFSH
Sbjct: 178 QACFDFLPMRAKLDLAGWPEMDIFSH 203


>gi|163745220|ref|ZP_02152580.1| 3'- 5' exonuclease family protein, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161382038|gb|EDQ06447.1| 3'- 5' exonuclease family protein, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 204

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 106/207 (51%), Positives = 142/207 (68%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   +++ D+P +        +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ
Sbjct: 1   MTNF-LYQNDLPDDLDLG--PMVAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQIAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L +    K+FHYGRFDIA +   FG    PV+CTKIASRL RTYT++HGL 
Sbjct: 58  TEAPNLCALLENPHVLKLFHYGRFDIAAMLNAFGATAAPVYCTKIASRLIRTYTDRHGLA 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              +ELL ++ISK QQSSDW A +L+  Q+ YAASDV++LH LR +  ++L R GR D+A
Sbjct: 118 KLCQELLSVDISKQQQSSDWGAKELTQAQIDYAASDVLYLHRLRDELNKRLIREGRMDMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LDL GW + DIF+H+
Sbjct: 178 QACFDFLPMRARLDLEGWPDTDIFAHA 204


>gi|306844394|ref|ZP_07476984.1| 3'-5' exonuclease [Brucella sp. BO1]
 gi|306275207|gb|EFM56957.1| 3'-5' exonuclease [Brucella sp. BO1]
          Length = 205

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 155/206 (75%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK
Sbjct: 1   MTIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIDAGQK 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 60  KAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A 
Sbjct: 120 ICSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ELDL+GW   DIF+HS
Sbjct: 180 ACFKFLPTRSELDLMGWAESDIFAHS 205


>gi|39933126|ref|NP_945402.1| 3'-5' exonuclease [Rhodopseudomonas palustris CGA009]
 gi|39652751|emb|CAE25490.1| 3'-5' exonuclease [Rhodopseudomonas palustris CGA009]
          Length = 204

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 124/206 (60%), Positives = 154/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P    +RY  ++A+DTET+GL P RDRLC+VQLS GDG+ D+++I  G  
Sbjct: 1   MTIRLHRGDLPD--LSRYTHSVAIDTETMGLHPHRDRLCVVQLSNGDGSADVVQIPQGAT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+ RFD+A L+ TFGV  +PV+CTKIASRLTRTYT++HGLKD
Sbjct: 59  DAPNLKKLLGDPAVVKIFHFARFDLAALYKTFGVMPQPVYCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELLGI++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L R  R+DLA 
Sbjct: 119 LVRELLGIDLSKQQQSSDWGADSLSDAQLAYAASDVLHLHALRDRLDTMLARENRTDLAA 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL GW   DIF+HS
Sbjct: 179 ACFGFLPVRARLDLDGWSEEDIFAHS 204


>gi|154250652|ref|YP_001411476.1| 3'-5' exonuclease [Parvibaculum lavamentivorans DS-1]
 gi|154154602|gb|ABS61819.1| 3'-5' exonuclease [Parvibaculum lavamentivorans DS-1]
          Length = 203

 Score =  194 bits (492), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 105/205 (51%), Positives = 139/205 (67%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             + +H GD+P      + +++AVDTET+GL P RD+LC+VQLS GDG   I+++  G  
Sbjct: 1   MAVTLHRGDLPEG--LSFGESVAVDTETMGLHPERDQLCVVQLSAGDGNAHIVQLDRGTY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           NAP L  ++ D    KIFH+ RFD+A+L    GV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  NAPRLRALMADPAILKIFHFARFDVAMLQRYLGVVTAPVYCTKIASKLVRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL+ I++SK QQSSDW A  L+D QL YAASDV+HLH ++      L R GR++LA 
Sbjct: 119 LARELVNIDMSKQQQSSDWGAASLTDAQLSYAASDVLHLHEIKSVLDGMLAREGRTELAR 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C  FL  RA LDL GW   DIF+H
Sbjct: 179 ACFAFLPVRAALDLAGWPEEDIFAH 203


>gi|114764076|ref|ZP_01443315.1| exonuclease, putative [Pelagibaca bermudensis HTCC2601]
 gi|114543434|gb|EAU46449.1| exonuclease, putative [Roseovarius sp. HTCC2601]
          Length = 204

 Score =  194 bits (492), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 111/207 (53%), Positives = 140/207 (67%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++GD+P          +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ
Sbjct: 1   MAN-HLYKGDLPDGLDLG--PVVAIDCETMGLEPHRDRLCVVQLSGGDGNAHLVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L DE   K+FHYGRFDIA ++  FG    PV+CTKIASR+ RTYT++HGLK
Sbjct: 58  TEAPNLCRLLRDECVLKLFHYGRFDIAAMYNAFGALAAPVYCTKIASRMVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              +ELL ++ISK QQSSDW A+ L++ Q  YAASDV+HLH LR      L R GRS LA
Sbjct: 118 TLTQELLSVDISKQQQSSDWGAETLTEAQRDYAASDVLHLHKLREALDGMLAREGRSALA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            SC +FL  RA LDL GW   DIF+HS
Sbjct: 178 QSCFDFLPTRALLDLEGWPGTDIFAHS 204


>gi|153007480|ref|YP_001368695.1| 3'-5' exonuclease [Ochrobactrum anthropi ATCC 49188]
 gi|151559368|gb|ABS12866.1| 3'-5' exonuclease [Ochrobactrum anthropi ATCC 49188]
          Length = 205

 Score =  194 bits (492), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 155/206 (75%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+ D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK
Sbjct: 1   MTIRFHKNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQK 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+GRFD+AVL   FG   +PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 60  KAPNLVKLLKDRSITKIFHFGRFDLAVLAQAFGTMPQPVFCTKIASKLTRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A 
Sbjct: 120 LCNELLDVSISKQQQSSDWAAETLSAAQLEYAASDVLYLHRLKAVLEQRLERDGRAKQAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ELDL+GW   DIF+HS
Sbjct: 180 ACFKFLPTRSELDLMGWPEDDIFAHS 205


>gi|15890866|ref|NP_356538.1| ribonuclease D [Agrobacterium tumefaciens str. C58]
 gi|15159163|gb|AAK89323.1| ribonuclease D [Agrobacterium tumefaciens str. C58]
          Length = 208

 Score =  194 bits (492), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 148/205 (72%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI AE AARY  AIA+DTETLGL+PRRDRLC+VQLS GDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAEDAARYKGAIAIDTETLGLVPRRDRLCVVQLSSGDGTADVIRIAAGQKQ 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV ML D  R+KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVHMLADPARQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLCRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR + A +
Sbjct: 124 LKEMLEVDISKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRIEHADA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGW+  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWDETDIFAHS 208


>gi|90420956|ref|ZP_01228860.1| 3'-5' exonuclease [Aurantimonas manganoxydans SI85-9A1]
 gi|90334734|gb|EAS48510.1| 3'-5' exonuclease [Aurantimonas manganoxydans SI85-9A1]
          Length = 205

 Score =  194 bits (492), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 119/206 (57%), Positives = 157/206 (76%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIRVH+GD+P    +RY   +A+DTETLGL  RRDRLC+VQLSPGDGT D+++IA GQ 
Sbjct: 1   MTIRVHKGDLPD--ISRYTGPVAIDTETLGLDTRRDRLCVVQLSPGDGTADVVQIAKGQS 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APN+  +L D  + KIFHY RFD+A L++ FGV    +FCTKIASRLTRTYT++HGLKD
Sbjct: 59  EAPNITALLKDPAKTKIFHYARFDVAALYHAFGVMTDGIFCTKIASRLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +E++G++ISK QQSSDW+A+ LS  Q++YAASDV++LH +     ++L+R  R +LA 
Sbjct: 119 LAREMVGVDISKQQQSSDWAAETLSQAQVEYAASDVLYLHDIMGGLYKRLEREDRMELAK 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA+LDL GW++ DIFSHS
Sbjct: 179 ACFTFLPTRAKLDLAGWDDEDIFSHS 204


>gi|218661189|ref|ZP_03517119.1| ribonuclease III protein [Rhizobium etli IE4771]
          Length = 208

 Score =  194 bits (492), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 148/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L I+ISK QQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDIDISKTQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|188581677|ref|YP_001925122.1| 3'-5' exonuclease [Methylobacterium populi BJ001]
 gi|179345175|gb|ACB80587.1| 3'-5' exonuclease [Methylobacterium populi BJ001]
          Length = 209

 Score =  194 bits (492), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A      IA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHRGDLPLDFAPGAA--IAIDTETLGLNPHRDRLCVVQISRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D +  KIFH+ RFD+AVLF  FGV   PV+CTK+AS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADPQIVKIFHFARFDLAVLFKAFGVMPMPVYCTKVASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A+ LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAEALSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRAKLDLAGWPEMDIFAHT 209


>gi|126734481|ref|ZP_01750228.1| exonuclease, putative [Roseobacter sp. CCS2]
 gi|126717347|gb|EBA14211.1| exonuclease, putative [Roseobacter sp. CCS2]
          Length = 203

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 142/206 (68%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC++Q+S GDG   ++++  GQ
Sbjct: 1   MAN-HLYQNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCLIQMSGGDGDCHLVQVTPGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML +    K+FH+GRFDIA L   FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TAAPNLCAMLENPDVLKLFHFGRFDIAALLNAFGALTAPVYCTKIASKLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L++++GI+ISK QQ SDW A +L+D QL YAASDV++LH L+ +F   L R  R+D+A
Sbjct: 118 TLLQDMVGIDISKHQQQSDWGAPNLTDAQLDYAASDVLYLHQLKEKFDVLLAREHRADVA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            SC +FL  RA+LDL GW ++DIFSH
Sbjct: 178 QSCFDFLPTRAKLDLAGWPDIDIFSH 203


>gi|77464733|ref|YP_354237.1| ribonuclease D [Rhodobacter sphaeroides 2.4.1]
 gi|77389151|gb|ABA80336.1| Ribonuclease D [Rhodobacter sphaeroides 2.4.1]
          Length = 204

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 145/206 (70%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI +H  D+P          +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ 
Sbjct: 1   MTIHLHRNDLPDGLVLG--PVVAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK 
Sbjct: 59  SAPNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA 
Sbjct: 119 LLLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
            C +FL  RAELDL+GW+   DIF H
Sbjct: 179 RCFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|116249870|ref|YP_765708.1| ribonuclease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254518|emb|CAK05592.1| putative ribonuclease [Rhizobium leguminosarum bv. viciae 3841]
          Length = 208

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 148/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A   ARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIAAGQK 
Sbjct: 4   TIRYHEGDISAADVARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADIIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TF V   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFSVTTTPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + TE+L R GR D AT+
Sbjct: 124 LKEMLDVDVSKAQQSSDWAAERLSPAQLEYAASDVLYLHALRDKLTERLIRDGRYDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|222147114|ref|YP_002548071.1| ribonuclease D [Agrobacterium vitis S4]
 gi|221734104|gb|ACM35067.1| ribonuclease D [Agrobacterium vitis S4]
          Length = 208

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 147/206 (71%), Positives = 173/206 (83%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           +TIR HEGDI +E AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIA GQ+
Sbjct: 3   STIRYHEGDISSEDAARYTRAIAIDTETLGLIPRRDRLCVVQLSPGDGTADVIRIAPGQR 62

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  REKIFHYGRFDIAVLF+TFGV   PVFCTKIASRL+RTYT++HGLKD
Sbjct: 63  QAPNLTALLEDPTREKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLSRTYTDRHGLKD 122

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
           NLKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT
Sbjct: 123 NLKEMLDVDVSKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLVRDGRMDHAT 182

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 183 ACFEFLPTRAKLDLLGWEETDIFAHS 208


>gi|254561638|ref|YP_003068733.1| 3'-5' exonuclease [Methylobacterium extorquens DM4]
 gi|254268916|emb|CAX24877.1| 3'-5' exonuclease [Methylobacterium extorquens DM4]
          Length = 209

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 147/206 (71%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A      IA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHHGDLPPDFAPGAA--IAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAGTLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|240139043|ref|YP_002963518.1| 3'-5' exonuclease [Methylobacterium extorquens AM1]
 gi|240009015|gb|ACS40241.1| 3'-5' exonuclease [Methylobacterium extorquens AM1]
          Length = 209

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 147/206 (71%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A      IA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHHGDLPPDFAPGAA--IAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAGTLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|239830972|ref|ZP_04679301.1| 3'-5' exonuclease [Ochrobactrum intermedium LMG 3301]
 gi|239823239|gb|EEQ94807.1| 3'-5' exonuclease [Ochrobactrum intermedium LMG 3301]
          Length = 205

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 124/206 (60%), Positives = 157/206 (76%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+ D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK
Sbjct: 1   MTIRFHKNDLP-NLDHYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQK 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+GRFD+AVL +TFG   +PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 60  KAPNLVKLLKDRSITKIFHFGRFDLAVLAHTFGTMPQPVFCTKIASKLTRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A 
Sbjct: 120 LCNELLDVSISKQQQSSDWAAETLSAAQLEYAASDVLYLHRLKAVLEQRLERDGRAKQAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ELDL+GW   DIF+HS
Sbjct: 180 ACFKFLPTRSELDLMGWPEDDIFAHS 205


>gi|163842395|ref|YP_001626799.1| hypothetical protein BSUIS_A0125 [Brucella suis ATCC 23445]
 gi|163673118|gb|ABY37229.1| Hypothetical protein BSUIS_A0125 [Brucella suis ATCC 23445]
          Length = 205

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 122/206 (59%), Positives = 154/206 (74%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H  D+P       V A+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK
Sbjct: 1   MTIRFHRNDLP-NLDNYQVAAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEAGQK 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 60  KAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A 
Sbjct: 120 ICSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ELDL+GW   DIF+HS
Sbjct: 180 ACFKFLPTRSELDLMGWAESDIFAHS 205


>gi|86355756|ref|YP_467648.1| RNAse D protein [Rhizobium etli CFN 42]
 gi|86279858|gb|ABC88921.1| RNAse D protein [Rhizobium etli CFN 42]
          Length = 208

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 149/205 (72%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADIIRIAAGQKA 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTNPVFCTKIASRLCRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDVDVSKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|23501034|ref|NP_697161.1| 3'-5' exonuclease family protein [Brucella suis 1330]
 gi|161618108|ref|YP_001591995.1| hypothetical protein BCAN_A0123 [Brucella canis ATCC 23365]
 gi|254705301|ref|ZP_05167129.1| hypothetical protein Bsuib36_15553 [Brucella suis bv. 3 str. 686]
 gi|260567236|ref|ZP_05837706.1| 3'-5' exonuclease [Brucella suis bv. 4 str. 40]
 gi|261756011|ref|ZP_05999720.1| 3'-5' exonuclease [Brucella suis bv. 3 str. 686]
 gi|23346898|gb|AAN29076.1| 3'-5' exonuclease family protein [Brucella suis 1330]
 gi|161334919|gb|ABX61224.1| Hypothetical protein BCAN_A0123 [Brucella canis ATCC 23365]
 gi|260156754|gb|EEW91834.1| 3'-5' exonuclease [Brucella suis bv. 4 str. 40]
 gi|261745764|gb|EEY33690.1| 3'-5' exonuclease [Brucella suis bv. 3 str. 686]
          Length = 205

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 122/206 (59%), Positives = 154/206 (74%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I A QK
Sbjct: 1   MTIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTADVIQIEADQK 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+GRFD+AVL + FG   +PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 60  KAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIASKLTRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A 
Sbjct: 120 ICSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ELDL+GW   DIF+HS
Sbjct: 180 ACFKFLPTRSELDLMGWAESDIFAHS 205


>gi|163733026|ref|ZP_02140470.1| 3'- 5' exonuclease family protein, putative [Roseobacter litoralis
           Och 149]
 gi|161393561|gb|EDQ17886.1| 3'- 5' exonuclease family protein, putative [Roseobacter litoralis
           Och 149]
          Length = 204

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 111/206 (53%), Positives = 141/206 (68%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T +V++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +I+IA GQ 
Sbjct: 1   MTHKVYKNDLPDGLDLG--PMVAIDCETMGLHPHRDRLCVVQLSGGDGKAHLIQIAKGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D    K+FH+GRFDIA +   FG    PV+CTKIASRL RTYT++HGL  
Sbjct: 59  EAPNLCKLLEDPNVLKLFHFGRFDIAAMLNAFGATAAPVYCTKIASRLVRTYTDRHGLAK 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L+ELL I+ISK QQSSDW AD L+D Q+ YAASDV++LH LR      L R GR + A 
Sbjct: 119 LLQELLNIDISKQQQSSDWGADTLTDAQIDYAASDVLYLHQLREALNTMLTREGRMETAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL+GW + DIF+HS
Sbjct: 179 ACFDFLPMRAKLDLMGWPDTDIFAHS 204


>gi|163738084|ref|ZP_02145500.1| exonuclease, putative [Phaeobacter gallaeciensis BS107]
 gi|161388700|gb|EDQ13053.1| exonuclease, putative [Phaeobacter gallaeciensis BS107]
          Length = 204

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 109/207 (52%), Positives = 144/207 (69%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +++IA GQ
Sbjct: 1   MAN-HLYQNDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVVQLSGGDGNAHMVQIAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    K+FH+GRFDIA +++ FG    PV+CTKIASRL RTYT++HGL+
Sbjct: 58  SEAPNLCAMLEDPNVLKLFHFGRFDIAAMYHAFGALAAPVYCTKIASRLVRTYTDRHGLR 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +  +EL+G++ISK QQ SDW A  LSD QL YAASDV+HLH LR    ++L R  RS++A
Sbjct: 118 NLTQELIGVDISKQQQMSDWGAAQLSDAQLDYAASDVLHLHRLRAALDKRLDREDRSEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA+LDL GW + DIF+HS
Sbjct: 178 QACFDFLPMRAKLDLAGWSDTDIFAHS 204


>gi|222084303|ref|YP_002542832.1| RNAse D protein [Agrobacterium radiobacter K84]
 gi|221721751|gb|ACM24907.1| RNAse D protein [Agrobacterium radiobacter K84]
          Length = 208

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 149/205 (72%), Positives = 170/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIA+GQ  
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLIPRRDRLCVVQLSPGDGTADIIRIASGQSQ 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV ML D  R+KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVAMLADTTRQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLCRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKELL ++ISKAQQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR + A +
Sbjct: 124 LKELLEVDISKAQQSSDWAAEKLSPAQLEYAASDVLYLHALRDKLTARLVRDGRMEHAEA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|159046129|ref|YP_001534923.1| 3'-5' exonuclease [Dinoroseobacter shibae DFL 12]
 gi|157913889|gb|ABV95322.1| 3'-5' exonuclease [Dinoroseobacter shibae DFL 12]
          Length = 203

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 113/206 (54%), Positives = 141/206 (68%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   +H  D+P          +A+DTET+GL+P RDRLC+VQLS GDG   +++IA GQ
Sbjct: 1   MTN-HLHSHDLPDGLDLG--PVVAIDTETMGLVPARDRLCVVQLSSGDGDAHMVQIAQGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D K  K+FHY RFD+A L   FGVR  P++CTKIAS+L RTYT++HGLK
Sbjct: 58  TEAPNLTRMLTDPKVLKLFHYARFDVAALENAFGVRTAPIYCTKIASKLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L E+LG+++SKAQQSSDW A  LS  QL YAASDV++LH L+      L R GR++LA
Sbjct: 118 ALLSEVLGVDVSKAQQSSDWGAPTLSAAQLDYAASDVLYLHRLKEALDGMLAREGRTELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RA LDL GW  +DIF H
Sbjct: 178 QACFEFLPTRARLDLGGWSEIDIFHH 203


>gi|218508865|ref|ZP_03506743.1| ribonuclease III protein [Rhizobium etli Brasil 5]
 gi|327190020|gb|EGE57137.1| ribonuclease III protein [Rhizobium etli CNPAF512]
          Length = 208

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 147/205 (71%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL+RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLSRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISK QQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDVDISKTQQSSDWAAETLSQAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|99079868|ref|YP_612022.1| 3'-5' exonuclease [Ruegeria sp. TM1040]
 gi|99036148|gb|ABF62760.1| 3'-5' exonuclease [Ruegeria sp. TM1040]
          Length = 204

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 109/203 (53%), Positives = 143/203 (70%), Gaps = 2/203 (0%)

Query: 5   RVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
            +++ D+P          +A+D ET+GL P RDRLC+VQ+S GDG   +++IA GQ +AP
Sbjct: 4   HLYQHDLPNSLDLG--PVVAIDCETMGLNPHRDRLCVVQMSSGDGDAHLVQIAKGQTDAP 61

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
           NL  ML +    K+FHYGRFDIA L++ FG    PV+CTKIASRL RTYT++HGLK+  +
Sbjct: 62  NLTAMLTNPDVLKLFHYGRFDIAALYHRFGALAAPVYCTKIASRLVRTYTDRHGLKNLTQ 121

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           +LLG +ISK QQ SDW A+ L+  Q+ YAASDV+HLH LR    ++L R GRSDLA +C 
Sbjct: 122 DLLGQDISKQQQMSDWGAETLTRAQMDYAASDVLHLHRLRDALDQRLVREGRSDLAQACF 181

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
           +FL  RA LDL GW + DIF+HS
Sbjct: 182 DFLPTRARLDLAGWPDTDIFAHS 204


>gi|254718341|ref|ZP_05180152.1| hypothetical protein Bru83_02133 [Brucella sp. 83/13]
 gi|265983300|ref|ZP_06096035.1| 3'-5' exonuclease [Brucella sp. 83/13]
 gi|306839563|ref|ZP_07472369.1| 3'-5' exonuclease [Brucella sp. NF 2653]
 gi|264661892|gb|EEZ32153.1| 3'-5' exonuclease [Brucella sp. 83/13]
 gi|306405349|gb|EFM61622.1| 3'-5' exonuclease [Brucella sp. NF 2653]
          Length = 205

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 123/206 (59%), Positives = 154/206 (74%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H  D+P       VDA+A+DTETLGL P RDRLC+VQ+SPGDGT D+I+I AGQK
Sbjct: 1   MTIRFHRNDLP-NLDNYQVDAVAIDTETLGLNPHRDRLCMVQISPGDGTADVIQIEAGQK 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+GRFD+AVL   FG   +PVFCTKIAS+LTRTYT++HGLK+
Sbjct: 60  KAPNLVKLLKDRSITKIFHFGRFDLAVLANAFGTMPQPVFCTKIASKLTRTYTDRHGLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL ++ISK QQSSDW+A+ LS  QL+YAASDV++LH L+    ++L+R GR+  A 
Sbjct: 120 ICSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKAVLEQRLERDGRTKQAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  R+ELDL+GW   DIF+HS
Sbjct: 180 ACFKFLPTRSELDLMGWAESDIFAHS 205


>gi|146278808|ref|YP_001168967.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17025]
 gi|145557049|gb|ABP71662.1| 3'-5' exonuclease [Rhodobacter sphaeroides ATCC 17025]
          Length = 204

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 144/206 (69%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI +H  D+P          +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ 
Sbjct: 1   MTIHLHRNDLPDGLDLGR--VVAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK 
Sbjct: 59  RAPNLERLLTDPQVLKLFHFGRFDIAALQRAFGVRTEPVWCTKIASKMVRTFTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA 
Sbjct: 119 LLLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKEELEARLLREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
            C +FL  RAELDL+GW+   DIF H
Sbjct: 179 RCFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|254780636|ref|YP_003065049.1| ribonuclease D [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040313|gb|ACT57109.1| ribonuclease D [Candidatus Liberibacter asiaticus str. psy62]
          Length = 207

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ
Sbjct: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK
Sbjct: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA
Sbjct: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
           TSCCNFLMDRAELDLLGWENVDIFSHS
Sbjct: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207


>gi|260460457|ref|ZP_05808708.1| 3'-5' exonuclease [Mesorhizobium opportunistum WSM2075]
 gi|259033562|gb|EEW34822.1| 3'-5' exonuclease [Mesorhizobium opportunistum WSM2075]
          Length = 206

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 126/207 (60%), Positives = 156/207 (75%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+ D+P       V A+A+DTETLGL P RDRLC+VQ+SPGDG+ D+I+IA GQ
Sbjct: 1   MADIRFHKHDLPD-LTHYNVGAVAIDTETLGLNPHRDRLCVVQISPGDGSADVIQIAPGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L +    K+FHYGRFD+AVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 60  KKAPNLVSLLRNRGITKLFHYGRFDLAVLYNAFGVMPEPVFCTKIASRLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D   ELLG+ +SKAQQSSDW+A+ LS EQL+YAASDV++LH LR   + +L R GR+  A
Sbjct: 120 DICFELLGVGLSKAQQSSDWAAEILSPEQLEYAASDVLYLHRLRDVLSGRLARDGRTKEA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GW   DIF+HS
Sbjct: 180 DACFRFLPTRAKLDLMGWGEEDIFAHS 206


>gi|241207041|ref|YP_002978137.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860931|gb|ACS58598.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 208

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 149/205 (72%), Positives = 171/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT DIIRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADIIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           A NLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  ARNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTATPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L +++SKAQQSSDW+A+ LS  QL+YAASDV++LHALR + TE+L R GR D AT+
Sbjct: 124 LKEMLDVDVSKAQQSSDWAAERLSPAQLEYAASDVLYLHALRDKLTERLIRDGRYDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|119713543|gb|ABL97595.1| putative exonuclease [uncultured marine bacterium EB0_39F01]
          Length = 204

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 103/207 (49%), Positives = 141/207 (68%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT    ++ D+P          +A+DTET+GL P RDRLC++Q S GDG   I++I    
Sbjct: 1   MTNFT-YKNDLPDNLELG--PIVAIDTETMGLNPMRDRLCVIQFSSGDGNAHIVQIEPDA 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APN+  +L+D+ + K+FH+ RFDIA+L + F + + PV+CTKIAS+L RTYTN+HGLK
Sbjct: 58  PQAPNICKILLDQNKVKLFHFARFDIAILKHHFKINISPVYCTKIASKLVRTYTNKHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+E+L I ISK QQSSDW A +L+  Q++YAASDV++LH L  +    L+R  R ++A
Sbjct: 118 NLLREMLSIEISKQQQSSDWGASELTKAQIEYAASDVLYLHKLMDKLNLNLKRENRYEIA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C NFL  RA LDL GW   DIFSHS
Sbjct: 178 EACFNFLPMRATLDLAGWSEDDIFSHS 204


>gi|329888476|ref|ZP_08267074.1| 3'-5' exonuclease family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328847032|gb|EGF96594.1| 3'-5' exonuclease family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 204

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 108/206 (52%), Positives = 142/206 (68%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+  HEGD+P          +A+D+ET+GL  RRD LC+VQLS GDG   ++R+     
Sbjct: 1   MTVYFHEGDLPDGLDLG--PQVAIDSETMGLRFRRDPLCVVQLSSGDGNAHVVRLNRPAY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  +L D K  KIFH+GRFDI +     GV  RPV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKRLLTDPKVLKIFHFGRFDIGMFDLHLGVETRPVYCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             KEL G+++SKAQQSSDW A +LS  QL YAASDV++LHA+  +  E L R GR +LA 
Sbjct: 119 VAKELAGVDMSKAQQSSDWGAAELSQAQLDYAASDVLYLHAIMNRLNEMLVREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R+ LDL GW+ +DIF+H+
Sbjct: 179 ACFDFLPVRSRLDLAGWDEIDIFAHA 204


>gi|209551599|ref|YP_002283516.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537355|gb|ACI57290.1| 3'-5' exonuclease [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 208

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 149/205 (72%), Positives = 172/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIA+GQK 
Sbjct: 4   TIRYHEGDISAADAARYTGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIASGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTNPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISKAQQSSDW+A+ LS  QL+YAASDV++LHALR + TE+L R GR D AT+
Sbjct: 124 LKEMLDVDISKAQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTERLLRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWEEADIFAHS 208


>gi|218670593|ref|ZP_03520264.1| ribonuclease III protein [Rhizobium etli GR56]
          Length = 208

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 147/205 (71%), Positives = 169/205 (82%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI    AARY  A+A+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISTADAARYTGAVAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNLV +L D   +KIFHYGRFDIAVLF+TFGV   PVFCTKIASRL RTYT++HGLKDN
Sbjct: 64  APNLVALLEDPTHQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLIRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L I+ISK QQSSDW+A+ LS  QL+YAASDV++LHALR + T +L R GR D AT+
Sbjct: 124 LKEMLDIDISKTQQSSDWAAETLSPAQLEYAASDVLYLHALRDKLTARLIRDGRFDHATA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 184 CFEFLPTRAKLDLLGWEEADIFAHS 208


>gi|126724660|ref|ZP_01740503.1| exonuclease, putative [Rhodobacterales bacterium HTCC2150]
 gi|126705824|gb|EBA04914.1| exonuclease, putative [Rhodobacterales bacterium HTCC2150]
          Length = 203

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 140/206 (67%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M+   V++ D+P          +A+D ET+GL P RDRLC++Q+S GDG   ++++  GQ
Sbjct: 1   MSN-TVYKRDLPDGLDLG--PVVAIDCETMGLNPIRDRLCLIQMSNGDGNAHMVQVEKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    K+FH+GRFDIA +   FGV   PV+CTKIAS++ RTYT++HGL+
Sbjct: 58  TEAPNLCRMLADPNVLKLFHFGRFDIAAMHNAFGVLTEPVYCTKIASKMVRTYTDRHGLR 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+ELL ++ISK QQ SDW A+ L+  QL YAASDV+HLH LR +  E L R GR +LA
Sbjct: 118 NLLQELLKVDISKFQQMSDWGAETLTKAQLDYAASDVLHLHRLRDRLNELLVREGRMELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            SC +FL  RA LDL GW   DIF+H
Sbjct: 178 QSCFDFLPSRALLDLKGWPETDIFAH 203


>gi|158425553|ref|YP_001526845.1| 3'-5' exonuclease [Azorhizobium caulinodans ORS 571]
 gi|158332442|dbj|BAF89927.1| 3'-5' exonuclease [Azorhizobium caulinodans ORS 571]
          Length = 206

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 125/208 (60%), Positives = 155/208 (74%), Gaps = 4/208 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ- 60
            TIR+H GD+P     +    +A+DTETLGL P RDRLC+VQLS GDGT D+++I AG  
Sbjct: 1   MTIRLHRGDLPDSF--QPAPVVAIDTETLGLKPHRDRLCVVQLSNGDGTADVVQIPAGAT 58

Query: 61  -KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
            ++APNLV ML D    K+FH+GRFDIAVL +TFGV   PVFCTKIASRLTRTYT++HGL
Sbjct: 59  AESAPNLVRMLADPNVVKLFHFGRFDIAVLLHTFGVTTAPVFCTKIASRLTRTYTDRHGL 118

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           KD ++ELLG+++SK QQSSDW+A +L+D QL YAASDV+HLHA + +    L R GR+ L
Sbjct: 119 KDLVRELLGVDLSKQQQSSDWAASELTDAQLAYAASDVLHLHACKEKLEAMLARDGRTAL 178

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSHS 207
           A  C  FL  RA LDL GW + DIF+HS
Sbjct: 179 AAECFKFLPARAALDLAGWPDEDIFAHS 206


>gi|258541780|ref|YP_003187213.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256632858|dbj|BAH98833.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256635915|dbj|BAI01884.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-03]
 gi|256638970|dbj|BAI04932.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-07]
 gi|256642024|dbj|BAI07979.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-22]
 gi|256645079|dbj|BAI11027.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-26]
 gi|256648134|dbj|BAI14075.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-32]
 gi|256651187|dbj|BAI17121.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654178|dbj|BAI20105.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-12]
          Length = 217

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 103/208 (49%), Positives = 140/208 (67%), Gaps = 7/208 (3%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA----- 58
           I +H  D+P      +  ++AVDTET+GL P RDRLC+VQLS GDGT  +++I       
Sbjct: 10  ITLHRNDLPDNVT--FTGSVAVDTETMGLNPHRDRLCLVQLSAGDGTAHLVQIIPTSLGG 67

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              + PNL  +L D    KI H+ RFD+A+L +  G+ V PV CTKIA+RL RT+T++HG
Sbjct: 68  KGYDCPNLKRVLADPSITKIMHFARFDVAILQHALGITVSPVVCTKIAARLVRTFTDRHG 127

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           L    +++LG+ +SK QQ+SDW A +L  EQL YAASDV++LHAL  + +  L R GR +
Sbjct: 128 LAALCRDMLGVELSKQQQTSDWGAKELKPEQLAYAASDVLYLHALWDKMSALLDREGRRE 187

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA +C +FL  RA LDLLG+E+ DIFSH
Sbjct: 188 LAQACYDFLPARARLDLLGYEDPDIFSH 215


>gi|83944937|ref|ZP_00957303.1| Ribonuclease D [Oceanicaulis alexandrii HTCC2633]
 gi|83851719|gb|EAP89574.1| Ribonuclease D [Oceanicaulis alexandrii HTCC2633]
          Length = 204

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 138/206 (66%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI  H GD+P          +A+DTET GL   RD LC+VQLS GDG   I++      
Sbjct: 1   MTIHFHRGDLPDGLDLG--KRVAIDTETQGLSLVRDGLCLVQLSAGDGEAHIVQPDRATY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  +L D   EK+ H+ RFD+A++    GV + PVFCTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKALLADTGVEKLLHFARFDLAIIERDLGVTMTPVFCTKIASKLVRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +E+ G+ +SK QQSSDW+A DLS+ QL YAASDV++LHA+    T  L+R GR ++A 
Sbjct: 119 VCREIAGVELSKQQQSSDWAAQDLSEAQLNYAASDVLYLHAIADGLTAMLEREGRMEMAR 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL+GW+  DIF+HS
Sbjct: 179 ACFDFLPSRARLDLMGWDETDIFAHS 204


>gi|114769797|ref|ZP_01447407.1| exonuclease, putative [alpha proteobacterium HTCC2255]
 gi|114549502|gb|EAU52384.1| exonuclease, putative [alpha proteobacterium HTCC2255]
 gi|161170293|gb|ABX59263.1| 5-exonuclease family protein [uncultured marine bacterium
           EB000_55B11]
 gi|297183821|gb|ADI19944.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 204

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 103/207 (49%), Positives = 141/207 (68%), Gaps = 3/207 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT    ++ D+P          +A+DTET+GL P RDRLC++Q S GDG   I++I    
Sbjct: 1   MTNFT-YKNDLPDNLELG--PIVAIDTETMGLNPMRDRLCVIQFSSGDGHAHIVQIEPDA 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APN+  +L+D+ + K+FH+ RFDIA+L + F + + PV+CTKIAS+L RTYTN+HGLK
Sbjct: 58  PQAPNICKILLDQNKVKLFHFARFDIAILKHHFKINISPVYCTKIASKLVRTYTNKHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+E+L I ISK QQSSDW A +L+  Q++YAASDV++LH L  +    L+R  R ++A
Sbjct: 118 NLLREMLSIEISKQQQSSDWGASELTKAQIEYAASDVLYLHKLMDKLNLNLKRENRYEIA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C NFL  RA LDL GW   DIFSHS
Sbjct: 178 EACFNFLPMRATLDLAGWSEDDIFSHS 204


>gi|85705765|ref|ZP_01036862.1| exonuclease, putative [Roseovarius sp. 217]
 gi|85669755|gb|EAQ24619.1| exonuclease, putative [Roseovarius sp. 217]
          Length = 203

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 139/206 (67%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   ++++A GQ
Sbjct: 1   MAN-HLYQNDLPDGLDLG--SVVAIDCETMGLHPHRDRLCVVQLSGGDGHAHLVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L D    K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TSAPNLERLLTDPNVLKLFHFGRFDIAAMHNAFGALAAPVYCTKIASKLIRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L+ELL I+ISK QQSSDW A+ L+  QL YAASDV++LH LR +   +L R  R  LA
Sbjct: 118 YLLQELLNIDISKQQQSSDWGAESLTSAQLDYAASDVLYLHRLRDELNTRLVREDRMGLA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LDL GW  +DIF+H
Sbjct: 178 QACFDFLPQRAVLDLAGWPEIDIFAH 203


>gi|163851920|ref|YP_001639963.1| 3'-5' exonuclease [Methylobacterium extorquens PA1]
 gi|163663525|gb|ABY30892.1| 3'-5' exonuclease [Methylobacterium extorquens PA1]
          Length = 209

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 148/206 (71%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H GD+P + A      IA+DTETLGL P RDRLC+VQ+S GDG+ D+++I  G  
Sbjct: 6   SRIRLHHGDLPPDFAPGAA--IAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPGDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L+ +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLMAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAGTLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|182677567|ref|YP_001831713.1| 3'-5' exonuclease [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633450|gb|ACB94224.1| 3'-5' exonuclease [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 204

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 118/206 (57%), Positives = 153/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I +H+GD+P      +  ++AVDTETLGL+P RDRLC+VQLS GDG   +++I  GQ 
Sbjct: 1   MAIHLHKGDLPENV--SFGRSVAVDTETLGLLPHRDRLCLVQLSGGDGQAHLVQIKPGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +AP+L  +L+D    K+FHY RFDIAVL+ TFG    P++CTKIAS+LTRTYT++HGLKD
Sbjct: 59  HAPHLERLLIDPNVTKLFHYARFDIAVLYKTFGTMTTPLYCTKIASKLTRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+++SK QQSSDW AD LSD QL YAASDV+HLHALR +    L+R  R++LA 
Sbjct: 119 LARELLGVDLSKQQQSSDWGADTLSDAQLTYAASDVLHLHALRTKLDGMLEREHRTELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL GW   DIFSH+
Sbjct: 179 ACFDFLPTRAKLDLAGWAETDIFSHA 204


>gi|319408044|emb|CBI81698.1| Ribonuclease D [Bartonella schoenbuchensis R1]
          Length = 206

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 127/207 (61%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT IRVH+GD+P      +VDAIAVDTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MTEIRVHQGDLP-NLDNYHVDAIAVDTETLGLQPYRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFG+    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVKLLEDKAITKIFHFGRFDLAILAHTFGIMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+ + LS  Q++YAASDV++LH L+  F  +L+R  R ++A
Sbjct: 120 EICSELLNVNISKQQQSSDWATETLSRAQIEYAASDVLYLHRLKSVFETRLKREERENVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW   DIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWTETDIFAHS 206


>gi|302381884|ref|YP_003817707.1| 3'-5' exonuclease [Brevundimonas subvibrioides ATCC 15264]
 gi|302192512|gb|ADL00084.1| 3'-5' exonuclease [Brevundimonas subvibrioides ATCC 15264]
          Length = 204

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 107/206 (51%), Positives = 144/206 (69%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+ +HEGD+P +        +AVD+ET+GL  RRD LC+VQLS GDG   ++R++    
Sbjct: 1   MTVYLHEGDLPDDLDLG--PEVAVDSETMGLRFRRDPLCVVQLSSGDGDAHVVRLSRPDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  ++ D    KIFH+GRFDIA++    GV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKRLMADRDVLKIFHFGRFDIAMVELHLGVETGPVYCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +E+ GI++SKAQQSSDW A +LS  QL YAASDV+HLH +  +  E L R GR +LA 
Sbjct: 119 VAREMAGIDLSKAQQSSDWGAAELSQAQLDYAASDVLHLHVIMRRLNEMLVREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LDL GW+ +DIF+H+
Sbjct: 179 ACFDFLPVRARLDLRGWDEMDIFAHT 204


>gi|259417301|ref|ZP_05741220.1| 3'-5' exonuclease [Silicibacter sp. TrichCH4B]
 gi|259346207|gb|EEW58021.1| 3'-5' exonuclease [Silicibacter sp. TrichCH4B]
          Length = 204

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 108/203 (53%), Positives = 140/203 (68%), Gaps = 2/203 (0%)

Query: 5   RVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
            +++ D+P          +A+D ET+GL P RDRLC+VQ+S GDG   +++I+  Q  AP
Sbjct: 4   HLYQNDLPDSVDLG--PVVAIDCETMGLNPHRDRLCVVQMSGGDGDAHLVQISKDQTEAP 61

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
           NL  ML +    K+FHYGRFDIA L++ FG    PV+CTKIASRL RTYT++HGLK+  +
Sbjct: 62  NLTSMLTNPDVLKLFHYGRFDIAALYHRFGALTAPVYCTKIASRLVRTYTDRHGLKNLTQ 121

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           +LLG +ISK QQ SDW AD L+  Q+ YAASDV+HLH LR     +L R GRSDLA +C 
Sbjct: 122 DLLGQDISKQQQMSDWGADTLTRAQMDYAASDVLHLHRLRGALDLRLAREGRSDLAQACF 181

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
           +FL  RA LDL GW + DIF+HS
Sbjct: 182 DFLPTRARLDLAGWPDTDIFAHS 204


>gi|332559626|ref|ZP_08413948.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
 gi|332277338|gb|EGJ22653.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
          Length = 204

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 145/206 (70%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI +H  D+P          +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ 
Sbjct: 1   MTIHLHRNDLPDGLVLG--PVVAIDTETMGLDPRRDRLCVVQLSAGDGDAHLLQIERGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK 
Sbjct: 59  SAPNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA 
Sbjct: 119 LLLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
            C +FL  RAELDL+GW+   DIF H
Sbjct: 179 RCFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|221640647|ref|YP_002526909.1| 3'-5' exonuclease [Rhodobacter sphaeroides KD131]
 gi|221161428|gb|ACM02408.1| 3'-5' exonuclease [Rhodobacter sphaeroides KD131]
          Length = 204

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 145/206 (70%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI +H  D+P          +A+DTET+GL PRRDRLC+VQLS GDG   +++I  GQ 
Sbjct: 1   MTIHLHRSDLPDGLVLG--PVVAIDTETMGLDPRRDRLCVVQLSAGDGDAHLVQIERGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D +  K+FH+GRFDIA L   FGVR  PV+CTKIAS++ RT+T++HGLK 
Sbjct: 59  SAPNLERLLTDPQVLKLFHFGRFDIAALKRAFGVRTEPVWCTKIASKMVRTFTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L EL+G+++SK QQ+SDW A +L+D Q  YAASDV+HLH L+ +   +L R GR +LA 
Sbjct: 119 LLLELVGVDVSKQQQTSDWGAAELTDAQKDYAASDVLHLHRLKDELEARLLREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
            C +FL  RAELDL+GW+   DIF H
Sbjct: 179 RCFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|75674370|ref|YP_316791.1| 3'-5' exonuclease [Nitrobacter winogradskyi Nb-255]
 gi|74419240|gb|ABA03439.1| 3'-5' exonuclease [Nitrobacter winogradskyi Nb-255]
          Length = 206

 Score =  191 bits (485), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 125/206 (60%), Positives = 155/206 (75%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H GD+P +  ARY  + A+DTET+GL P RDRLC+VQ+SPGDG+ D+I+IA GQ+
Sbjct: 1   MTIRLHRGDLPHQDLARYTGSAAIDTETMGLKPHRDRLCVVQMSPGDGSADVIQIARGQR 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL+ +L D    KIFH+ RFD+A L+  FGV  RPV+CTKIASRL RTYT++HGLKD
Sbjct: 61  DAPNLIKLLKDPAIVKIFHFARFDLAALYNAFGVMPRPVYCTKIASRLIRTYTDRHGLKD 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELL I++SK QQSSDW +  LSD QL YAASDV+HLHALR +    L R  RS LA 
Sbjct: 121 LVRELLSIDLSKQQQSSDWGSPTLSDAQLAYAASDVLHLHALRDKLEATLAREDRSALAQ 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL GWE  DIF+HS
Sbjct: 181 ACFEFLPSRAMLDLAGWETEDIFAHS 206


>gi|254450150|ref|ZP_05063587.1| 3'-5' exonuclease [Octadecabacter antarcticus 238]
 gi|198264556|gb|EDY88826.1| 3'-5' exonuclease [Octadecabacter antarcticus 238]
          Length = 203

 Score =  191 bits (485), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 108/206 (52%), Positives = 141/206 (68%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   +++ D+P          +A+D ET+GL P RDRLC+VQLS GDG   +I++A GQ
Sbjct: 1   MTN-HLYQNDLPDGLDLGA--VVAIDCETMGLNPHRDRLCLVQLSGGDGNCHLIQVAGGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D +  K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TTAPNLCKVLADPQVLKLFHFGRFDIAAMLNAFGTVTAPVYCTKIASKLIRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+E L ++ISK QQ SDW AD LS  QL YAASDV++LH LR +   +L R  R+D+A
Sbjct: 118 NLLQEFLRVDISKFQQQSDWGADQLSKAQLDYAASDVLYLHKLRDELNIRLARELRTDMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW   DIFSH
Sbjct: 178 QACFDFLPMRAQLDLAGWPEQDIFSH 203


>gi|84684593|ref|ZP_01012494.1| exonuclease, putative [Maritimibacter alkaliphilus HTCC2654]
 gi|84667572|gb|EAQ14041.1| exonuclease, putative [Rhodobacterales bacterium HTCC2654]
          Length = 203

 Score =  191 bits (485), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 142/206 (68%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P          +A+D ET+GL P RDRLC+VQ+S GDG   ++++  GQ
Sbjct: 1   MAN-HLYKCDLPDGLDLG--PVVAIDCETMGLNPHRDRLCVVQMSGGDGHAHMVQVERGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    KIFH+GRFDIA L   FGV   PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TEAPNLTAMLTDPNVLKIFHFGRFDIAALLNAFGVVTAPVYCTKIASKLIRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L+E+L I+ISK QQ +DW A +L++ QL YAASDV++LH LR +   +L R GR++LA
Sbjct: 118 TLLEEILRIDISKYQQQTDWGARELTEAQLDYAASDVLYLHRLREKLDGRLAREGRAELA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW + DIF+H
Sbjct: 178 QACFDFLPARAQLDLAGWPDTDIFTH 203


>gi|315497170|ref|YP_004085974.1| 3'-5' exonuclease [Asticcacaulis excentricus CB 48]
 gi|315415182|gb|ADU11823.1| 3'-5' exonuclease [Asticcacaulis excentricus CB 48]
          Length = 206

 Score =  191 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 110/206 (53%), Positives = 141/206 (68%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI  HEGD+P          +A+D+ET+GL   RD LC+VQLS GDG   ++R+     
Sbjct: 1   MTIHYHEGDLPNGLNLGA--VVAIDSETMGLRFGRDDLCVVQLSAGDGDAHVVRLNRPAY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  +L DEK  K+FH+GRFDI +     GV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKALLTDEKVLKLFHFGRFDIGMFLLHLGVVTAPVYCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++ELL ++ISKAQQSSDW A  L+ EQL YAASDV+HLH LR +    L R GR++LA 
Sbjct: 119 LVRELLSVDISKAQQSSDWGAQTLTPEQLAYAASDVLHLHTLREKLDTMLAREGRTELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
            C +FL  R +LDL GWE+ DIF+HS
Sbjct: 179 GCFDFLPHRVKLDLAGWEDTDIFAHS 204


>gi|148555811|ref|YP_001263393.1| 3'-5' exonuclease [Sphingomonas wittichii RW1]
 gi|148501001|gb|ABQ69255.1| 3'-5' exonuclease [Sphingomonas wittichii RW1]
          Length = 205

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 107/206 (51%), Positives = 142/206 (68%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
            T+ +H+ D+PA+        +AVDTET+GL+  RDRLC+VQ+S G G   ++R A G  
Sbjct: 1   MTVHLHQEDLPADAL--GPGPVAVDTETMGLITPRDRLCLVQISDGRGDEHLVRFAPGSD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D  R K++H+ RFD+A + +  GV   PV+CTK ASRL RTYT++HGLK
Sbjct: 59  YAAPNLRAVLADPARLKLYHFARFDLAAIRHYIGVMAAPVYCTKTASRLIRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG  +SK QQSSDW A DLS+ Q  YAASDV +LHA+R    E+L R GR+ LA
Sbjct: 119 ELVRELLGQEVSKQQQSSDWGAPDLSEAQKDYAASDVRYLHAMRTILDERLAREGRTALA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RAELDL GW  +DIF+H
Sbjct: 179 QACFDFLPARAELDLAGWPEIDIFAH 204


>gi|288956945|ref|YP_003447286.1| ribonuclease D [Azospirillum sp. B510]
 gi|288909253|dbj|BAI70742.1| ribonuclease D [Azospirillum sp. B510]
          Length = 208

 Score =  190 bits (483), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 106/208 (50%), Positives = 143/208 (68%), Gaps = 3/208 (1%)

Query: 2   TTIRVHEGDIPAECAARYV---DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
             I +H+GD+P           + +A+DTET+GL P RDRLC+VQLS GDG V +++   
Sbjct: 1   MPIDLHDGDLPDGLDLAAGARDNCVAIDTETMGLNPHRDRLCLVQLSAGDGAVHLVQFRP 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G+  APNL  +L D    K+FH+ RFD+AV+    GV  RPV+CTK+AS+L RT+T++HG
Sbjct: 61  GRYEAPNLKRLLTDPGVTKLFHFARFDVAVMKAYLGVDCRPVYCTKVASKLVRTFTDRHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           LKD  K+LLG+ ISK QQSSDW A +L+ +Q++YAASDV+HLH L+ +    L R GR+ 
Sbjct: 121 LKDLCKDLLGVEISKQQQSSDWGAPELTTDQMKYAASDVLHLHDLKAKLDVMLAREGRTH 180

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA +C +FL  R ELDL GWE  DI +H
Sbjct: 181 LAQACFDFLPARGELDLGGWETPDILAH 208


>gi|254438617|ref|ZP_05052111.1| 3'-5' exonuclease, putative [Octadecabacter antarcticus 307]
 gi|198254063|gb|EDY78377.1| 3'-5' exonuclease, putative [Octadecabacter antarcticus 307]
          Length = 203

 Score =  190 bits (483), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 141/206 (68%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +++ D+P +        +A+D ET+GL P RDRLC++QLS GDG   +I+I+ GQ
Sbjct: 1   MPN-HLYQHDLPDDLDLG--PVVAIDCETMGLNPHRDRLCLIQLSSGDGNCHLIQISVGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D +  K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TTAPNLCKVLADPQVLKLFHFGRFDIAAMLNAFGTVTAPVYCTKIASKLIRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+E L ++ISK QQ SDW A+ LS  Q+ YAASDV++LH LR +   +L R  R+D+A
Sbjct: 118 NLLQEFLRVDISKFQQQSDWGAETLSKAQIDYAASDVLYLHQLRDELNIRLVRERRTDMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW   DIFSH
Sbjct: 178 QACFDFLPMRAKLDLAGWPEQDIFSH 203


>gi|254463169|ref|ZP_05076585.1| 3'-5' exonuclease [Rhodobacterales bacterium HTCC2083]
 gi|206679758|gb|EDZ44245.1| 3'-5' exonuclease [Rhodobacteraceae bacterium HTCC2083]
          Length = 203

 Score =  190 bits (483), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 107/206 (51%), Positives = 143/206 (69%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   +++ DIPA+        +A+D ET+GL P RDRLC++Q+S GDG   ++++A GQ
Sbjct: 1   MTN-TLYQNDIPADLDLG--PVVAIDCETMGLHPHRDRLCVIQMSGGDGNAHLVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  TEAPNLCKMLTDPNVLKLFHFGRFDIAAMQNAFGAVTAPVYCTKIASKLIRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L+ELL I+ISK QQSSDW +  L++ QL+YAASDV++LH LR +  ++L R  R  +A
Sbjct: 118 NLLQELLNIDISKQQQSSDWGSAKLTNAQLEYAASDVLYLHRLRTELNKRLIREDRMVIA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LDL GW   DIFSH
Sbjct: 178 QACFDFLPMRANLDLKGWPEQDIFSH 203


>gi|254419186|ref|ZP_05032910.1| 3'-5' exonuclease, putative [Brevundimonas sp. BAL3]
 gi|196185363|gb|EDX80339.1| 3'-5' exonuclease, putative [Brevundimonas sp. BAL3]
          Length = 204

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 105/206 (50%), Positives = 143/206 (69%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+ +HEGD+P +        +A+D+ET+GL  RRD LC+VQLS GDG   ++R+     
Sbjct: 1   MTVYLHEGDLPDDLDLG--PDVAIDSETMGLRFRRDPLCVVQLSAGDGNAHVVRLNRPGY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  +L D    KIFH+GRFDI +     GV  RPV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKRLLTDPAVTKIFHFGRFDIGMFLLHLGVETRPVYCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++E +G+++SKAQQSSDW A +L+  QL YAASDV++LHA R +    L R GR++LA 
Sbjct: 119 VVRETVGVDLSKAQQSSDWGAAELTQAQLDYAASDVLYLHAARAKLDLMLAREGRAELAA 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
            C +FL  R+ LDL GW+ +DIF+HS
Sbjct: 179 QCFDFLPTRSALDLAGWDEIDIFAHS 204


>gi|85709987|ref|ZP_01041052.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. NAP1]
 gi|85688697|gb|EAQ28701.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. NAP1]
          Length = 215

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 140/206 (67%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
            T+  HE D+PA         +AVDTET+GL+  RDRLC+VQ+S G G   ++R + G  
Sbjct: 5   MTVHFHEEDLPAGV-LEGTGPLAVDTETMGLITHRDRLCVVQISDGSGDEHLVRFSPGSD 63

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L DE R K++H+ RFD+A + Y  GV   PVFCTKIAS+L RTYT++HGLK
Sbjct: 64  YEAPNLSAILADESRVKLYHFARFDLAAIQYYLGVVAAPVFCTKIASKLVRTYTDRHGLK 123

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELLG +ISK QQSSDW   +L+D Q +YAASDV +LH LR +   +L+R GR ++A
Sbjct: 124 NLTDELLGESISKQQQSSDWGGPELNDAQREYAASDVRYLHRLRDELIVRLEREGRMEIA 183

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LD+ GW+  DIFSH
Sbjct: 184 QACFDFLPTRAALDIAGWDGRDIFSH 209


>gi|148260666|ref|YP_001234793.1| 3'-5' exonuclease [Acidiphilium cryptum JF-5]
 gi|146402347|gb|ABQ30874.1| 3'-5' exonuclease [Acidiphilium cryptum JF-5]
          Length = 218

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 106/209 (50%), Positives = 139/209 (66%), Gaps = 7/209 (3%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           TI +H  D+P          +AVDTET+GL PRRDRLC+VQLS GD +  +++I      
Sbjct: 11  TIHIHRHDLPDGLDLG--PVVAVDTETMGLDPRRDRLCLVQLSAGDNSAHLVQIVPPALG 68

Query: 62  ----NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               + PNL  +L      K+FH+ RFD+A+L +  GV   PV CTKIAS+L RTYT++H
Sbjct: 69  GRGADCPNLKRLLEHPGVTKLFHFARFDLAMLHHALGVTTAPVICTKIASKLVRTYTDRH 128

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           GLKD  ++L+GI ISK QQ+SDW + +LS EQ  YAASDV+HLHA+  +    L R GR 
Sbjct: 129 GLKDLCRDLVGIEISKQQQTSDWGSAELSPEQCAYAASDVLHLHAIWARLEALLVREGRR 188

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA +C  FL  RA+LDLLG+E+ DIFSH
Sbjct: 189 ELADACYRFLPARAKLDLLGFEDPDIFSH 217


>gi|326403860|ref|YP_004283942.1| 3'-5' exonuclease [Acidiphilium multivorum AIU301]
 gi|325050722|dbj|BAJ81060.1| 3'-5' exonuclease [Acidiphilium multivorum AIU301]
          Length = 218

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 106/209 (50%), Positives = 140/209 (66%), Gaps = 7/209 (3%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           TI +H  D+P          +AVDTET+GL PRRDRLC+VQLS GD +  +++I      
Sbjct: 11  TIHIHRHDLPDGLDLG--PVVAVDTETMGLDPRRDRLCLVQLSAGDNSAHLVQIVPPALG 68

Query: 62  ----NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               + PNL  +L      K+FH+ RFD+A+L++  GV   PV CTKIAS+L RTYT++H
Sbjct: 69  GRGADCPNLKRLLEHPGVTKLFHFARFDLAMLYHALGVTTAPVICTKIASKLVRTYTDRH 128

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           GLKD  ++L+GI ISK QQ+SDW + +LS EQ  YAASDV+HLHA+  +    L R GR 
Sbjct: 129 GLKDLCRDLVGIEISKQQQTSDWGSAELSPEQCAYAASDVLHLHAIWARLEALLVREGRR 188

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA +C  FL  RA+LDLLG+E+ DIFSH
Sbjct: 189 ELADACYRFLPARAKLDLLGFEDPDIFSH 217


>gi|170751505|ref|YP_001757765.1| 3'-5' exonuclease [Methylobacterium radiotolerans JCM 2831]
 gi|170658027|gb|ACB27082.1| 3'-5' exonuclease [Methylobacterium radiotolerans JCM 2831]
          Length = 207

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 113/205 (55%), Positives = 143/205 (69%), Gaps = 2/205 (0%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           T+R+H GD+PA   A     +A+DTETLGL P RDRLC+VQLS GDGT D+++I      
Sbjct: 5   TVRLHRGDLPASYDAGRA--VAIDTETLGLNPHRDRLCVVQLSTGDGTADVVQIPQAGPE 62

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
              L  +L D    KIFH+ RFD+AVL+   GV   PV+CTKIAS+L RTYT++HGLKD 
Sbjct: 63  PVVLKRVLADPGILKIFHFARFDVAVLYRALGVMPSPVYCTKIASKLARTYTDRHGLKDV 122

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           ++EL+G+++SK QQSSDW A+ LS  QL YAASDV+HLHA R +    L R GR+DLA +
Sbjct: 123 VRELVGVDLSKQQQSSDWGAETLSQAQLDYAASDVLHLHAARERLDAMLAREGRTDLAAA 182

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA LDL GW   DIF+H+
Sbjct: 183 CFGFLPTRARLDLDGWPETDIFAHT 207


>gi|329114438|ref|ZP_08243200.1| Ribonuclease D [Acetobacter pomorum DM001]
 gi|326696514|gb|EGE48193.1| Ribonuclease D [Acetobacter pomorum DM001]
          Length = 256

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 102/208 (49%), Positives = 140/208 (67%), Gaps = 7/208 (3%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA----- 58
           I +H  D+P      +  ++AVDTET+GL P RDRLC+VQLS GDGT  +++I       
Sbjct: 49  ITLHRNDLPDNVT--FTGSVAVDTETMGLNPHRDRLCLVQLSAGDGTAHLVQIIPTSLGG 106

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              + PNL  ++ D    KI H+ RFD+A+L +  G+ V PV CTKIA+RL RT+T++HG
Sbjct: 107 KGYDCPNLKRVMADPSITKIMHFARFDVAILQHALGITVSPVVCTKIAARLVRTFTDRHG 166

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           L    +++LG+ +SK QQ+SDW A +L  EQL YAASDV++LHAL  + +  L R GR +
Sbjct: 167 LAALCRDMLGVELSKQQQTSDWGALELKPEQLAYAASDVLYLHALWDKMSALLDREGRRE 226

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA +C +FL  RA LDLLG+E+ DIFSH
Sbjct: 227 LAQACYDFLPARARLDLLGYEDPDIFSH 254


>gi|296537397|ref|ZP_06899246.1| 3''-5'' exonuclease [Roseomonas cervicalis ATCC 49957]
 gi|296262276|gb|EFH09052.1| 3''-5'' exonuclease [Roseomonas cervicalis ATCC 49957]
          Length = 217

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 106/208 (50%), Positives = 140/208 (67%), Gaps = 7/208 (3%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK-- 61
           I++H+ D+P      +   +A+DTET+GL PRRDRLC+VQLS GDG    ++I       
Sbjct: 12  IKLHKHDLPDGID--FGPVVAIDTETMGLDPRRDRLCLVQLSAGDGNAHCVQIIPESLGG 69

Query: 62  ---NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              + PNL  +L      K+FH+ RFD+A+L    G+   PV CTKIA++L RT+T++HG
Sbjct: 70  RGADCPNLKALLTRPDVVKLFHFARFDVAILRAALGIECAPVRCTKIAAKLVRTFTDRHG 129

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           LKD  +ELLG+ ISK QQSSDW A +L+ EQL YAASDV+HLHAL  +    L+R GR +
Sbjct: 130 LKDLCRELLGVEISKQQQSSDWGAPELTPEQLAYAASDVLHLHALWAKLEGLLRREGRLE 189

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA SC  FL  R +LDLLG+E+ DIFSH
Sbjct: 190 LAESCFRFLPARGQLDLLGYEDPDIFSH 217


>gi|209966458|ref|YP_002299373.1| ribonuclease D, putative [Rhodospirillum centenum SW]
 gi|209959924|gb|ACJ00561.1| ribonuclease D, putative [Rhodospirillum centenum SW]
          Length = 204

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
             I +H+GD+P          +A+DTET+GL P RDRLC+VQLS GDG   +++   G  
Sbjct: 1   MPIDLHDGDLPDGLDLG--PVVAIDTETMGLNPARDRLCLVQLSAGDGRCHLVQFRQGAG 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  ML D    K+FH+ RFDIAV+    GV   PV+CTK+AS+LTRT+T++HGLK
Sbjct: 59  YDAPNLKRMLTDPGTLKLFHFARFDIAVMQAYLGVLTGPVYCTKVASKLTRTFTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  ++LLG+ +SK QQSSDW AD+L+ EQL+YAASDV+HLH ++ +    L R GR+ LA
Sbjct: 119 DLCRDLLGVELSKQQQSSDWGADELTAEQLKYAASDVLHLHEIKARLDGMLAREGRTALA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C  FL  RA LDL GW + D+F+H
Sbjct: 179 EDCFRFLPTRALLDLGGWADPDLFAH 204


>gi|218530671|ref|YP_002421487.1| 3'-5' exonuclease [Methylobacterium chloromethanicum CM4]
 gi|218522974|gb|ACK83559.1| 3'-5' exonuclease [Methylobacterium chloromethanicum CM4]
          Length = 209

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 108/206 (52%), Positives = 145/206 (70%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           + IR+H  D+P + A      IA+DTETLGL P RDRLC+VQ+S GDG+ D+++I     
Sbjct: 6   SRIRLHHCDLPPDFAPGAA--IAIDTETLGLNPHRDRLCVVQVSRGDGSADVVQIRPSDP 63

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
               L  +L D    KIFH+ RFD+AVLF  FGV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 64  APERLKAVLADAGVVKIFHFARFDLAVLFNAFGVMPAPVYCTKIASKLARTYTDRHGLKD 123

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++EL+G+++SK QQSSDW A  LS  Q+ YAASDV+HLHA R +    L R GR+++A 
Sbjct: 124 VVRELVGVDLSKQQQSSDWGAATLSQAQIDYAASDVLHLHAARERLDAMLAREGRTEMAQ 183

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R++LDL GW  +DIF+H+
Sbjct: 184 ACFDFLPTRSKLDLAGWPEIDIFAHA 209


>gi|300021932|ref|YP_003754543.1| 3'-5' exonuclease [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523753|gb|ADJ22222.1| 3'-5' exonuclease [Hyphomicrobium denitrificans ATCC 51888]
          Length = 205

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 114/205 (55%), Positives = 148/205 (72%), Gaps = 3/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           T I++H+GD+P      + + IA+DTET+GL P RDRLC+VQLS GDGT  +++      
Sbjct: 4   TKIKLHKGDLPTGLT--FPNGIAIDTETMGLNPHRDRLCLVQLSGGDGTAHLVKFDGKSY 61

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D K  KIFH+ RFD+AVL +  GV   P++CTKIAS+L RTYT++HGLKD
Sbjct: 62  DAPNLKALLADPKSLKIFHFARFDVAVLEHYLGVVTSPIYCTKIASKLARTYTDRHGLKD 121

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            + E+LGI ISK QQSSDW A +LSD Q  YAA+DV+HLHAL+ +  E L R GR DLA 
Sbjct: 122 LVGEILGIEISKQQQSSDWGAAELSDSQRSYAANDVLHLHALKTRLDEMLARTGRQDLAK 181

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +   FL  RA+LDLLG+E+ DIF+H
Sbjct: 182 AAFGFLPIRAKLDLLGFED-DIFAH 205


>gi|298290361|ref|YP_003692300.1| 3'-5' exonuclease [Starkeya novella DSM 506]
 gi|296926872|gb|ADH87681.1| 3'-5' exonuclease [Starkeya novella DSM 506]
          Length = 210

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 120/213 (56%), Positives = 158/213 (74%), Gaps = 10/213 (4%)

Query: 2   TTIRVHEGDIPAECAAR-----YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI 56
            +IR+H GD+                +A+DTETLGL P RDRLC+VQLSPGDGT D+++I
Sbjct: 1   MSIRLHRGDL---VDLSRYTPENAPFVAIDTETLGLNPHRDRLCVVQLSPGDGTADVVQI 57

Query: 57  AAG--QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
            AG    +APNL  +L D +  K+FH+ RFD+AVL  TFG+ V PV+CTKIASRLTRTYT
Sbjct: 58  PAGAGPGSAPNLEALLTDPRITKLFHFARFDVAVLGKTFGLTVAPVWCTKIASRLTRTYT 117

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           ++HGLK+ ++EL+G+++SK QQSSDW+A++LS+ QLQYAASDV++LHALR +    L R 
Sbjct: 118 DRHGLKELVRELIGVDLSKQQQSSDWAAEELSEAQLQYAASDVLYLHALREKLASMLARD 177

Query: 175 GRSDLATSCCNFLMDRAELDLLGWENVDIFSHS 207
           GR++LA SC  FL  RA+LDL GW + DIF+HS
Sbjct: 178 GRTELAQSCFEFLPTRAKLDLAGWPDEDIFAHS 210


>gi|307293724|ref|ZP_07573568.1| 3'-5' exonuclease [Sphingobium chlorophenolicum L-1]
 gi|306879875|gb|EFN11092.1| 3'-5' exonuclease [Sphingobium chlorophenolicum L-1]
          Length = 205

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 108/206 (52%), Positives = 141/206 (68%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
            T+  HE D+P    A     IAVDTET+GL+  RDRLC+VQ+S G G   ++R   G  
Sbjct: 1   MTVHFHEEDLPQGVLA--PGPIAVDTETMGLITPRDRLCVVQISDGQGDEHLVRFNPGSD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D  R K++H+GRFDIA + +  G+   PV+CTKIASRL RTYT++HGLK
Sbjct: 59  YAAPNLRAVLADPARLKLYHFGRFDIAAIRHYMGIVAAPVYCTKIASRLVRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG  +SK QQSSDW    LSD Q +YAASDV +LHAL+ +  ++L R GR +LA
Sbjct: 119 ELVRELLGQELSKVQQSSDWGGPVLSDPQKEYAASDVRYLHALKAELDKRLVREGRMELA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RAELDL GW  +DIF+H
Sbjct: 179 QACFDFLPHRAELDLAGWPEIDIFAH 204


>gi|260577298|ref|ZP_05845271.1| 3'-5' exonuclease [Rhodobacter sp. SW2]
 gi|259020479|gb|EEW23802.1| 3'-5' exonuclease [Rhodobacter sp. SW2]
          Length = 204

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 143/206 (69%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             + +++GD+PA         +A+DTET+GL PRRDRLC+VQLS GDG   +++IA GQ 
Sbjct: 1   MAVHLYKGDLPAGLNLG--PVVAIDTETMGLDPRRDRLCLVQLSSGDGNAHLVQIARGQT 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    K+FH+GRFDIA +   FGV   PV+CTKIA++L RT+T++HGLK 
Sbjct: 59  SAPNLEKLLTDPSVLKLFHFGRFDIAAMKAAFGVVTAPVWCTKIAAKLVRTFTDRHGLKY 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            L+EL+G+++SK QQ+SDW ++ LSD Q  YAASDV++LH L  +    L R  R  LA 
Sbjct: 119 LLQELVGVDVSKQQQTSDWGSETLSDAQKDYAASDVLYLHRLMAELERCLIRENRLALAQ 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
            C +FL  RAELDL+GW+   DIF H
Sbjct: 179 RCFDFLPTRAELDLMGWDEPNDIFHH 204


>gi|332187924|ref|ZP_08389657.1| 3'-5' exonuclease family protein [Sphingomonas sp. S17]
 gi|332012085|gb|EGI54157.1| 3'-5' exonuclease family protein [Sphingomonas sp. S17]
          Length = 206

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 112/207 (54%), Positives = 150/207 (72%), Gaps = 2/207 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
            T+ +HE DIPA+  A    AIAVDTET+GL+  RDRLC+VQLS G     ++R +    
Sbjct: 1   MTVHLHEEDIPADLFAPGA-AIAVDTETMGLITPRDRLCVVQLSDGGPDEHLVRFSPDSD 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D  R K++H+GRFDIA + +  GV   PV+CTKIASRL RTYT++HGLK
Sbjct: 60  YAAPNLRALLADPARLKLYHFGRFDIAAIRHYLGVVAAPVYCTKIASRLIRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLGI +SKAQQSSDW A +LSD Q +YAASDV +LH ++++  ++L+R GR +LA
Sbjct: 120 ELVRELLGIELSKAQQSSDWGAPELSDAQREYAASDVRYLHRMKVELDKRLEREGRMELA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RAELDL GW  +DIF+H+
Sbjct: 180 QACFDFLPARAELDLAGWPEIDIFAHA 206


>gi|170743378|ref|YP_001772033.1| 3'-5' exonuclease [Methylobacterium sp. 4-46]
 gi|168197652|gb|ACA19599.1| 3'-5' exonuclease [Methylobacterium sp. 4-46]
          Length = 204

 Score =  187 bits (476), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 117/203 (57%), Positives = 146/203 (71%), Gaps = 2/203 (0%)

Query: 5   RVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           R+H GD+P + A     AIAVDTETLGL P RDRLC+VQ+S GDG  D+++IA G     
Sbjct: 4   RLHRGDLPDDYA--PGPAIAVDTETLGLEPHRDRLCVVQISRGDGEADLVQIAKGGPEPV 61

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +L D    KIFH+ RFD+AVLF+  GV   P++CTK+ASRL+RTYT++HGLKD ++
Sbjct: 62  VLKRVLTDPAVTKIFHFARFDLAVLFHRLGVMPGPIYCTKVASRLSRTYTDRHGLKDLVR 121

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           ELLGI ISK QQSSDW A+ LS  Q++YAASDV+HLHALR +    L R  R+ LA +C 
Sbjct: 122 ELLGIEISKQQQSSDWGAETLSPAQIEYAASDVLHLHALRAKLDAMLAREERTALAEACF 181

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
            FL  RA LDLLGW+ VDI +HS
Sbjct: 182 AFLPTRARLDLLGWDEVDILAHS 204


>gi|197103637|ref|YP_002129014.1| ribonuclease D [Phenylobacterium zucineum HLK1]
 gi|196477057|gb|ACG76585.1| ribonuclease D [Phenylobacterium zucineum HLK1]
          Length = 205

 Score =  187 bits (475), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 113/206 (54%), Positives = 148/206 (71%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T  VHEGD+PA+  A    ++A+D+ET+GL   RD LC+VQLS G G   ++++     
Sbjct: 1   MTTFVHEGDLPADVLAS-ASSVAIDSETMGLRLGRDPLCVVQLSDGGGDAHLVKLDRTTY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L D    KIFH+GRFDIA+ +   GV   PV+CTKIAS++ RTYT++HGLKD
Sbjct: 60  DAPNLKRLLTDPAVTKIFHFGRFDIAMFWLHLGVLTAPVYCTKIASKIARTYTDRHGLKD 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             KELLG+++SKAQQSSDW A  LSDEQ+ YAASDV+HLHAL+ +  + L R GR  LA 
Sbjct: 120 ISKELLGVDMSKAQQSSDWGAGKLSDEQVAYAASDVLHLHALKDRLQQMLVREGRDSLAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA LD+ GWE+VDIF+HS
Sbjct: 180 ACFDFLPHRAVLDVAGWEDVDIFAHS 205


>gi|332716830|ref|YP_004444296.1| Ribonuclease D [Agrobacterium sp. H13-3]
 gi|325063515|gb|ADY67205.1| Ribonuclease D [Agrobacterium sp. H13-3]
          Length = 208

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 150/205 (73%), Positives = 172/205 (83%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TIR HEGDI A  AARY+ AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK 
Sbjct: 4   TIRYHEGDISAADAARYLGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQKE 63

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  ML D  R+KIFHYGRFDIAVLF+TFGV   PVFCTKIASRLTRTYT++HGLKDN
Sbjct: 64  APNLTHMLADPARQKIFHYGRFDIAVLFHTFGVTTTPVFCTKIASRLTRTYTDRHGLKDN 123

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           LKE+L ++ISKAQQSSDW+A+ LS  QL+YAASDV+HLHALR + T +L R GR D A +
Sbjct: 124 LKEMLEVDISKAQQSSDWAAEKLSPAQLEYAASDVLHLHALRDKLTHRLVRDGRLDHADA 183

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C  FL  RA+LDLLGW+  DIF+HS
Sbjct: 184 CFAFLPTRAKLDLLGWDETDIFAHS 208


>gi|304392222|ref|ZP_07374164.1| 3'-5' exonuclease [Ahrensia sp. R2A130]
 gi|303296451|gb|EFL90809.1| 3'-5' exonuclease [Ahrensia sp. R2A130]
          Length = 211

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 154/206 (74%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR+H+ D+P    + Y D++A+DTETLGL PRRDRLC+VQLSPGDGT D+++I  GQ 
Sbjct: 8   MTIRLHKNDLPD--LSNYSDSVAIDTETLGLRPRRDRLCVVQLSPGDGTADVVQIEKGQT 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APN+  +LVD   +KI+HYGRFDIAVL++ FG      FCTKIASRLTRTYT++HGLK+
Sbjct: 66  SAPNIEKLLVDTNVQKIYHYGRFDIAVLYHAFGALSDNNFCTKIASRLTRTYTDRHGLKN 125

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              EL+G+++SK QQSSDW+A++L+  Q  YAASDV+HLHALR    ++L R  R  LA 
Sbjct: 126 LTHELIGVDLSKVQQSSDWAAEELTKAQQAYAASDVLHLHALRDALLKRLAREDRQHLAD 185

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
            C  FL  R  LDL GWE+ DIF+HS
Sbjct: 186 ECFKFLPTRCLLDLAGWEDTDIFAHS 211


>gi|329847152|ref|ZP_08262180.1| 3'-5' exonuclease family protein [Asticcacaulis biprosthecum C19]
 gi|328842215|gb|EGF91784.1| 3'-5' exonuclease family protein [Asticcacaulis biprosthecum C19]
          Length = 206

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 111/206 (53%), Positives = 143/206 (69%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+  HEGD+PA        +IA+D+ET+GL   RD LC+VQLS GDG   ++R+     
Sbjct: 1   MTVFYHEGDLPAGLDLG--KSIALDSETMGLRFGRDDLCVVQLSAGDGHAHVVRLNRPAY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  +LVD    K+FHYGRFDI +     GV   PV+CTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKALLVDPSVLKLFHYGRFDIGMFALHLGVDTSPVYCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL+G+++SKAQQSSDW A  L+ EQL YAASDV+HLHAL+ +    L R GRS LA 
Sbjct: 119 LSRELVGVDMSKAQQSSDWGAATLTPEQLAYAASDVLHLHALKDKLDAMLAREGRSALAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  R +LDL GWE+ DIF+HS
Sbjct: 179 ACFDFLPQRVKLDLAGWEDCDIFAHS 204


>gi|296282123|ref|ZP_06860121.1| 3'-5' exonuclease [Citromicrobium bathyomarinum JL354]
          Length = 205

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 143/206 (69%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ- 60
             +  HE D+P    A    A+AVDTET+GL+ RRDRLC+VQ+S G G   ++R      
Sbjct: 1   MAVYFHEEDLPEGVLAE--GAVAVDTETMGLITRRDRLCLVQISDGKGDEHLVRFGVDSS 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L D  R K++H+GRFD+A + Y  GV   PVFCTKIAS+LTRTYT++HGLK
Sbjct: 59  FDAPNLKAVLADPARTKLYHFGRFDLAAIEYWLGVTAAPVFCTKIASKLTRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             + ELLG +ISK QQSSDW A  ++D Q +YAASDV +LH LR  F E+L R GR+++A
Sbjct: 119 MLVSELLGEDISKQQQSSDWGAPKINDAQREYAASDVRYLHRLRDIFEERLAREGRTEIA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LD++GW + DIFSH
Sbjct: 179 QACFDFLPTRARLDIIGWPDTDIFSH 204


>gi|163757673|ref|ZP_02164762.1| putative ribonuclease [Hoeflea phototrophica DFL-43]
 gi|162285175|gb|EDQ35457.1| putative ribonuclease [Hoeflea phototrophica DFL-43]
          Length = 207

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 136/207 (65%), Positives = 163/207 (78%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR H+GDI  +  ARY   IAVDTETLGL+PRRDRLC+VQLSPGDG+ D+I+IA GQ
Sbjct: 1   MADIRAHKGDISDQAMARYTGDIAVDTETLGLVPRRDRLCVVQLSPGDGSADVIQIAKGQ 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K APNLV +L D KR K+FHYGRFDIAVL+  FGV   PVFCTKIASRLTRTYT++HGLK
Sbjct: 61  KRAPNLVALLTDRKRRKLFHYGRFDIAVLYNAFGVTTEPVFCTKIASRLTRTYTDRHGLK 120

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +ELL +++SK QQSSDW+A+ L+  QL+YAASDV+HLHAL  + TE+LQR  R   A
Sbjct: 121 DVTRELLEVDLSKQQQSSDWAAETLTPAQLEYAASDVLHLHALTAKLTERLQRDDREAHA 180

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDL+GWE  DIF+HS
Sbjct: 181 KACFEFLPTRAKLDLMGWEETDIFAHS 207


>gi|94495607|ref|ZP_01302187.1| ribonuclease D 3'-5' exonuclease [Sphingomonas sp. SKA58]
 gi|94424995|gb|EAT10016.1| ribonuclease D 3'-5' exonuclease [Sphingomonas sp. SKA58]
          Length = 205

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 140/206 (67%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
            T+  HE D+P    A     IAVDTET+GL+  RDRLC+VQ+S G G   ++R   G  
Sbjct: 1   MTVHFHEEDLPVGVLA--PGPIAVDTETMGLITPRDRLCVVQISDGKGDEHLVRFNPGSD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D +R K++H+GRFDIA L +  G+   PV+CTKIASRL RTYT++HGLK
Sbjct: 59  YAAPNLKAVLADPERLKLYHFGRFDIAALRHYLGIVAAPVYCTKIASRLVRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG +ISK QQSSDW    LSD Q  YAASDV  LH L+ +  ++L+R GR +LA
Sbjct: 119 ELVRELLGQDISKQQQSSDWGGPVLSDAQKDYAASDVRFLHQLKAELDKRLEREGRMELA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RAELDL GW   DIF+H
Sbjct: 179 QACFDFLPHRAELDLAGWPETDIFAH 204


>gi|254292595|ref|YP_003058618.1| 3'-5' exonuclease [Hirschia baltica ATCC 49814]
 gi|254041126|gb|ACT57921.1| 3'-5' exonuclease [Hirschia baltica ATCC 49814]
          Length = 204

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 140/206 (67%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I+ HEGD+P          +AVDTE +GL   RD+LC+VQLS G G   ++R+     
Sbjct: 1   MAIKYHEGDLPNGLKLGA--ILAVDTEAMGLEFHRDQLCVVQLSDGTGDEHVVRLDRKTF 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           + PNL  ++ D K  KIFH+ RFD+A++    G+   P+FCTKIAS+L RTYT++HGLKD
Sbjct: 59  DCPNLKALMSDTKVLKIFHFARFDVAMMKKWLGIECAPIFCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL+G ++SKAQQSSDW AD LS+ QL YAASDV++LH +R +    L+R GR +LA 
Sbjct: 119 VSRELVGADMSKAQQSSDWGADSLSEAQLAYAASDVLYLHEIREKLILMLEREGRMELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C +FL  RA+LDL GW   DIF+HS
Sbjct: 179 ACFDFLPKRADLDLAGWPETDIFAHS 204


>gi|294013112|ref|YP_003546572.1| ribonuclease D [Sphingobium japonicum UT26S]
 gi|292676442|dbj|BAI97960.1| ribonuclease D [Sphingobium japonicum UT26S]
          Length = 205

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 140/206 (67%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
            T+  HE D+P    A     IAVDTET+GL+  RDRLC+VQ+S G G   ++R   G  
Sbjct: 1   MTVHFHEEDLPLGVLA--PGPIAVDTETMGLITPRDRLCVVQISDGQGDEHLVRFNPGSD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL   L D  R K++H+GRFDIA + +  GV   PV+CTKIASRL RTYT++HGLK
Sbjct: 59  YAAPNLRAALADPARLKLYHFGRFDIAAIRHYLGVVAAPVYCTKIASRLVRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG  +SK QQSSDW    LSD Q +YAASDV +LHAL+ +  ++L R GR +LA
Sbjct: 119 ELVRELLGQELSKVQQSSDWGGPVLSDAQKEYAASDVRYLHALKAELDKRLAREGRMELA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RAELDL GW  +DIF+H
Sbjct: 179 QACFDFLPHRAELDLAGWPEIDIFAH 204


>gi|330993409|ref|ZP_08317344.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
 gi|329759439|gb|EGG75948.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
          Length = 215

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 106/205 (51%), Positives = 143/205 (69%), Gaps = 4/205 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I  H GD+PA+    +   +AVDTET+GL P RDRLC+VQLS GDG   ++++      A
Sbjct: 10  IHFHRGDLPADVT--FTGMVAVDTETMGLNPHRDRLCLVQLSAGDGQAHLVQVPPHATAA 67

Query: 64  --PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
             PNLV +L D +  KI H+ RFD+A+L +TF V V P  CTK+AS+L RTYT++HGL +
Sbjct: 68  GFPNLVRVLTDARVPKIMHFARFDVAILQHTFNVTVAPCICTKVASKLVRTYTDRHGLAN 127

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+ +SK QQSSDW A DL+ EQL YAASDV++LHAL  +    L R GR D+A 
Sbjct: 128 LCRELLGVELSKQQQSSDWGATDLTREQLCYAASDVLYLHALWERLEALLHREGRRDVAQ 187

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C +F+  RA LD+LG+++ DIF+H
Sbjct: 188 ACFDFMPARARLDILGYQDPDIFAH 212


>gi|58040278|ref|YP_192242.1| ribonuclease D [Gluconobacter oxydans 621H]
 gi|58002692|gb|AAW61586.1| Ribonuclease D [Gluconobacter oxydans 621H]
          Length = 214

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 98/208 (47%), Positives = 135/208 (64%), Gaps = 7/208 (3%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ--- 60
           I +++GD+P +        +A+DTET+GL P RDRLC+VQLS GDG   +++I       
Sbjct: 7   IHLYDGDLPDDFDLG--PLVAIDTETMGLNPHRDRLCLVQLSAGDGEAHLVQIKPVSMGG 64

Query: 61  --KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              + PNL  +L D+   K+ H+ RFD+AVL   F + +  V CTKIA+RL  T+T++HG
Sbjct: 65  RGYDCPNLKALLTDDSVTKLMHFARFDVAVLQNAFNITIPSVICTKIAARLVYTFTDRHG 124

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           L    ++LLG+ ISK QQSSDW A  L+ +QL+YAASDV++LHAL  +    L R  R D
Sbjct: 125 LAYLCRDLLGVEISKHQQSSDWGAQTLTPDQLRYAASDVLYLHALWDKLEAMLIRENRRD 184

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA +C +FL  R  LDL+G+E  DIFSH
Sbjct: 185 LAQACYDFLPARCRLDLMGYEEPDIFSH 212


>gi|110636308|ref|YP_676516.1| 3'-5' exonuclease [Mesorhizobium sp. BNC1]
 gi|110287292|gb|ABG65351.1| 3'-5' exonuclease [Chelativorans sp. BNC1]
          Length = 205

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 126/206 (61%), Positives = 161/206 (78%), Gaps = 1/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+ D+P   +   VDA+A+DTETLGL P RDRLC+VQLSPGDGT D+++IAAGQ+
Sbjct: 1   MTIRFHQYDLPD-LSRYDVDAVAIDTETLGLNPHRDRLCVVQLSPGDGTADVVQIAAGQR 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L + +  K+FHY RFDIAVL+++FGV   PVFCTKIASRLTRTYT++HGLKD
Sbjct: 60  RAPNLVALLRNRRITKLFHYARFDIAVLYHSFGVMPDPVFCTKIASRLTRTYTDRHGLKD 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL +N+SKAQQSSDW+A+ L+ EQL+YAASDV++LH L     ++L R GR+  A 
Sbjct: 120 ICYELLQVNLSKAQQSSDWAAEQLTPEQLEYAASDVLYLHRLADVLQQRLMRDGRAREAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA+LDL+GW+  DIF+HS
Sbjct: 180 ACFKFLPTRAKLDLMGWDEQDIFAHS 205


>gi|83950822|ref|ZP_00959555.1| exonuclease, putative [Roseovarius nubinhibens ISM]
 gi|83838721|gb|EAP78017.1| exonuclease, putative [Roseovarius nubinhibens ISM]
          Length = 203

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 146/206 (70%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT   V++GD+P +        +A+D ET+GL+P RDRLC+VQLS GDG   ++++A GQ
Sbjct: 1   MTN-TVYKGDLPDDLDLG--PIVAIDCETMGLLPHRDRLCVVQLSGGDGHAHLVQVAKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           + APNLV +L +    K+FH+GRFDIA +   FG    PV+CTKIAS+L RTYT++HGL+
Sbjct: 58  RTAPNLVRLLENPDVLKLFHFGRFDIAAMLNAFGAVAAPVYCTKIASKLVRTYTDRHGLR 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + L++LLG++ISK QQSSDW   +LS  Q+ YAASDV++LH LR     +L R  R ++A
Sbjct: 118 NLLQDLLGVDISKHQQSSDWGRAELSTAQIDYAASDVLYLHRLREALNVRLLREERMEMA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LDL GW + D+F+H
Sbjct: 178 QACFDFLPMRAQLDLAGWPDDDLFAH 203


>gi|56417079|ref|YP_154153.1| ribonuclease D [Anaplasma marginale str. St. Maries]
 gi|222475445|ref|YP_002563862.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
 gi|254995250|ref|ZP_05277440.1| ribonuclease D (rnd) [Anaplasma marginale str. Mississippi]
 gi|255003431|ref|ZP_05278395.1| ribonuclease D (rnd) [Anaplasma marginale str. Puerto Rico]
 gi|255004550|ref|ZP_05279351.1| ribonuclease D (rnd) [Anaplasma marginale str. Virginia]
 gi|56388311|gb|AAV86898.1| ribonuclease D [Anaplasma marginale str. St. Maries]
 gi|222419583|gb|ACM49606.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
          Length = 204

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 105/205 (51%), Positives = 141/205 (68%), Gaps = 3/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             + VH  D+P          +AVDTET+GL+ RRDR+C+VQLS GDG   +++ + G  
Sbjct: 1   MAVFVHNNDLPDGLDLGN--VVAVDTETMGLVCRRDRVCLVQLSSGDGDAHLVKFS-GDY 57

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  ++ + +  KIFH+ RFD+A + + FG+   P +CTKIASRL RTYTN HGLKD
Sbjct: 58  SAPNLRRIVSNPEIMKIFHFARFDVAAIRHCFGMWAVPCYCTKIASRLVRTYTNHHGLKD 117

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELLG+ I+KAQQSSDW  + L+ EQL YAA+DV++LH ++ +    L+R  + DLA 
Sbjct: 118 LCYELLGVKINKAQQSSDWGREVLTSEQLSYAAADVIYLHDIKKKLDMMLEREDKQDLAE 177

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           SC  F+  RAELDLLGW+ VDIFSH
Sbjct: 178 SCFKFIPARAELDLLGWDGVDIFSH 202


>gi|84514850|ref|ZP_01002213.1| exonuclease, putative [Loktanella vestfoldensis SKA53]
 gi|84511009|gb|EAQ07463.1| exonuclease, putative [Loktanella vestfoldensis SKA53]
          Length = 203

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 137/206 (66%), Gaps = 3/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    ++  D+P          +A+D ET+GL P RDRLC++Q+S GDG   +++++ GQ
Sbjct: 1   MANF-LYHNDLPDGLNLG--PVVAIDCETMGLNPHRDRLCLIQMSGGDGDCHLVQVSKGQ 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  ML D    K+FH+GRFDIA L   FGV   PV+CTKIAS+L RTYT++HGLK
Sbjct: 58  AGAPNLCAMLTDPAVLKLFHFGRFDIAALLNAFGVVTAPVYCTKIASKLVRTYTDRHGLK 117

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             L+++LGI+ISK QQ SDW A  L+  QL YAASDV++LH L+  F   LQR  R+ +A
Sbjct: 118 VLLQDMLGIDISKHQQQSDWGAPKLTPAQLDYAASDVLYLHQLKAAFDVLLQREDRTAVA 177

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LDL GW   DIF+H
Sbjct: 178 KACFDFLPTRAALDLHGWPETDIFTH 203


>gi|269958513|ref|YP_003328300.1| 3'-5' exonuclease [Anaplasma centrale str. Israel]
 gi|269848342|gb|ACZ48986.1| 3'-5' exonuclease [Anaplasma centrale str. Israel]
          Length = 204

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 105/205 (51%), Positives = 140/205 (68%), Gaps = 3/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             + VH  D+P          +AVDTET+GL+ RRDR+C+VQLS GDG   +++ + G  
Sbjct: 1   MAVFVHNNDLPDGLDLGN--VVAVDTETMGLVCRRDRVCLVQLSSGDGDAHLVKFS-GDY 57

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  ++ +    KIFH+ RFD+A + + FG+   P +CTKIASRL RTYTN HGLKD
Sbjct: 58  SAPNLRRIVSNPDIMKIFHFARFDVAAIRHCFGMWATPCYCTKIASRLVRTYTNHHGLKD 117

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELLG+ I+KAQQSSDW  + L+ EQL YAA+DV++LH ++ +    L+R  + DLA 
Sbjct: 118 LCYELLGVKINKAQQSSDWGREVLTSEQLSYAAADVIYLHDIKKKLDMMLEREDKQDLAE 177

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           SC  F+  RAELDLLGW+ VDIFSH
Sbjct: 178 SCFKFIPARAELDLLGWDGVDIFSH 202


>gi|315122172|ref|YP_004062661.1| ribonuclease D [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495574|gb|ADR52173.1| ribonuclease D [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 209

 Score =  184 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 166/206 (80%), Positives = 183/206 (88%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MTTIRVH GDIP EC ARY   IAVDTETLGL+PRRDRLC+VQLSPGDGT DIIRIAA Q
Sbjct: 1   MTTIRVHNGDIPTECIARYTGPIAVDTETLGLIPRRDRLCVVQLSPGDGTADIIRIAAEQ 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           KNAPNLV ML +E +EKIFHY RFDIAVLFYTFGVRV+P+FCTKIASRLTRTY ++HGLK
Sbjct: 61  KNAPNLVTMLANETQEKIFHYARFDIAVLFYTFGVRVKPIFCTKIASRLTRTYIDRHGLK 120

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           DNL+ELLG++ISK QQ SDWS DDLS EQLQYAASDVVHLHALR +F  KLQ LGRSD+A
Sbjct: 121 DNLRELLGVDISKKQQLSDWSEDDLSHEQLQYAASDVVHLHALREKFIAKLQSLGRSDVA 180

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
           ++C NFLM RAELDLLGW+N+DIFSH
Sbjct: 181 SACFNFLMSRAELDLLGWDNIDIFSH 206


>gi|83313031|ref|YP_423295.1| ribonuclease D [Magnetospirillum magneticum AMB-1]
 gi|82947872|dbj|BAE52736.1| Ribonuclease D [Magnetospirillum magneticum AMB-1]
          Length = 203

 Score =  184 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 106/205 (51%), Positives = 136/205 (66%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+  H+ D+P          +A+D+ET+GL  +RDRLC+VQLS GDG   ++     + 
Sbjct: 1   MTVFYHKNDLPDGLDLGN--LVAIDSETMGLNLQRDRLCVVQLSAGDGHAHVVHYPKPEW 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           N+PNLV ML D K  K+FH+ RFD+A++    GVR  PVFCTKIAS+LTRT T  H LK 
Sbjct: 59  NSPNLVRMLADSKVTKLFHFARFDVAMIRRYLGVRCTPVFCTKIASKLTRTNTEGHSLKV 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             KE L I++SK QQSSDW A +L+ +QL YAASDV++LH L+ +    L R GR  LA 
Sbjct: 119 LCKEFLNIDLSKLQQSSDWGAPELTADQLAYAASDVLYLHQLKDRLDALLDREGRRALAE 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C  FL DRAELDL GW+  DIFSH
Sbjct: 179 ACFAFLPDRAELDLAGWDAEDIFSH 203


>gi|304320833|ref|YP_003854476.1| hypothetical protein PB2503_06342 [Parvularcula bermudensis
           HTCC2503]
 gi|303299735|gb|ADM09334.1| hypothetical protein PB2503_06342 [Parvularcula bermudensis
           HTCC2503]
          Length = 204

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I +H  D+PA+   R+  A+AVD+ETLGL P RDRLC+VQLS GDG   ++   AG  
Sbjct: 1   MAIHLHRNDLPADI--RFDGAVAVDSETLGLNPLRDRLCVVQLSAGDGDAHLVTFDAGAY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +AP+L  +L D +  KIFH+ RFD+AV  +  GV   P++CTKIAS+L RTYT++HGLKD
Sbjct: 59  DAPHLKAVLSDPQLLKIFHFARFDVAVFKHWLGVDTTPIYCTKIASKLARTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++E+ G+ +SK QQSSDW+A +L++ Q  YAASDV+HLHA+R      + R GR  L T
Sbjct: 119 VVREMTGVELSKQQQSSDWAAAELTEAQRAYAASDVLHLHAVREGLDRMIDREGRRALLT 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +   FL  RA LDL GW   DIF+HS
Sbjct: 179 AAFAFLPTRAALDLAGWSETDIFAHS 204


>gi|227824096|ref|YP_002828069.1| 3'-5' exonuclease [Sinorhizobium fredii NGR234]
 gi|227343098|gb|ACP27316.1| 3'-5' exonuclease [Sinorhizobium fredii NGR234]
          Length = 208

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 151/206 (73%), Positives = 171/206 (83%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR HEGDI A  AARY  AIA+DTETLGL+PRRDRLC+VQLSPGDGT D+IRIAAGQK
Sbjct: 3   NTIRFHEGDISAADAARYAGAIAIDTETLGLVPRRDRLCVVQLSPGDGTADVIRIAAGQK 62

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV ML D  R+KIFH+GRFDIAVLF+TFGV   PVFCTKIASRLTRTYT++HGLKD
Sbjct: 63  EAPNLVRMLADPARQKIFHFGRFDIAVLFHTFGVTSTPVFCTKIASRLTRTYTDRHGLKD 122

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
           NLKELL ++ISK QQSSDW+AD LS  QL+YAASDV+HLHALR + T +L R GR + A 
Sbjct: 123 NLKELLDVDISKQQQSSDWAADILSPAQLEYAASDVLHLHALRDKLTARLIRDGRMEHAD 182

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA+LDLLGWE  DIF+HS
Sbjct: 183 ACFAFLPTRAKLDLLGWEETDIFAHS 208


>gi|114327365|ref|YP_744522.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
 gi|114315539|gb|ABI61599.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
          Length = 259

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 96/209 (45%), Positives = 132/209 (63%), Gaps = 7/209 (3%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK- 61
           TI +H  D+P          IA+DTET+GL   RDRLC++Q+S GDG   +++I   +  
Sbjct: 53  TIHLHRHDLPPSLDIG--PIIAIDTETMGLNHHRDRLCLIQISAGDGHAHLVQIVPERLG 110

Query: 62  ----NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               + PNL  +L +    K+ HY RFD+ +L    G+ +  V CTKIA++L RT+T++H
Sbjct: 111 GKGADCPNLKRLLSNPGCVKLMHYARFDVGILQNALGIAMSNVKCTKIAAKLVRTFTDRH 170

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           GLKD  ++LLG+ ISK QQSSDW A +L+ EQ+ YAASDV++LHAL  +    L R  R 
Sbjct: 171 GLKDLCRDLLGVEISKQQQSSDWGAPELTPEQMAYAASDVLYLHALWNRLEGLLIREDRL 230

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA +C  FL  RA LD LG++  DIFSH
Sbjct: 231 ALAEACFAFLPARARLDYLGYDEPDIFSH 259


>gi|328545553|ref|YP_004305662.1| 3'-5' exonuclease [polymorphum gilvum SL003B-26A1]
 gi|326415294|gb|ADZ72357.1| 3'-5' exonuclease, putative [Polymorphum gilvum SL003B-26A1]
          Length = 206

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 122/206 (59%), Positives = 155/206 (75%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+ D+P   A     A+AVDTETLGL P RDRLC+VQLSPGDGT D+++IA GQ+
Sbjct: 1   MTIRHHKTDLPDLSAYDAAQAVAVDTETLGLNPHRDRLCVVQLSPGDGTADVVQIARGQR 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  + KIFH+ RFD+AVL +  G+ V PV+CTKIAS+L RTYT++HGLKD
Sbjct: 61  AAPNLARLLTDPAKMKIFHFARFDLAVLRHNLGIEVAPVWCTKIASKLVRTYTDRHGLKD 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+++SK QQSSDW+A+ L+D QL YAASDV+HLHALR +    L+R  R+ LA 
Sbjct: 121 ITRELLGVDLSKQQQSSDWAAETLTDAQLAYAASDVLHLHALREKLAAMLEREERTALAR 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +C  FL  RA LDL+GWE  DIF+H+
Sbjct: 181 ACYEFLPTRAALDLMGWEEQDIFAHT 206


>gi|295691424|ref|YP_003595117.1| 3'-5' exonuclease [Caulobacter segnis ATCC 21756]
 gi|295433327|gb|ADG12499.1| 3'-5' exonuclease [Caulobacter segnis ATCC 21756]
          Length = 205

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 109/207 (52%), Positives = 141/207 (68%), Gaps = 2/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    VHEGD+P    A     IA+D+ET+GL   RD LC+VQLS GDG   ++R++   
Sbjct: 1   MANF-VHEGDLPDGVFAG-ASIIAIDSETMGLRLGRDPLCVVQLSSGDGDAHVVRLSRPD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            + PNL  +L D    K+FH+GRFDIA+     GV   PV+CTKIAS+L RTYT++HGLK
Sbjct: 59  YDCPNLKALLTDPAILKLFHFGRFDIAMFQLHLGVVTAPVYCTKIASKLARTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +ELLG+ +SKAQQSSDW +  LS +Q+ YAASDV+HLH LR +    L+R GR  LA
Sbjct: 119 DVTRELLGVELSKAQQSSDWGSASLSADQVAYAASDVLHLHGLRQKLNAMLEREGRMALA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +  ++L  RA LDL GWE+VDIF+HS
Sbjct: 179 QAAFDYLPHRASLDLAGWEDVDIFAHS 205


>gi|167648909|ref|YP_001686572.1| 3'-5' exonuclease [Caulobacter sp. K31]
 gi|167351339|gb|ABZ74074.1| 3'-5' exonuclease [Caulobacter sp. K31]
          Length = 205

 Score =  184 bits (466), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 111/207 (53%), Positives = 141/207 (68%), Gaps = 2/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +HEGD+P    A    AIA+D+ET+GL   RD LC+VQLS GDG   ++R+    
Sbjct: 1   MANF-LHEGDLPDGVFAGAA-AIAIDSETMGLRLGRDPLCVVQLSSGDGDAHVVRLDRAT 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L D    K+FH+GRFDIA+     GV   PV+CTKIAS+L RTYT++HGLK
Sbjct: 59  YDAPNLKRLLTDPSVVKLFHFGRFDIAMFLLHLGVMTAPVYCTKIASKLARTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +EL+G+ +SK QQSSDW A  LS EQL YAASDV+HLHALR +    L R GR  LA
Sbjct: 119 DVTRELVGVELSKVQQSSDWGAATLSPEQLAYAASDVLHLHALRERLNAMLVREGRMQLA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +  ++L  RA LDL GWE+VDIF+H+
Sbjct: 179 QAAFDYLPHRAALDLAGWEDVDIFAHT 205


>gi|91205563|ref|YP_537918.1| ribonuclease D [Rickettsia bellii RML369-C]
 gi|157827279|ref|YP_001496343.1| ribonuclease D [Rickettsia bellii OSU 85-389]
 gi|91069107|gb|ABE04829.1| Ribonuclease D [Rickettsia bellii RML369-C]
 gi|157802583|gb|ABV79306.1| Ribonuclease D [Rickettsia bellii OSU 85-389]
          Length = 203

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 98/205 (47%), Positives = 135/205 (65%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI +++ D+P +        +A+DTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MTITLYQNDLPDDFELE--GDLAIDTETMGLNLYRDKLCLLQFSNGNGDAHLVHFLNQNY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           NAPNL  +L D++R KIFH+ RFD+A +    G+ +  +FCTKI+S+L RTYT  HGLKD
Sbjct: 59  NAPNLKNLLSDKERCKIFHFARFDLAAIKKYLGIDLENIFCTKISSKLVRTYTESHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+NISK QQSS W AD+LS +Q +YAA DV++LH LR    E L +  R +LA 
Sbjct: 119 ICRELLGVNISKQQQSSYWGADNLSSDQQEYAAKDVLYLHKLREHLIEMLVKENRFELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  RA LDL+GW+ VDIF+H
Sbjct: 179 DIFKFLPTRANLDLVGWDEVDIFTH 203


>gi|294084811|ref|YP_003551571.1| 3'- 5' exonuclease family protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664386|gb|ADE39487.1| 3'- 5' exonuclease family protein, putative [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 203

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 97/205 (47%), Positives = 140/205 (68%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             + +++ D+PA+        +A+DTET+GL  +RDRLC+VQLS GDG   +++IA   K
Sbjct: 1   MAVNIYKDDLPADIDLG--SIVAIDTETMGLKTQRDRLCLVQLSSGDGNAHLVQIAQPAK 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            +P L  +L D    K+FH+ RFD+A L +  G     ++CTKIAS+L RTYT++HGLK+
Sbjct: 59  PSPVLAALLADPAVTKLFHFARFDLAALIHYIGAVEGDIYCTKIASKLARTYTDRHGLKE 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL I+ISK QQSSDW A+ L+ +Q  YAA DV++LHA+R + +  L+R  R  LA 
Sbjct: 119 LCRELLQIDISKQQQSSDWGAETLTIDQQNYAAGDVLYLHAIREKLSYMLERENRMALAN 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C  FL +RA+LDL+G+ +VDIF H
Sbjct: 179 ACFGFLPERAQLDLIGFGDVDIFHH 203


>gi|209542515|ref|YP_002274744.1| 3'-5' exonuclease [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530192|gb|ACI50129.1| 3'-5' exonuclease [Gluconacetobacter diazotrophicus PAl 5]
          Length = 210

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 103/203 (50%), Positives = 141/203 (69%), Gaps = 3/203 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +H GD+  +    +  +IAVDTE +GL P RDRLC+VQ+S GDG+  +++I  G   +
Sbjct: 9   ILLHRGDLADDVV--FHGSIAVDTEAMGLNPHRDRLCLVQISAGDGSAHLVQILPGTP-S 65

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  ++ D    K+ H+ RFD+A+L ++ GV V PV CTKIAS+L RT+T +HGL    
Sbjct: 66  PNLARLMADPSITKLMHFARFDVAILQHSLGVTVAPVICTKIASKLVRTFTERHGLAQLC 125

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +ELLG+++SK QQ+SDW A +L+ EQ  YAASDV+HLHAL  +    L R GR DLA +C
Sbjct: 126 RELLGVDLSKQQQTSDWGAPELTPEQKAYAASDVLHLHALWTKLEALLHREGRRDLAQAC 185

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
            +FL  RA LDLLG+E+ DIF+H
Sbjct: 186 YDFLPTRARLDLLGYEDPDIFAH 208


>gi|326388611|ref|ZP_08210204.1| 3'-5' exonuclease [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206862|gb|EGD57686.1| 3'-5' exonuclease [Novosphingobium nitrogenifigens DSM 19370]
          Length = 205

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 106/206 (51%), Positives = 142/206 (68%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ- 60
             + +HE D+PA+  A     +AVDTET+GL+  RDRLC+VQ+S G G   ++R A G  
Sbjct: 1   MAVYLHEEDLPADVLA--PGIVAVDTETMGLVTTRDRLCVVQISDGKGDEHLVRFAPGST 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L D +R K+FH+ RFD+A + Y  GV   PVFCTKIAS+L RTYT++HGLK
Sbjct: 59  YDAPNLKAVLADPERLKLFHFARFDLAAIHYYLGVMATPVFCTKIASKLVRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++EL G  ISK QQSSDW   +LSD QL+YAASDV +LH       ++L R GR+++A
Sbjct: 119 ELVRELAGKEISKQQQSSDWGGANLSDAQLEYAASDVRYLHTCHAVLVDRLAREGRAEIA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LD+ GW + DIFSH
Sbjct: 179 QACFDFLPTRALLDIAGWADRDIFSH 204


>gi|239787681|emb|CAX84189.1| 3\'-5\' exonuclease family protein [uncultured bacterium]
          Length = 202

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 112/206 (54%), Positives = 139/206 (67%), Gaps = 4/206 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    +H GD+P          IA+DTET+GL P RDRLC+VQLS GDG   ++    G+
Sbjct: 1   MANY-LHHGDLPEGLDLG--PVIAIDTETMGLNPMRDRLCLVQLSSGDGDAHLVHF-QGR 56

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             AP L  +L D  R K+FHY RFDIA+L    GV   PV+CTKIASRLTRT T++HGLK
Sbjct: 57  YEAPRLKALLADHNRLKLFHYARFDIAMLARWLGVTCTPVYCTKIASRLTRTNTDKHGLK 116

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  ++LLGI++SK QQ+SDW + DL+ EQ  YAASDV+HLHAL+ +    L+R GR  LA
Sbjct: 117 DLCRDLLGIDLSKQQQTSDWGSGDLTAEQQAYAASDVLHLHALKAKLDALLKREGRGALA 176

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            SC +FL  RA LDLLGW   DIF+H
Sbjct: 177 DSCYSFLPTRAALDLLGWGEEDIFAH 202


>gi|241760851|ref|ZP_04758940.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753179|ref|YP_003226072.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283856222|ref|YP_162013.2| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374470|gb|EER63931.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552542|gb|ACV75488.1| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283775217|gb|AAV88902.2| 3'-5' exonuclease [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 209

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 105/206 (50%), Positives = 140/206 (67%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
            T+  HE D+P +       A+AVDTET+GL+  RDRLC+VQ+S G G   ++R A    
Sbjct: 5   MTVYFHEEDLPKDAL--SEGAVAVDTETMGLITHRDRLCVVQISDGKGDQHLVRFAPDSD 62

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L D  R KI+H+GRFDIA + Y  GV   PV+CTKIAS+L RTYT++HGLK
Sbjct: 63  YSAPNLKAVLSDPNRLKIYHFGRFDIAAILYYLGVMAAPVYCTKIASKLVRTYTDRHGLK 122

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG +ISK QQ SDW  + LSD Q +YAASDV  LH L+ +   +L+R  R +LA
Sbjct: 123 ELVRELLGQDISKQQQCSDWGGEKLSDAQREYAASDVRFLHGLKEKLDIRLKREKREELA 182

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA+LD+ GW   DIF+H
Sbjct: 183 QACFDFLPTRAKLDIAGWSETDIFAH 208


>gi|85375259|ref|YP_459321.1| ribonuclease D 3'-5' exonuclease [Erythrobacter litoralis HTCC2594]
 gi|84788342|gb|ABC64524.1| ribonuclease D 3'-5' exonuclease [Erythrobacter litoralis HTCC2594]
          Length = 206

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 106/207 (51%), Positives = 140/207 (67%), Gaps = 2/207 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
             +  HE D+PA   A     +AVDTET+GL+ RRDRLCIVQ+S G     ++R A    
Sbjct: 1   MAVHFHEEDLPAGVLAGDAP-LAVDTETMGLVTRRDRLCIVQISDGGEDEHLVRFAPDSD 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D  R K++H+ RFD+A + +  GV   PVFCTKIAS+LTRTYT++HGLK
Sbjct: 60  YAAPNLKALLADTNRVKLYHFARFDLAAIEHYLGVTAAPVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG N+SK QQSSDW   D+++ Q  YAASDV +LH +R     +L+R GR+++A
Sbjct: 120 NLVEELLGENLSKQQQSSDWGGADINEAQRDYAASDVRYLHRMREILITRLEREGRTEMA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LDL GWE  DIF HS
Sbjct: 180 QACFDFLPTRARLDLAGWEEHDIFHHS 206


>gi|163794941|ref|ZP_02188910.1| hypothetical protein BAL199_08698 [alpha proteobacterium BAL199]
 gi|159179760|gb|EDP64287.1| hypothetical protein BAL199_08698 [alpha proteobacterium BAL199]
          Length = 203

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 106/205 (51%), Positives = 143/205 (69%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+ +H GD+P          +A+D+ET+GL P RDRLC+VQ S GDGT  +++ A G+ 
Sbjct: 1   MTVTLHHGDLPDGLDLG--SVVAIDSETMGLRPIRDRLCVVQFSSGDGTAHLVQFAPGEY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  ML D    K+FH+ RFD+AVL    GV   P++CTKIAS+L RTYT++HGLKD
Sbjct: 59  DAPNLTRMLTDPDVLKLFHFARFDVAVLQAFLGVATAPIYCTKIASKLVRTYTDRHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +EL+G+++SK QQSSDW A +L+ EQL YAASDV+HLHAL+ +    L R GR+ +A 
Sbjct: 119 LCRELIGVDLSKQQQSSDWGAAELTAEQLAYAASDVLHLHALKDRLDIMLAREGRTGIAA 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  RA LDL+G+ + DIF+H
Sbjct: 179 DCFRFLGTRAALDLIGYADEDIFAH 203


>gi|83591355|ref|YP_425107.1| 3'-5' exonuclease [Rhodospirillum rubrum ATCC 11170]
 gi|83574269|gb|ABC20820.1| 3'-5' exonuclease [Rhodospirillum rubrum ATCC 11170]
          Length = 206

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 108/204 (52%), Positives = 134/204 (65%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI  H GD+P+     +   IAVDTET+GL P RDRLC+VQLS GD    ++ +      
Sbjct: 6   TIHYHRGDLPSGLT--FPQGIAVDTETMGLNPHRDRLCVVQLSGGDNIAHVVHLNRD-LQ 62

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           AP L  +L D    KI H+GRFDIA + +  GV   PV+CTKIAS+L RT T+ HGLK  
Sbjct: 63  APVLASLLGDPSVLKIMHFGRFDIASIHHGLGVLCEPVYCTKIASKLCRTNTDSHGLKAL 122

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            K+LLG+++SK QQ+SDW A+ LS EQL YAASDV++LHAL+ +    L R GR+ LA  
Sbjct: 123 CKDLLGVDLSKHQQTSDWGAESLSPEQLTYAASDVLYLHALKARLDGLLAREGRTTLAEG 182

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  RA LDL GWE  DIFSH
Sbjct: 183 CFRFLPTRALLDLAGWEEPDIFSH 206


>gi|46201483|ref|ZP_00054962.2| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 203

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 105/205 (51%), Positives = 136/205 (66%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            T+  H+ D+P          +A+D+ET+GL  +RDRLC+VQLS GDG   ++     + 
Sbjct: 1   MTVFYHKNDLPDGLDLGN--LVAIDSETMGLNLQRDRLCVVQLSAGDGHAHVVHYPKPEW 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           N+PNLV ML D K  K+FH+ RFD+A++    GVR  P+FCTKIAS+LTRT T  H LK 
Sbjct: 59  NSPNLVRMLADPKVTKLFHFARFDVAMIRKYLGVRCNPLFCTKIASKLTRTNTEGHSLKV 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             KE L I++SK QQSSDW A +L+ +QL YAASDV++LH L+ +    L R GR  LA 
Sbjct: 119 LCKEFLNIDLSKLQQSSDWGAPELNADQLAYAASDVLYLHQLKDRLDMLLDREGRRALAE 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C  FL DRAELDL GW+  DIFSH
Sbjct: 179 ACFAFLPDRAELDLAGWDAEDIFSH 203


>gi|162147898|ref|YP_001602359.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786475|emb|CAP56057.1| putative ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
          Length = 210

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 103/203 (50%), Positives = 141/203 (69%), Gaps = 3/203 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           I +H GD+  +    +  +IAVDTE +GL P RDRLC+VQ+S GDG+  +++I  G   +
Sbjct: 9   ILLHRGDLADDVV--FHGSIAVDTEAMGLNPHRDRLCLVQISAGDGSAHLVQILPGTP-S 65

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  ++ D    K+ H+ RFD+A+L ++ GV V PV CTKIAS+L RT+T +HGL    
Sbjct: 66  PNLARLMADPSITKLMHFARFDVAILQHSLGVTVAPVICTKIASKLVRTFTERHGLAQLC 125

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +ELLG+++SK QQ+SDW A +L+ EQ  YAASDV+HLHAL  +    L R GR DLA +C
Sbjct: 126 RELLGVDLSKQQQTSDWGAPELTPEQKAYAASDVLHLHALWTKLEVLLHREGRRDLAQAC 185

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
            +FL  RA LDLLG+E+ DIF+H
Sbjct: 186 YDFLPTRARLDLLGYEDPDIFAH 208


>gi|88608093|ref|YP_506413.1| 3'-5' exonuclease family protein [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600262|gb|ABD45730.1| 3'-5' exonuclease family protein [Neorickettsia sennetsu str.
           Miyayama]
          Length = 206

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 143/206 (69%), Gaps = 2/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    ++EGD+PA+ A    DAIA+DTE++GL+ RRDRLC+VQLS GDGT  ++R     
Sbjct: 1   MNKYYIYEGDVPADFA--PSDAIAIDTESMGLVNRRDRLCLVQLSTGDGTAHLVRFNGTD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +AP L  +LVD    KIFH+ RFDIA+L +  GV     +CTKIASRL RTYT+ H LK
Sbjct: 59  YSAPRLKSLLVDPAVIKIFHFARFDIAILRHYLGVLTENCYCTKIASRLVRTYTDHHSLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   +LLG+ ++K +QSSDW +  L+ EQ+ YAASDV++LHA++      L+R  R +LA
Sbjct: 119 ELCLDLLGVRLNKGKQSSDWGSTSLTREQMSYAASDVLYLHAIKEALDVMLKREKRIELA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RAELDLLGWEN DIFSH
Sbjct: 179 RACFQFLPYRAELDLLGWENQDIFSH 204


>gi|149185091|ref|ZP_01863408.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. SD-21]
 gi|148831202|gb|EDL49636.1| ribonuclease D 3'-5' exonuclease [Erythrobacter sp. SD-21]
          Length = 207

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 100/207 (48%), Positives = 143/207 (69%), Gaps = 3/207 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-Q 60
             +  HE D+P +  A     +AVDTET+GL+  RDRLC+VQ+S G+G   ++R      
Sbjct: 1   MAVHFHEEDLPEDVLAD--GPVAVDTETMGLVTIRDRLCVVQISDGNGDEHLVRFGPDSD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L D +R K+FH+ RFD+A + Y  GV   P +CTKIAS++ RT+T++HGLK
Sbjct: 59  YDAPNLKAVLGDPERLKLFHFARFDLAAIEYYLGVTAAPCYCTKIASKMVRTFTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           + ++ELLG ++SKAQQSSDW    L+D Q  YAASDV  LH ++ +   +L+R GR++LA
Sbjct: 119 NLVEELLGESMSKAQQSSDWGGPVLNDAQRDYAASDVRFLHRMKEELDRRLEREGRTELA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C +FL  RA LD+LGW++ DIFSH+
Sbjct: 179 QACFDFLPARAHLDILGWDDHDIFSHA 205


>gi|220925751|ref|YP_002501053.1| 3'-5' exonuclease [Methylobacterium nodulans ORS 2060]
 gi|219950358|gb|ACL60750.1| 3'-5' exonuclease [Methylobacterium nodulans ORS 2060]
          Length = 204

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 113/203 (55%), Positives = 142/203 (69%), Gaps = 2/203 (0%)

Query: 5   RVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           R+H GD+P +       AIAVDTETLGL P RDRLC+VQ+S GDG  D+++I        
Sbjct: 4   RLHCGDLPDDYV--PGPAIAVDTETLGLEPHRDRLCVVQISHGDGEADVVQIPKIGPEPV 61

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +L D    KIFHY RFD+AVL++  GV   PV+CTK+ASRL RTYT++HGLKD ++
Sbjct: 62  VLKRVLTDPAVTKIFHYARFDLAVLYHRLGVMPGPVYCTKVASRLARTYTDRHGLKDLVR 121

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           ELLG+ +SK QQSSDW AD L+  Q+ YAASDV+HLHALR +    L R  R+D+A +C 
Sbjct: 122 ELLGVELSKQQQSSDWGADTLTPAQIDYAASDVLHLHALRAKLDAMLAREERTDMAEACF 181

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
            FL  RA LDLLGW+ VDI +HS
Sbjct: 182 AFLPTRARLDLLGWDEVDILAHS 204


>gi|254796888|ref|YP_003081725.1| ribonuclease D [Neorickettsia risticii str. Illinois]
 gi|254590124|gb|ACT69486.1| ribonuclease D [Neorickettsia risticii str. Illinois]
          Length = 216

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 107/205 (52%), Positives = 141/205 (68%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
               ++EGD+PA+      DAIAVDTE++GL+ RRDRLC+VQLS GDGT  ++R      
Sbjct: 12  NKYYIYEGDVPADFPLS--DAIAVDTESMGLVNRRDRLCLVQLSTGDGTAHLVRFNGTDY 69

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +AP L  ++VD    KIFH+ RFDIA+L +  GV     +CTKIASRL RTYT+ H LK+
Sbjct: 70  SAPRLKSLIVDPAVIKIFHFARFDIAILRHYLGVLTENCYCTKIASRLVRTYTDHHSLKE 129

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              +LLG+ ++K +QSSDW +  L+ EQ+ YAASDV++LHA++      L+R  R +LA 
Sbjct: 130 LCSDLLGVRLNKGKQSSDWGSASLTREQMSYAASDVLYLHAIKEALDVMLKREKRIELAQ 189

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C  FL  RAELDLLGWEN DIFSH
Sbjct: 190 ACFQFLPYRAELDLLGWENQDIFSH 214


>gi|296115075|ref|ZP_06833717.1| 3'-5' exonuclease [Gluconacetobacter hansenii ATCC 23769]
 gi|295978412|gb|EFG85148.1| 3'-5' exonuclease [Gluconacetobacter hansenii ATCC 23769]
          Length = 215

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 139/206 (67%), Gaps = 4/206 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           TI  H GD+P +    +  A+AVDTET+GL P RDRLC+VQLS GDG   ++++ AG   
Sbjct: 9   TIHFHRGDLPHDVV--FSGAVAVDTETMGLNPHRDRLCLVQLSDGDGHAHLVQVPAGATA 66

Query: 63  APNLVGML--VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           A     +    D    K+ H+ RFD+A+L YTFG+ V P  CTKIAS+L RTYT +HGL 
Sbjct: 67  ADFPNMLAVLTDPSVTKLMHFARFDVAILQYTFGITVAPCICTKIASKLVRTYTERHGLA 126

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
              +ELLG+ +SK QQSSDW A DL+ EQ+ YAASDV++LHAL  +    L R GR +LA
Sbjct: 127 HLCRELLGVELSKQQQSSDWGAPDLTPEQMTYAASDVLYLHALWARLEALLVREGRRELA 186

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +F+  RA LD+LG+E+ D+F+H
Sbjct: 187 QACYDFMPTRARLDILGYEDPDLFAH 212


>gi|312114054|ref|YP_004011650.1| 3'-5' exonuclease [Rhodomicrobium vannielii ATCC 17100]
 gi|311219183|gb|ADP70551.1| 3'-5' exonuclease [Rhodomicrobium vannielii ATCC 17100]
          Length = 204

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 144/206 (69%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI VH  D+P +    +  ++A+DTETLGL P RDRLC+VQLS GDG   +++   G  
Sbjct: 1   MTITVHLNDLPPDID--FGASVAIDTETLGLKPHRDRLCVVQLSAGDGNAHLVQFEKGHY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +LV+    KIFH+GRFDIAV+    GV+  PV+CTKIA++L RT+T +HGLKD
Sbjct: 59  DAPNLTALLVNPAVLKIFHFGRFDIAVMQQYLGVKTGPVYCTKIAAKLVRTFTERHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG+ +SK QQ+SDW    L+ EQL YAASDV+HLHAL+ +    L R GR++LA 
Sbjct: 119 LCRELLGVELSKQQQTSDWGQAKLTPEQLSYAASDVLHLHALKEKLDALLAREGRTELAA 178

Query: 182 SCCNFLMDRAELDLLGWENV-DIFSH 206
           +C  FL  RAELDL GW +  D+F+H
Sbjct: 179 ACFGFLPYRAELDLKGWHDDADVFNH 204


>gi|87201263|ref|YP_498520.1| 3'-5' exonuclease [Novosphingobium aromaticivorans DSM 12444]
 gi|87136944|gb|ABD27686.1| 3'-5' exonuclease [Novosphingobium aromaticivorans DSM 12444]
          Length = 205

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 108/206 (52%), Positives = 141/206 (68%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ- 60
             + +HE D+P    A    A+AVDTET+GL+  RDRLC+VQ+S G G   ++R + G  
Sbjct: 1   MAVFLHEEDLPEGALA--PGAVAVDTETMGLITPRDRLCVVQISDGRGDEHLVRFSPGSA 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNL  +L D +R K++H+ RFD+A + +  GV   PVFCTKIAS+L RTYT++HGLK
Sbjct: 59  FAAPNLKAVLADPERLKLYHFARFDLAAIEHYLGVVAAPVFCTKIASKLVRTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D ++ELLG  ISK QQSSDW A  L+D Q +YAASDV HLHA+     E+L+R GR+ +A
Sbjct: 119 DLVRELLGKEISKQQQSSDWGAPTLTDAQQEYAASDVRHLHAMHTILVERLEREGRTAMA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C +FL  RA LDL GW   DIFSH
Sbjct: 179 QACFDFLPMRARLDLAGWAERDIFSH 204


>gi|57239514|ref|YP_180650.1| putative ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|58579496|ref|YP_197708.1| putative ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|58617549|ref|YP_196748.1| putative ribonuclease D [Ehrlichia ruminantium str. Gardel]
 gi|57161593|emb|CAH58521.1| putative exonuclease [Ehrlichia ruminantium str. Welgevonden]
 gi|58417161|emb|CAI28274.1| Probable ribonuclease D [Ehrlichia ruminantium str. Gardel]
 gi|58418122|emb|CAI27326.1| Probable ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
          Length = 205

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 104/206 (50%), Positives = 141/206 (68%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I VH+ D+P      + + +AVDTET+GL+ RRDRLC+VQ+S  +G V +++  + + 
Sbjct: 1   MPIFVHDYDLPDGV--EFGNTVAVDTETMGLVCRRDRLCLVQMSGSNGNVHLVKFPSTEY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            A NL  +L D    KIFH+ RFDI  + Y  G+   P +CTKIAS+L RTYT+ HGLK+
Sbjct: 59  QASNLKKILSDLSITKIFHFARFDITAIRYYLGIWAIPCYCTKIASKLARTYTDHHGLKE 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELLGI ++K QQSSDW  + L+ EQL YAASDV+HLHAL+ +    L+R  + +LA 
Sbjct: 119 LCNELLGIKLNKVQQSSDWGKEVLTSEQLNYAASDVIHLHALKSKLDAMLERENKQELAK 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           SC +FL  R +LDLLGW+NVDIFSH+
Sbjct: 179 SCFDFLPTRVQLDLLGWDNVDIFSHA 204


>gi|16127833|ref|NP_422397.1| ribonuclease D [Caulobacter crescentus CB15]
 gi|221236653|ref|YP_002519090.1| ribonuclease D [Caulobacter crescentus NA1000]
 gi|13425349|gb|AAK25565.1| ribonuclease D, putative [Caulobacter crescentus CB15]
 gi|220965826|gb|ACL97182.1| ribonuclease D [Caulobacter crescentus NA1000]
          Length = 205

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 110/207 (53%), Positives = 142/207 (68%), Gaps = 2/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M    VHEGD+P    A   + IA+D+ET+GL  RRD LC+VQLS GDG   ++R++   
Sbjct: 1   MANF-VHEGDLPDGVFA-DAEIIAIDSETMGLRLRRDPLCVVQLSAGDGDAHVVRLSRPD 58

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            + PNL  +L + K  K+FH+GRFDIA+     GV   PV+CTKIAS+L RTYT++HGLK
Sbjct: 59  YDCPNLKALLTNPKVLKLFHFGRFDIAMFELHLGVVTAPVYCTKIASKLARTYTDRHGLK 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +ELLG+ +SK QQSSDW A  LS +Q+ YAASDV+HLH LRL+    L+R GR  LA
Sbjct: 119 DVTRELLGVELSKVQQSSDWGAPSLSVDQVAYAASDVLHLHGLRLKLNAMLEREGRMALA 178

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
               ++L  RA LDL GWE +DIF+HS
Sbjct: 179 QHAFDYLPHRASLDLAGWEEMDIFAHS 205


>gi|88607131|ref|YP_505646.1| 3''-5'' exonuclease family protein [Anaplasma phagocytophilum HZ]
 gi|88598194|gb|ABD43664.1| 3''-5'' exonuclease family protein [Anaplasma phagocytophilum HZ]
          Length = 204

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 105/205 (51%), Positives = 142/205 (69%), Gaps = 3/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             + VH  D+P +      D +AVDTET+GL+ RRDR+C+VQLS G+G   +++   G  
Sbjct: 1   MAVFVHRNDLPHDVDLG--DMVAVDTETMGLVCRRDRVCLVQLSAGNGDAHLVKFD-GDY 57

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  ++ D    KIFH+ RFD+A + + FG+   P +CTKIASRL RTYTN HGLKD
Sbjct: 58  SAPNLRKVISDPGVLKIFHFARFDVAAIRHGFGMWATPCYCTKIASRLVRTYTNHHGLKD 117

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELLG+ I+KAQQSSDW  + L+ EQL YAA+DV++LHA++ +    L+R  + +LA 
Sbjct: 118 LCYELLGVKINKAQQSSDWGREVLTAEQLSYAAADVIYLHAIKKKLDMMLEREEKQELAE 177

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
           +C  F+  RAELDLLGW+ VDIFSH
Sbjct: 178 ACFKFVPVRAELDLLGWDGVDIFSH 202


>gi|163867544|ref|YP_001608743.1| hypothetical protein Btr_0277 [Bartonella tribocorum CIP 105476]
 gi|161017190|emb|CAK00748.1| Ribonuclease D [Bartonella tribocorum CIP 105476]
          Length = 206

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 130/207 (62%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P        DAIA+DTETLGL P RDRLC+VQ+SPGDGT DII+IA GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYKTDAIAIDTETLGLQPHRDRLCVVQISPGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           KNAPNLV +L D    KIFH+GRFD+A+L +TFGV    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  KNAPNLVKLLEDNAVTKIFHFGRFDLAILAHTFGVMPEAVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L+  F E+L+R  R  +A
Sbjct: 120 EICNELLNVNISKQQQSSDWAAETLSQAQIEYAASDVLYLHRLKAIFEERLRREERESVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  VDIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWSEVDIFAHS 206


>gi|67459045|ref|YP_246669.1| ribonuclease D [Rickettsia felis URRWXCal2]
 gi|67004578|gb|AAY61504.1| Ribonuclease D [Rickettsia felis URRWXCal2]
          Length = 203

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 130/205 (63%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I++++ D+P          IA+DTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MNIKIYQDDLPNNFELE--GDIAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFVNQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  SAPNLKALLLDKTRCKIFHFARFDLAAIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W  D+LS EQ +YAA DV++LH L+    + L R  R +LA 
Sbjct: 119 LCRELLSINISKQQQSSYWGTDNLSSEQKEYAAKDVLYLHQLKDILQKMLLRENRLELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  RA LDL+GW  +DIF H
Sbjct: 179 DIFRFLPTRANLDLIGWNEIDIFMH 203


>gi|307943000|ref|ZP_07658345.1| 3'-5' exonuclease [Roseibium sp. TrichSKD4]
 gi|307773796|gb|EFO33012.1| 3'-5' exonuclease [Roseibium sp. TrichSKD4]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 118/206 (57%), Positives = 147/206 (71%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TIR H+ D+         DA+AVDTETLGL   RDRLC+VQLSPGDG+ D+++I  G  
Sbjct: 1   MTIRFHKNDLSDLTHYVSCDAVAVDTETLGLNLLRDRLCVVQLSPGDGSADVVQIEKGMT 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D  R KIFHY RFD+A+L    G+ V PV+CTKIAS+L RTYT++HGLKD
Sbjct: 61  AAPNLTALLSDPARTKIFHYARFDVAILRQNLGIHVDPVWCTKIASKLCRTYTDRHGLKD 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELLG++ISK QQSSDW+A+ L+D QL YAASDV+HLHAL+ +    L+R  R+ LA 
Sbjct: 121 ITRELLGVDISKQQQSSDWAAEQLTDAQLAYAASDVLHLHALKEKLEFMLRREERTHLAE 180

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           +   FL  RAELDL GW   DIF+HS
Sbjct: 181 ASFGFLPTRAELDLKGWGETDIFAHS 206


>gi|51473610|ref|YP_067367.1| ribonuclease D [Rickettsia typhi str. Wilmington]
 gi|51459922|gb|AAU03885.1| ribonuclease D [Rickettsia typhi str. Wilmington]
          Length = 203

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 130/205 (63%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I++++ D+P          IAVDTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MNIKIYQNDLPNNFKLE--GDIAVDTETMGLNIHRDKLCLLQFSNGNGAAHLVHFINQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  TAPNLKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W  D+LS EQ +YAA DV++LH L+    + L R  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWGTDNLSLEQKEYAAKDVLYLHQLKDILQKMLFRENRLELAH 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  R  LDL+GW+ +DIF+H
Sbjct: 179 EIFRFLPTRVNLDLIGWDQIDIFTH 203


>gi|157803820|ref|YP_001492369.1| ribonuclease D [Rickettsia canadensis str. McKiel]
 gi|157785083|gb|ABV73584.1| ribonuclease D [Rickettsia canadensis str. McKiel]
          Length = 203

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 130/205 (63%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MTIKIYQNDLPNNFRLG--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFENQNY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  TAPNLKALLSDKSRCKIFHFARFDLAAIKKYLEIELENIFCTKISSKLVRTYTDSHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWRADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRFELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               F+  RA LDLLGW  +DIF H
Sbjct: 179 DIFRFVPTRANLDLLGWNEIDIFMH 203


>gi|71083204|ref|YP_265923.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062317|gb|AAZ21320.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1062]
          Length = 203

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            I++H+ D+P +        IAVD E +GL  +RD LC++Q+S G+    II++   + +
Sbjct: 4   DIKLHKNDLPEDLDLGN--IIAVDGEFMGLNVKRDPLCLIQISTGNSDAHIIQLDREKYD 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L D    KIFHYGR D+A + +        +  TKIAS+L R+Y++ H LK  
Sbjct: 62  APNLNKVLSDASIIKIFHYGRADMAHIKHYLKTETNNILDTKIASKLARSYSDSHSLKTL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           +KE + +++SK  QSSD+  + LS  QL+Y A+DV++LH +  +  + L R  R DL  S
Sbjct: 122 IKEFMNVDVSKQFQSSDFGGE-LSPAQLKYCANDVIYLHKIHEELNKILVREKRIDLYKS 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  R +LDL  +++ DI+SH
Sbjct: 181 CLAFLKTRVDLDLALFKD-DIWSH 203


>gi|49475064|ref|YP_033105.1| ribonuclease d [Bartonella henselae str. Houston-1]
 gi|49237869|emb|CAF27065.1| Ribonuclease d [Bartonella henselae str. Houston-1]
          Length = 206

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 128/207 (61%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           MT IRVH+GD+P       +DA+AVDTETLGL P RDRLC+VQLS GDGT D+I+IA GQ
Sbjct: 1   MTEIRVHQGDLP-NLDNYRIDAVAVDTETLGLQPHRDRLCVVQLSSGDGTADVIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K+APNLV +L D    KIFH+GRFD+A+L +TFGV    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  KSAPNLVRLLSDRDITKIFHFGRFDLAILAHTFGVMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L+  F E+L+R  R  +A
Sbjct: 120 EICGELLNVNISKQQQSSDWAAETLSRAQIEYAASDVLYLHRLKDIFEERLKREERESVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA LDLLGW  +DIF+HS
Sbjct: 180 KACFQFLPMRANLDLLGWSEIDIFAHS 206


>gi|239947292|ref|ZP_04699045.1| ribonuclease D [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921568|gb|EER21592.1| ribonuclease D [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 203

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 129/205 (62%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G    +       
Sbjct: 1   MTIKIYQNDLPNNFELE--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHFVHFTNQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGL D
Sbjct: 59  IAPNLKALLLDKTRCKIFHFARFDLAFIKKYLSIDLENIFCTKISSKLVRTYTDSHGLND 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  RA LDLLGW  +DIF H
Sbjct: 179 DIFRFLPTRANLDLLGWNEIDIFMH 203


>gi|157825707|ref|YP_001493427.1| ribonuclease D [Rickettsia akari str. Hartford]
 gi|157799665|gb|ABV74919.1| Ribonuclease D [Rickettsia akari str. Hartford]
          Length = 203

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 95/205 (46%), Positives = 130/205 (63%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI++++ D+P          IA+DTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MTIKIYQNDLPDNFELE--GDIAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFVNQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  TAPNLKALLLDKTRCKIFHFARFDLASIKQYLSIDLENIFCTKISSKLVRTYTDNHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W  D+LS EQ +YAA DV++LH L+    + L R  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWGTDNLSSEQKEYAAKDVLYLHQLKDMLQKMLLRENRLELAH 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  RA LDL+GW  +DIF H
Sbjct: 179 DIFRFLPTRANLDLIGWNEIDIFMH 203


>gi|121602332|ref|YP_989471.1| 3'-5' exonuclease domain-containing protein [Bartonella
           bacilliformis KC583]
 gi|120614509|gb|ABM45110.1| 3'-5' exonuclease domain protein [Bartonella bacilliformis KC583]
          Length = 206

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 127/207 (61%), Positives = 160/207 (77%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       VDA+A+DTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MIDIRVHQGDLP-NLDNYCVDAVAIDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFG+    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVKLLADKAITKIFHFGRFDLAILAHTFGIMPDAVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAAETLSRAQIEYAASDVLYLHRLKSVFEERLKREEREDVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  +DIF+HS
Sbjct: 180 KACFQFLPVRAKLDLLGWPEIDIFAHS 206


>gi|240849913|ref|YP_002971302.1| 3'-5' exonuclease [Bartonella grahamii as4aup]
 gi|240267036|gb|ACS50624.1| 3'-5' exonuclease [Bartonella grahamii as4aup]
          Length = 206

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 126/207 (60%), Positives = 159/207 (76%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P        DAIA+DTETLGL P RDRLC+VQLS GDGT D+I+I+ GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYKTDAIAIDTETLGLQPHRDRLCVVQLSSGDGTADVIQISKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K+APNLV +L D    KIFH+GRFD+A+L +TFGV    +FCTKIAS+LTRTYT++HGLK
Sbjct: 60  KSAPNLVKLLGDNAVIKIFHFGRFDLAILAHTFGVMPEAIFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH L++ F E+L+R  R  +A
Sbjct: 120 EICNELLNVNISKQQQSSDWAAETLSQAQIEYAASDVLYLHRLKVIFEERLRREERESVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  VDIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWAEVDIFAHS 206


>gi|225630598|ref|YP_002727389.1| 3'-5' exonuclease [Wolbachia sp. wRi]
 gi|225592579|gb|ACN95598.1| 3'-5' exonuclease [Wolbachia sp. wRi]
          Length = 206

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 97/205 (47%), Positives = 133/205 (64%), Gaps = 1/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I +++ D+PA      V +IAVDTE +GL+  RDRLC+VQLS  DG   +++      
Sbjct: 1   MGIFLYKDDLPASSIPDDVRSIAVDTEAMGLLHGRDRLCLVQLSFNDGNAHLVQ-LKNDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+
Sbjct: 60  TAPNLRKILEDKNITKIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL   ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA 
Sbjct: 120 LCLELLDTKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  R ELDL+GWENVDIF+H
Sbjct: 180 KCFEFLPTRIELDLMGWENVDIFNH 204


>gi|15604287|ref|NP_220803.1| hypothetical protein RP422 [Rickettsia prowazekii str. Madrid E]
 gi|3860979|emb|CAA14879.1| unknown [Rickettsia prowazekii]
 gi|292572036|gb|ADE29951.1| Ribonuclease D [Rickettsia prowazekii Rp22]
          Length = 203

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 129/205 (62%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I++++ D+P+         IAVDTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MNIKIYQNDLPSNFKLE--GDIAVDTETMGLNIHRDKLCLLQFSNGNGEAHLVHFINQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  TAPNLKMLLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W  D LS EQ +YAA DV++LH L+    + L R  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWGTDHLSLEQKEYAAKDVLYLHQLKDILQKMLLRENRLELAH 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  R  LDL+GW+ +DIF H
Sbjct: 179 DIFRFLPTRVHLDLIGWDQIDIFMH 203


>gi|49473901|ref|YP_031943.1| ribonuclease d [Bartonella quintana str. Toulouse]
 gi|49239404|emb|CAF25742.1| Ribonuclease d [Bartonella quintana str. Toulouse]
          Length = 206

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 131/207 (63%), Positives = 161/207 (77%), Gaps = 1/207 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       +DA+AVDTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MKEIRVHQGDLP-NLDNYQIDAVAVDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K+APNLV +L D+   KIFH+GRFD+A+L YTFGV    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  KSAPNLVKLLKDKAITKIFHFGRFDLAILAYTFGVMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+A+ LS  Q++YAASDV++LH LR  F E+L+R  R ++A
Sbjct: 120 EICCELLNVNISKQQQSSDWAAEILSRAQIEYAASDVLYLHRLRDIFEERLKREERENVA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
            +C  FL  RA+LDLLGW  VDIF+HS
Sbjct: 180 KACFQFLPMRAKLDLLGWSEVDIFAHS 206


>gi|157828459|ref|YP_001494701.1| ribonuclease D [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933177|ref|YP_001649966.1| ribonuclease D [Rickettsia rickettsii str. Iowa]
 gi|157800940|gb|ABV76193.1| ribonuclease D [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908264|gb|ABY72560.1| ribonuclease D [Rickettsia rickettsii str. Iowa]
          Length = 203

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 93/205 (45%), Positives = 131/205 (63%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MTIKIYQNDLPNNFTLE--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFTNQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APN+  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  TAPNVKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  RA LDL+GW  +DIF H
Sbjct: 179 DIFRFLPIRANLDLIGWNEIDIFMH 203


>gi|218440719|ref|YP_002379048.1| 3'-5' exonuclease [Cyanothece sp. PCC 7424]
 gi|218173447|gb|ACK72180.1| 3'-5' exonuclease [Cyanothece sp. PCC 7424]
          Length = 209

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 95/209 (45%), Positives = 129/209 (61%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  E  +R    DAIAVDTET+GL P RDRLC++QL   +G V  IR+  
Sbjct: 3   LDNFKVLQEDLSDEILSRYLKADAIAVDTETMGLNPHRDRLCLIQLCDPEGYVTAIRVTK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ AP L  ++      K+FH+ RFD+A L + FG+   P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQQEAPKLKQLMEASNITKVFHFARFDVAQLRHHFGIETTPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  + EL G+ + K  QSSDW   D LS+EQL YAA+DV +L  ++ +    L R  R 
Sbjct: 123 LKSLVLELEGVELDKTAQSSDWGNADKLSEEQLSYAANDVRYLLGVKEKLISMLNRENRM 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA +C N L     LDL  ++N  IF H
Sbjct: 183 ELARNCFNCLPVLVSLDLQFYQN--IFEH 209


>gi|58584866|ref|YP_198439.1| ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58419182|gb|AAW71197.1| Ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 206

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 96/205 (46%), Positives = 134/205 (65%), Gaps = 1/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I V++ D+PA      V +IAVDTE +GL+  RDRLC++QLS  DG   +I+      
Sbjct: 1   MRIFVYKDDLPASSIPDNVRSIAVDTEAMGLLHVRDRLCLIQLSFNDGNAHLIQF-KNDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+
Sbjct: 60  AAPNLRKILGDKNITKIFHFARFDVSIICYYLETWALPCYCTKIASRLVRTYTDNHSLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL   ++K QQSSDW +++L+D+Q  YAASDV++LH ++ +    L+R  R +LA 
Sbjct: 120 LCLELLDTKLNKQQQSSDWGSENLTDKQKSYAASDVLYLHKIKEKLDLMLERENRKELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  R ELDL+GWE++DIF+H
Sbjct: 180 KCFEFLPIRVELDLMGWEDMDIFNH 204


>gi|15892510|ref|NP_360224.1| ribonuclease D [Rickettsia conorii str. Malish 7]
 gi|34580497|ref|ZP_00141977.1| ribonuclease D [Rickettsia sibirica 246]
 gi|229586700|ref|YP_002845201.1| Ribonuclease D [Rickettsia africae ESF-5]
 gi|238650888|ref|YP_002916744.1| ribonuclease D [Rickettsia peacockii str. Rustic]
 gi|15619670|gb|AAL03125.1| ribonuclease D [Rickettsia conorii str. Malish 7]
 gi|28261882|gb|EAA25386.1| ribonuclease D [Rickettsia sibirica 246]
 gi|228021750|gb|ACP53458.1| Ribonuclease D [Rickettsia africae ESF-5]
 gi|238624986|gb|ACR47692.1| ribonuclease D [Rickettsia peacockii str. Rustic]
          Length = 203

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 93/205 (45%), Positives = 131/205 (63%), Gaps = 2/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MTIKIYQNDLPNNFKLE--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFTNQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APN+  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  TAPNVKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
               FL  RA LDL+GW  +DIF H
Sbjct: 179 DIFRFLPIRANLDLIGWNEIDIFMH 203


>gi|58698542|ref|ZP_00373443.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58534924|gb|EAL59022.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila ananassae]
          Length = 234

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 97/205 (47%), Positives = 133/205 (64%), Gaps = 1/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I +++ D+PA      V +IAVDTE +GL+  RDRLC+VQLS  DG   +++      
Sbjct: 29  MGIFLYKDDLPASSIPDDVRSIAVDTEAMGLLHGRDRLCLVQLSFNDGNAHLVQ-LKNDY 87

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+
Sbjct: 88  TAPNLRKILEDKNITKIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKE 147

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL   ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA 
Sbjct: 148 LCLELLDTKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQ 207

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  R ELDL+GWENVDIF+H
Sbjct: 208 KCFEFLPTRIELDLMGWENVDIFNH 232


>gi|254456084|ref|ZP_05069513.1| ribonuclease D [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083086|gb|EDZ60512.1| ribonuclease D [Candidatus Pelagibacter sp. HTCC7211]
          Length = 203

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 122/205 (59%), Gaps = 4/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I++H+ D+P +        +AVD E +GL  RRD LC++QLS G+    I+++     
Sbjct: 3   NNIKLHQKDLPEDLDLGN--VLAVDGEFMGLNVRRDPLCLIQLSTGNSDAHIVQLDRKSY 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL+ +L DE   KIFHYGR D+A + Y        +  TKIAS+L R+Y++ H LK 
Sbjct: 61  EAPNLIKILKDETITKIFHYGRADMAHIKYYLKTETNNILDTKIASKLARSYSDNHSLKT 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            +KE   ++ISK  QSSD+    L+  QL+Y A+DV++LH +  +  + L+R  R  L  
Sbjct: 121 LIKEFANVDISKQFQSSDFGG-TLTPAQLKYCANDVIYLHQIHDELFKILERENRIKLYK 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C +FL  R +LDL  +++ DI+SH
Sbjct: 180 DCLSFLKTRVDLDLALFKD-DIWSH 203


>gi|73667429|ref|YP_303445.1| 3'-5' exonuclease [Ehrlichia canis str. Jake]
 gi|72394570|gb|AAZ68847.1| 3'-5' exonuclease [Ehrlichia canis str. Jake]
          Length = 216

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 110/204 (53%), Positives = 145/204 (71%), Gaps = 3/204 (1%)

Query: 4   IRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           + VH+ D+P      + DA+A+DTET+GL+ RRDRLC+VQL+   G V +++ + G   A
Sbjct: 15  VFVHDCDLPNG--LNFEDAVAIDTETMGLVCRRDRLCLVQLADSSGNVHLVKFS-GNYQA 71

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNLV +L D    KIFH+ RFDIAV+ Y  G+   P +CTKIAS+L RTYT+ HGLK+  
Sbjct: 72  PNLVSVLSDPNIIKIFHFARFDIAVMRYYLGMWANPCYCTKIASKLVRTYTDHHGLKELC 131

Query: 124 KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            ELLG+ ++K QQSSDW  + L+ EQL YAASDV++LHAL+ +    LQR  + +LA +C
Sbjct: 132 YELLGVKLNKMQQSSDWGRESLTSEQLNYAASDVIYLHALKSKLDAMLQRENKRELAAAC 191

Query: 184 CNFLMDRAELDLLGWENVDIFSHS 207
             FL  RA+LDLLGWENVDIFSHS
Sbjct: 192 FKFLQTRAQLDLLGWENVDIFSHS 215


>gi|319403664|emb|CBI77249.1| Ribonuclease D [Bartonella rochalimae ATCC BAA-1498]
          Length = 206

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 128/206 (62%), Positives = 159/206 (77%), Gaps = 1/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       VD+IA+DTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYCVDSIAIDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFGV    VFCTK+AS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVTLLEDKTITKIFHFGRFDLAILAHTFGVMPDAVFCTKLASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAADALSRAQIEYAASDVLYLHRLKSIFEERLKREEREDIA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RA+LDLLGW  VDIF+H
Sbjct: 180 KACFQFLPVRAKLDLLGWSEVDIFAH 205


>gi|91762366|ref|ZP_01264331.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718168|gb|EAS84818.1| ribonuclease D [Candidatus Pelagibacter ubique HTCC1002]
          Length = 203

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 82/204 (40%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
            I++H  D+P +        IAVD E +GL  +RD LC++Q+S G+    II++   + +
Sbjct: 4   DIKLHTSDLPEDLDLGN--IIAVDGEFMGLNVKRDPLCLIQISTGNSDAHIIQLDREKYD 61

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           APNL  +L DE   KIFHYGR D+A + +        +  TKIAS+L R+Y++ H LK  
Sbjct: 62  APNLNKVLSDESITKIFHYGRADMAHIKHYLKTETNNILDTKIASKLARSYSDSHSLKTL 121

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           +KE + +++SK  QSSD+  + LS  QL+Y A+DV++LH +  +  + L R  R DL  S
Sbjct: 122 IKEFMNVDVSKQFQSSDFGGE-LSPAQLKYCANDVIYLHKIHEELNKILVREKRIDLYKS 180

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  R +LDL  +++ DI+SH
Sbjct: 181 CLAFLKTRVDLDLALFKD-DIWSH 203


>gi|319406582|emb|CBI80224.1| Ribonuclease D [Bartonella sp. 1-1C]
          Length = 206

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 129/206 (62%), Positives = 160/206 (77%), Gaps = 1/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IRVH+GD+P       VD+IA+DTETLGL P RDRLC+VQLSPGDGT DII+IA GQ
Sbjct: 1   MAEIRVHQGDLP-NLDNYCVDSIAIDTETLGLQPHRDRLCVVQLSPGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNLV +L D+   KIFH+GRFD+A+L +TFGV    VFCTK+AS+LTRTYT++HGLK
Sbjct: 60  NSAPNLVTLLEDKTITKIFHFGRFDLAILAHTFGVMPDAVFCTKLASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAADALSRAQIEYAASDVLYLHRLKSIFEERLKREEREDIA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RA+LDLLGW  VDIF+H
Sbjct: 180 KACFQFLPVRAKLDLLGWSEVDIFAH 205


>gi|157964505|ref|YP_001499329.1| ribonuclease D [Rickettsia massiliae MTU5]
 gi|157844281|gb|ABV84782.1| Ribonuclease D [Rickettsia massiliae MTU5]
          Length = 203

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 93/203 (45%), Positives = 131/203 (64%), Gaps = 2/203 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            TI++++ D+P          +A+DTET+GL   RD+LC++Q S G+G   ++       
Sbjct: 1   MTIKIYQNDLPNNFELE--GDLAIDTETMGLNLHRDKLCLLQFSNGNGEAHLVHFTNQDY 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L+D+ R KIFH+ RFD+A +     + +  +FCTKI+S+L RTYT+ HGLKD
Sbjct: 59  TAPNLKALLLDKTRCKIFHFARFDLASIKKYLSIDLENIFCTKISSKLVRTYTDSHGLKD 118

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
             +ELL INISK QQSS W AD+LS EQ +YAA DV++LH L+    + L +  R +LA 
Sbjct: 119 LCRELLNINISKQQQSSYWGADNLSSEQKEYAAKDVLYLHQLKDILQKMLLKENRYELAQ 178

Query: 182 SCCNFLMDRAELDLLGWENVDIF 204
              +FL  RA LDL+GW  +DIF
Sbjct: 179 DIFHFLPTRANLDLIGWNEIDIF 201


>gi|42520711|ref|NP_966626.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410451|gb|AAS14560.1| 3'-5' exonuclease [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 206

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 96/205 (46%), Positives = 133/205 (64%), Gaps = 1/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I +++ D+PA      + +IAVDTE +GL+  RDRLC+VQLS  DG   +++      
Sbjct: 1   MGIFLYKDDLPASSIPDDIRSIAVDTEAMGLLHSRDRLCLVQLSFNDGNAHLVQ-LKNDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+
Sbjct: 60  TAPNLRKILEDKNITKIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL   ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA 
Sbjct: 120 LCLELLDTKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQ 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  R ELDL+GWENVDIF+H
Sbjct: 180 KCFEFLPTRIELDLMGWENVDIFNH 204


>gi|68171372|ref|ZP_00544766.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657845|ref|YP_507797.1| 3'-5' exonuclease family protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67772422|gb|AAY79412.1| ribonuclease D [Ehrlichia chaffeensis]
 gi|67999197|gb|EAM85853.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599302|gb|ABD44771.1| 3'-5' exonuclease family protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 204

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 105/206 (50%), Positives = 141/206 (68%), Gaps = 3/206 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             + VH+ D+P     ++ + +AVDTET+GL+ RRD+LC+VQL   +G   +++   G  
Sbjct: 1   MPVFVHDCDLPNG--LKFENTVAVDTETMGLVCRRDKLCVVQLCDSNGETHLVKFL-GSY 57

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNLV +L D    KIFH+ RFDIAV+ Y  GV   P +CTKIAS+L RTYT+ HGLK+
Sbjct: 58  QAPNLVSVLSDSSITKIFHFARFDIAVIRYYLGVWATPCYCTKIASKLVRTYTDHHGLKE 117

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL + ++K QQSSDW  + L+ EQL YAASDV++LHAL+ +    LQR  + +LA 
Sbjct: 118 LCYELLNVKLNKMQQSSDWGKETLTSEQLNYAASDVIYLHALKNKLDAMLQRENKQELAA 177

Query: 182 SCCNFLMDRAELDLLGWENVDIFSHS 207
           SC  FL  RA+LDLLGW+ VDIFSH+
Sbjct: 178 SCFGFLPTRAQLDLLGWDGVDIFSHA 203


>gi|319405135|emb|CBI78741.1| Ribonuclease D [Bartonella sp. AR 15-3]
          Length = 206

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 127/206 (61%), Positives = 158/206 (76%), Gaps = 1/206 (0%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  IR+H+GD+P       VD++A+DTETLGL P RDRLC+VQLS GDGT DII+IA GQ
Sbjct: 1   MAEIRIHQGDLP-NLDNYCVDSVAIDTETLGLQPHRDRLCVVQLSSGDGTADIIQIAKGQ 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             APNLV +L D+K  KIFH+GRFD+A+L +TF V    VFCTKIAS+LTRTYT++HGLK
Sbjct: 60  NRAPNLVTLLEDKKITKIFHFGRFDLAILAHTFAVMPDVVFCTKIASKLTRTYTDRHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           +   ELL +NISK QQSSDW+AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A
Sbjct: 120 EICSELLNVNISKQQQSSDWAADALSRAQIEYAASDVLYLHRLKSIFEERLKREEREDIA 179

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
            +C  FL  RA+LDLLGW  VDIF+H
Sbjct: 180 KACFQFLPVRAKLDLLGWAEVDIFAH 205


>gi|117923642|ref|YP_864259.1| 3'-5' exonuclease [Magnetococcus sp. MC-1]
 gi|117607398|gb|ABK42853.1| 3'-5' exonuclease [Magnetococcus sp. MC-1]
          Length = 213

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 101/207 (48%), Positives = 128/207 (61%), Gaps = 4/207 (1%)

Query: 3   TIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           TI     D+      R      +AVDTET+GL   RDRLC+VQ+    G V +++I    
Sbjct: 7   TIHTFIDDLDEAQFQRYMKSPFLAVDTETMGLDINRDRLCVVQMCDVTGEVSVVQIR--N 64

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             AP L  ++   + EKIFH+ RFD+A +     + ++PVFCTKIAS+L RTYT  HGLK
Sbjct: 65  YQAPRLKALMEAPEVEKIFHFARFDLATMKRWLDIEIKPVFCTKIASKLVRTYTGSHGLK 124

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  +ELLG+ + K QQSSDW A+ L+ EQLQYAASDV+HL  +R +  E L R GR  LA
Sbjct: 125 DVSQELLGVVMDKQQQSSDWGAEQLTPEQLQYAASDVIHLVEIRARLVEMLAREGRLQLA 184

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSHS 207
                FL  R  LDLLGW N DIFSH+
Sbjct: 185 DEIMRFLPTRVALDLLGWNNHDIFSHA 211


>gi|190571105|ref|YP_001975463.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|213019628|ref|ZP_03335434.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
 gi|190357377|emb|CAQ54811.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|212995050|gb|EEB55692.1| 3'-5' exonuclease [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
          Length = 206

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 132/205 (64%), Gaps = 1/205 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I +++ D+PA      + +IAVDTE +GL+  RDRLC+VQLS  DG   +++      
Sbjct: 1   MRIFIYKDDLPASAIPNDIKSIAVDTEAMGLLHSRDRLCLVQLSFNDGNAHLVQF-KNDY 59

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            APNL  +L D+   KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+
Sbjct: 60  TAPNLRKILEDKNITKIFHFARFDVSIIHYYLQTWALPCYCTKIASRLVRTYTDNHSLKE 119

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
              ELL I ++K QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA 
Sbjct: 120 LCLELLDIKLNKQQQSSDWGNENLTDKQKSYAASDVLYLHKIKEKLDLMLERENRKELAE 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  R ELD +GW +VDIF+H
Sbjct: 180 KCFEFLPTRIELDSMGWGSVDIFNH 204


>gi|16331359|ref|NP_442087.1| ribonuclease D [Synechocystis sp. PCC 6803]
 gi|1001530|dbj|BAA10157.1| ribonuclease D [Synechocystis sp. PCC 6803]
          Length = 217

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 92/209 (44%), Positives = 126/209 (60%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           ++   V + D+P +          +AVDTET+GL P RDRLC+VQ+   +G V  +RIA 
Sbjct: 7   LSQFEVFDYDLPEDVCQQLLACKEVAVDTETMGLNPHRDRLCLVQICDPEGNVTALRIAK 66

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  ++ D    KIFH+ RFD A L +TF ++  P+FCTKIAS++ RTYT+ HG
Sbjct: 67  GQEEAPNLTRLMEDPGITKIFHFARFDTAQLKHTFDIKTYPIFCTKIASKIARTYTSHHG 126

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL+G+ + K+ Q SDW    +LS  QL YAA+DV +L  LR +  + L R  R 
Sbjct: 127 LKTLVQELVGVELDKSSQCSDWGNAANLSKAQLAYAANDVRYLIPLRHKLEKMLAREDRL 186

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDL  + NV  F H
Sbjct: 187 RLAQRCFECLPVMVTLDLGMYGNV--FEH 213


>gi|307151178|ref|YP_003886562.1| 3'-5' exonuclease [Cyanothece sp. PCC 7822]
 gi|306981406|gb|ADN13287.1| 3'-5' exonuclease [Cyanothece sp. PCC 7822]
          Length = 209

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 100/209 (47%), Positives = 129/209 (61%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V EGD+  +  A+    +AIAVDTET+GL+P RDRLC+VQL    G V  IRIA 
Sbjct: 3   LDNFQVLEGDLSDDILAQYLQAEAIAVDTETMGLIPHRDRLCLVQLCDPTGYVTAIRIAK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQK AP L  ++ +    K+FH+ RFD+A L +  G+   P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQKEAPKLKQLMENNHSIKVFHFARFDVAQLRHHLGIETTPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  + EL GI + K  QSSDW    +LS+EQL YAA+DV +L  L+ +    LQR  R 
Sbjct: 123 LKSLVLELEGIELDKTAQSSDWGNAANLSEEQLSYAANDVRYLLGLKQKLITMLQREDRW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDLL + NV  F H
Sbjct: 183 QLAQDCFQCLPVIVSLDLLLYPNV--FEH 209


>gi|254422868|ref|ZP_05036586.1| 3'-5' exonuclease, putative [Synechococcus sp. PCC 7335]
 gi|196190357|gb|EDX85321.1| 3'-5' exonuclease, putative [Synechococcus sp. PCC 7335]
          Length = 207

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 102/209 (48%), Positives = 132/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M    V + D+  +   R    DAIAVDTET+GL P RDRLC++QL    G V  IR   
Sbjct: 1   MENFEVCDYDLTPQLLERYIQADAIAVDTETMGLNPLRDRLCLIQLCDPGGYVCAIRTER 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ +APNL  +L ++   KIFH+ RFD+A L +  G+   PVFCTKIAS++ RTY+  HG
Sbjct: 61  GQSSAPNLKQLLEEKNITKIFHFARFDLATLQHHLGIVTAPVFCTKIASKIARTYSPSHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  +KEL+GI + K+QQSSDW     LSDEQL YAA+DV +L+ L+ + TE L+R GR 
Sbjct: 121 LKSLVKELIGIELDKSQQSSDWGNAAALSDEQLSYAANDVRYLYVLQNKLTEMLKREGRW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C + L    ELDL  + +V  F H
Sbjct: 181 TLAKQCLDCLPVFVELDLRQFGSV--FEH 207


>gi|330813574|ref|YP_004357813.1| ribonuclease D related protein [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486669|gb|AEA81074.1| ribonuclease D related protein [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 205

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 92/206 (44%), Positives = 130/206 (63%), Gaps = 2/206 (0%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMP-RRDRLCIVQLSPGDGTVDIIRIAAGQ 60
             I +++ D+P         ++A+D E+LGL    RD+LC++QL  GD  V I++     
Sbjct: 1   MNITLYQNDLPENHKLTNAQSVAIDAESLGLNYKGRDKLCLLQLCSGDDEVYIVQFDRNN 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             +PNL  +L D    KI H+ RF++ +L Y    ++  ++CTKIAS+L RTYT++HGL 
Sbjct: 61  YKSPNLCKILNDNNILKIAHFARFEMGILKYYLNAKIENIYCTKIASKLGRTYTDKHGLY 120

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           D  KELL I ++K+QQSSDW   DLS+EQ QYAA DV++LH L+ +    L+R  R  LA
Sbjct: 121 DITKELLNITLNKSQQSSDWGLKDLSEEQKQYAALDVLYLHKLKEKLDLMLRREKRDQLA 180

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C +FL  R+ELDL GW + DIFSH
Sbjct: 181 KYCFDFLSTRSELDLNGW-DEDIFSH 205


>gi|297182779|gb|ADI18933.1| ribonuclease d [uncultured SAR11 cluster bacterium HF0010_09O16]
          Length = 203

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 83/205 (40%), Positives = 126/205 (61%), Gaps = 4/205 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           T I +H+GD+P          +AVD E LGL  RRDRLC++Q+S G+    I+++     
Sbjct: 3   TKIELHKGDLPENLDLGT--IVAVDGEFLGLNVRRDRLCLIQVSSGNSDAHIVQLDRENY 60

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           NAPNLV +L D+  +K+FHY R D+  + Y     V  + C+KI S+L RT+++ H LK 
Sbjct: 61  NAPNLVKILADKNIKKLFHYARSDLTHIKYYLKTDVNNIECSKIKSKLARTFSDSHSLKT 120

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            +KE   +++SK  Q+SD+  + LS  QL+Y A+DV++LH +  +  + L+R  R DL  
Sbjct: 121 LIKEFANVDVSKQFQTSDFGGE-LSQGQLKYCANDVIYLHKIHSELDKILEREKRMDLYR 179

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C  FL  R +LDLL +++ DI+SH
Sbjct: 180 ECIKFLHTRIKLDLLEFKD-DIWSH 203


>gi|113475312|ref|YP_721373.1| 3'-5' exonuclease [Trichodesmium erythraeum IMS101]
 gi|110166360|gb|ABG50900.1| 3'-5' exonuclease [Trichodesmium erythraeum IMS101]
          Length = 207

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 93/209 (44%), Positives = 138/209 (66%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M+  +V + D+  +  +     D++AVDTET+GL+PRRDRLC+VQL    G V  IRI  
Sbjct: 1   MSDFQVCDRDLTKDILSNYLQADSMAVDTETMGLLPRRDRLCLVQLCDPLGQVTAIRIHK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  ++      K+FH+ RFD+A+L +  G++V P+FCTKI+S+L RTYT +HG
Sbjct: 61  GQQEAPNLKQLMEANSIVKVFHFARFDVAMLQHYLGIKVSPIFCTKISSKLARTYTGKHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + EL  + + K+ QSSDW   ++L+++QL YAA+DV +L ++R + ++ L+R  R 
Sbjct: 121 LKDLVMELEKVELDKSSQSSDWGNAENLTEKQLNYAANDVRYLLSVREKLSKILKREERW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C   L     LDLL ++  DIF H
Sbjct: 181 ELAQQCFECLPVFVGLDLLQYK--DIFEH 207


>gi|166365344|ref|YP_001657617.1| ribonuclease D [Microcystis aeruginosa NIES-843]
 gi|166087717|dbj|BAG02425.1| probable ribonuclease D [Microcystis aeruginosa NIES-843]
          Length = 209

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 97/209 (46%), Positives = 137/209 (65%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  +  +RY  V++IAVDTET+GL+P RDRLC++QL    G V  IR+  
Sbjct: 3   LDNFQVCDRDLSDDLLSRYLGVNSIAVDTETMGLIPGRDRLCLIQLCDPSGFVTAIRVFR 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  ++ DE+ EK+FH+ RFD+A L  TFG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQTEAPNLKKVMEDERIEKVFHFARFDVAQLSQTFGIATKPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW    +L+ +QL YAA+DV +L ++R +    LQR  R 
Sbjct: 123 LKSLVQELEGIELDKTAQSSDWGNAANLTPQQLSYAANDVRYLLSVRDKLIVMLQREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C + +     LDL  ++  DIF H
Sbjct: 183 ELAQKCFSCIPIFTALDLQQYK--DIFEH 209


>gi|218245974|ref|YP_002371345.1| 3'-5' exonuclease [Cyanothece sp. PCC 8801]
 gi|218166452|gb|ACK65189.1| 3'-5' exonuclease [Cyanothece sp. PCC 8801]
          Length = 210

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 99/209 (47%), Positives = 129/209 (61%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  E  +RY    AIAVDTET+GL+P+RDRLC+VQL    G V  IRI  
Sbjct: 4   LENFQVCDRDLSDETLSRYLAATAIAVDTETMGLIPQRDRLCLVQLCDPSGFVTAIRIER 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQK AP L  ++  +   K+FHY RFD+A L Y FG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 64  GQKEAPKLKQLMEAKTILKVFHYARFDVAQLRYHFGIETQPIFCTKIASKLARTYTSSHG 123

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW    +LS  QL YAA+DV +L   + +    LQR  R 
Sbjct: 124 LKSLVQELEGIELDKTSQSSDWGNSANLSVAQLSYAANDVRYLIPAKEKLITMLQREERW 183

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C N +     LDL  ++  DIF H
Sbjct: 184 QLAEQCFNCIPVFVSLDLEQYK--DIFEH 210


>gi|186684292|ref|YP_001867488.1| 3'-5' exonuclease [Nostoc punctiforme PCC 73102]
 gi|186466744|gb|ACC82545.1| 3'-5' exonuclease [Nostoc punctiforme PCC 73102]
          Length = 209

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 99/209 (47%), Positives = 134/209 (64%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+      +Y    AIAVDTET+GL+P+RDRLC+VQL   +G V +IRIA 
Sbjct: 3   LQDFQVSDRDLSDAALGQYLESTAIAVDTETMGLLPQRDRLCLVQLCNLEGKVTVIRIAK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  +       K+FH+ RFDIA L    G++V PVFCTKIAS+L RTYTN+HG
Sbjct: 63  GQTEAPNLKKLFEAANVVKVFHFARFDIATLRANLGIQVSPVFCTKIASKLARTYTNRHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD ++EL  + + K+ QSSDW     LS+ QL YAA+DV +L +++ + TE L+R  R 
Sbjct: 123 LKDVVQELEKVELDKSSQSSDWGNAVSLSEAQLSYAANDVRYLLSVQQKLTEMLKREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            +A  C  FL     LDLL ++  D+F H
Sbjct: 183 KIAQECFEFLPTIVSLDLLQFK--DLFEH 209


>gi|257059023|ref|YP_003136911.1| 3'-5' exonuclease [Cyanothece sp. PCC 8802]
 gi|256589189|gb|ACV00076.1| 3'-5' exonuclease [Cyanothece sp. PCC 8802]
          Length = 210

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 98/209 (46%), Positives = 129/209 (61%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  +  +RY    AIAVDTET+GL+P+RDRLC+VQL    G V  IRI  
Sbjct: 4   LENFQVCDRDLSDQTLSRYLAATAIAVDTETMGLIPQRDRLCLVQLCDPSGFVTAIRIER 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQK AP L  ++  +   K+FHY RFD+A L Y FG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 64  GQKEAPKLKQLMEAKTILKVFHYARFDVAQLRYHFGIETQPIFCTKIASKLARTYTSSHG 123

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW    +LS  QL YAA+DV +L   + +    LQR  R 
Sbjct: 124 LKSLVQELEGIELDKTSQSSDWGNSANLSVAQLSYAANDVRYLIPAKEKLITMLQREERW 183

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C N +     LDL  ++  DIF H
Sbjct: 184 QLAEQCFNCIPVFVSLDLEQYK--DIFEH 210


>gi|86608835|ref|YP_477597.1| 3'-5' exonuclease family protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557377|gb|ABD02334.1| 3'-5' exonuclease family protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 210

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 100/206 (48%), Positives = 135/206 (65%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            ++ + D+    A        +AVDTET+GL+P+RDRLC+VQ++   G V ++R++ G K
Sbjct: 6   FQLCDEDLTPAVAKALAREPYLAVDTETMGLIPQRDRLCVVQIANSAGEVVLLRLSRGVK 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            AP L  +L+    EKIFHY RFD+A+L Y  G+R  PVFCTKIAS+L RTYT++HGLKD
Sbjct: 66  QAPFLAQLLMAPSIEKIFHYARFDLAMLRYHLGIRAWPVFCTKIASKLARTYTSKHGLKD 125

Query: 122 NLKELLGINISKAQQSSDWSADD-LSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + EL G+ ++K  QSSDW A   LS EQL+YAA+DV +L  +R +  E L+R  R +LA
Sbjct: 126 VVSELCGVELNKTAQSSDWGAVHALSAEQLEYAANDVRYLIPVRHKLAEMLRREERWELA 185

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C   L    ELDLLG+ NV  F H
Sbjct: 186 QQCFQHLPTLVELDLLGFSNV--FEH 209


>gi|172035932|ref|YP_001802433.1| ribonuclease D [Cyanothece sp. ATCC 51142]
 gi|171697386|gb|ACB50367.1| ribonuclease D [Cyanothece sp. ATCC 51142]
          Length = 214

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 95/208 (45%), Positives = 128/208 (61%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +V + D+  E   R     AIA+DTET+GL+P+RDRLC+VQL    G V  IRI  G
Sbjct: 9   NKFQVCDRDLSPETLDRYLQAKAIAIDTETMGLIPQRDRLCLVQLCDPSGYVTAIRIEKG 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q+ A NL  +L ++   KIFHY RFD+A   Y F +   P+FCTK+AS+L RTYT  HGL
Sbjct: 69  QQTAENLKQLLENQNIIKIFHYARFDVAQFKYNFAIETEPIFCTKVASKLARTYTGSHGL 128

Query: 120 KDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K  ++E+ G+ + K+ QSSDW    +LS+ QL YAA+DV +L  L+ Q    LQR  R +
Sbjct: 129 KALVQEIEGVELDKSSQSSDWGNSQNLSEAQLSYAANDVRYLIPLKEQLITMLQREERWE 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C   +    ELDL+ ++  DIF H
Sbjct: 189 LAQKCMKVIPLFVELDLMYYK--DIFEH 214


>gi|67921652|ref|ZP_00515170.1| 3'-5' exonuclease [Crocosphaera watsonii WH 8501]
 gi|67856764|gb|EAM52005.1| 3'-5' exonuclease [Crocosphaera watsonii WH 8501]
          Length = 214

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 96/208 (46%), Positives = 129/208 (62%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +V + D+ +E   R    DA+A+DTET+GL+P+RDRLC+VQL    G V  IRI  G
Sbjct: 9   NNFQVCDRDLSSETLERYLKADALAIDTETMGLVPQRDRLCLVQLCDPSGYVTAIRIERG 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q  APNL  +L ++   KIFHY RFD+    Y F V   P+FCTK+AS+L RTYT  HGL
Sbjct: 69  QTEAPNLKQLLENKNIVKIFHYARFDVGQFKYNFSVETDPIFCTKVASKLARTYTGSHGL 128

Query: 120 KDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K  ++EL G+ + K+ QSSDW    +LS+ QL YAA+DV +L  LR Q    L+R  R +
Sbjct: 129 KSLVQELEGVELDKSSQSSDWGNSQNLSEAQLSYAANDVRYLIQLREQLITMLKREERWE 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           +A  C   +    ELDL+ ++  DIF H
Sbjct: 189 IAQKCMKVIPLFVELDLMYYK--DIFDH 214


>gi|86605802|ref|YP_474565.1| 3'-5' exonuclease family protein [Synechococcus sp. JA-3-3Ab]
 gi|86554344|gb|ABC99302.1| 3'-5' exonuclease family protein [Synechococcus sp. JA-3-3Ab]
          Length = 210

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 99/206 (48%), Positives = 135/206 (65%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            ++ + D+  E A        +AVDTET+GL+P+RDRLC+VQ++   G V ++R++ G K
Sbjct: 6   FQICDEDLTPEVAEALAGETLLAVDTETMGLIPQRDRLCVVQIANAAGEVVLLRLSRGVK 65

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            AP+L  +L D   EKIFHY RFD+A+L Y  G++  PVFCTKIAS+L RTYT++H LKD
Sbjct: 66  QAPHLARLLTDPNIEKIFHYARFDLAMLRYHLGIQAWPVFCTKIASKLARTYTSKHSLKD 125

Query: 122 NLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + EL G+ ++K  QSSDW     LS EQL+YAA+DV +L  +R +  + LQR  R +LA
Sbjct: 126 VVGELCGVELNKTAQSSDWGNVQALSPEQLEYAANDVRYLIPVRHKLAQMLQREERWELA 185

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C   L    ELDLLG+ NV  F H
Sbjct: 186 QRCFQHLPTLVELDLLGYGNV--FEH 209


>gi|119487500|ref|ZP_01621110.1| ribonuclease D [Lyngbya sp. PCC 8106]
 gi|119455669|gb|EAW36805.1| ribonuclease D [Lyngbya sp. PCC 8106]
          Length = 208

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 132/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M+  +V + DI  +  + Y   D +AVDTET+GL+P RDRLC+VQL    G V  ++IA 
Sbjct: 1   MSNFQVCDRDISEDILSSYLTADRLAVDTETMGLLPWRDRLCLVQLCDPKGQVTAVKIAK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
            Q  AP+L  +L      K+FH+ RFD+A L Y   + V PVFCTKIAS+L RTYT +HG
Sbjct: 61  DQTEAPHLKKLLEASNTLKVFHFARFDMATLLYYLDIDVNPVFCTKIASKLARTYTGRHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK+ ++EL  + + K+ QSSDW    +LS++QL YAA+DV +L  ++ +    L+R  R 
Sbjct: 121 LKELVQELEQVELDKSSQSSDWGNVGNLSEDQLNYAANDVRYLLNVQQKLMVMLEREERL 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           DLA +C + L     LDLL ++  DIF H
Sbjct: 181 DLAQNCFDCLPTIVTLDLLHYK--DIFEH 207


>gi|126660170|ref|ZP_01731288.1| 3'-5' exonuclease [Cyanothece sp. CCY0110]
 gi|126618535|gb|EAZ89286.1| 3'-5' exonuclease [Cyanothece sp. CCY0110]
          Length = 214

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 99/208 (47%), Positives = 132/208 (63%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +V + D+ +E   R    DAIA+DTET+GL+P+RDRLC+VQL    G V  IRI   
Sbjct: 9   NNFQVCDRDLTSETLDRYLQTDAIAIDTETMGLIPQRDRLCLVQLCDSSGYVTAIRIEKE 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           QK APNL  +L ++   KIFHY RFD+A   Y FG+   P+FCTK+AS+L RTYT  HGL
Sbjct: 69  QKEAPNLKKLLENQSIVKIFHYARFDVAQFKYNFGIDTAPIFCTKVASKLARTYTGSHGL 128

Query: 120 KDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K  ++E+ G+ + K+ QSSDW    +LS+ QL YAA+DV +L  LR Q    LQR  R +
Sbjct: 129 KALVQEIEGVELDKSSQSSDWGNSQNLSEAQLSYAANDVRYLIPLREQLITMLQREERWE 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           +A  C N +    ELDL+ ++  DIF H
Sbjct: 189 IAQKCMNVISVFVELDLMYYK--DIFEH 214


>gi|189184295|ref|YP_001938080.1| ribonuclease D [Orientia tsutsugamushi str. Ikeda]
 gi|189181066|dbj|BAG40846.1| ribonuclease D [Orientia tsutsugamushi str. Ikeda]
          Length = 210

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 94/212 (44%), Positives = 127/212 (59%), Gaps = 9/212 (4%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPG-------DGTVDII 54
             I +   DIP          +A+DTET+GL   RDRLC++Q           D  V ++
Sbjct: 1   MKIHIFINDIPDNLMIS--GDLAIDTETMGLNLIRDRLCLLQFCQESKDDTIDDKEVFLV 58

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
           +    Q N  NL  +L+D+ R KIFH+ RFD+A + Y  GV +  +FCT +AS+L RTYT
Sbjct: 59  KFEDQQYNCRNLKKLLMDDGRTKIFHFARFDLAAIQYYLGVTLNNIFCTNVASKLVRTYT 118

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           + HGLKD  +ELLGI ISK  QSSDW    L+ +Q +YAA DVV+LH ++    E L R 
Sbjct: 119 DSHGLKDLCRELLGIQISKQCQSSDWGGQSLTSDQEEYAAKDVVYLHRIKNILEEMLIRE 178

Query: 175 GRSDLATSCCNFLMDRAELDLLGWENVDIFSH 206
            R D+A     FL  RAELD++GW+++DI SH
Sbjct: 179 QRLDIAQKIFKFLPARAELDVIGWQDIDILSH 210


>gi|159030499|emb|CAO91403.1| rnd [Microcystis aeruginosa PCC 7806]
          Length = 209

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 97/209 (46%), Positives = 137/209 (65%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+  +  +RY  V++IAVDTET+GL+P RDRLC++QL    G V  IRI  
Sbjct: 3   LDNFQVCDRDLSDDLLSRYLGVNSIAVDTETMGLIPGRDRLCLIQLCDPSGFVTAIRIFR 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  ++ DE+ EK+FH+ RFD+A L  TFG+  +P+FCTKIAS+L RTYT+ HG
Sbjct: 63  GQTEAPNLKKVMEDERIEKVFHFARFDVAQLSQTFGIATQPIFCTKIASKLARTYTSSHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  ++EL GI + K  QSSDW    +L+ +QL YAA+DV +L ++R +    +QR  R 
Sbjct: 123 LKSLVQELEGIELDKTAQSSDWGNAVNLTPKQLSYAANDVRYLLSVRDKLIVMMQREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C + +     LDL  ++  DIF H
Sbjct: 183 ELAQKCFSCIPIFTALDLQQYK--DIFEH 209


>gi|209524209|ref|ZP_03272759.1| 3'-5' exonuclease [Arthrospira maxima CS-328]
 gi|209495300|gb|EDZ95605.1| 3'-5' exonuclease [Arthrospira maxima CS-328]
          Length = 207

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 131/209 (62%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M   +V + D+     + +   +A+A+DTET+GL+P RDRLC+VQ+    G V  IRI  
Sbjct: 1   MNDFQVCDRDLSDSRLSEFMAAEALAIDTETMGLLPGRDRLCLVQICDPKGQVVAIRIER 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  +L      K+FH+ RFD+A L +  G+ V PVFCTKIAS+L RTYT +HG
Sbjct: 61  GQREAPNLKTLLETANILKVFHFARFDVATLRHNLGIEVNPVFCTKIASKLARTYTGKHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + EL G+ + K+ QSSDW    +LS+ QL YAA+DV +L + + +  + L+R  R 
Sbjct: 121 LKDLIMELEGVELDKSSQSSDWGNAANLSENQLNYAANDVRYLLSAKDKLIQMLKREERW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           DLA  C   L     LDL+ ++  DIF H
Sbjct: 181 DLALDCFQCLPTIVTLDLMQFD--DIFKH 207


>gi|119513593|ref|ZP_01632605.1| 3'-5' exonuclease [Nodularia spumigena CCY9414]
 gi|119461746|gb|EAW42771.1| 3'-5' exonuclease [Nodularia spumigena CCY9414]
          Length = 189

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 98/188 (52%), Positives = 129/188 (68%), Gaps = 3/188 (1%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
            DAIAVDTET+GL+P+RDRLC+VQL   +G V  IRIA GQ  APNL  ++      KIF
Sbjct: 4   SDAIAVDTETMGLLPQRDRLCLVQLCNPEGKVTAIRIAKGQTEAPNLKILMEAVNVVKIF 63

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H+ RFDIA L +  G++V+PVFCTKIAS+L RTYTN+HGLK+ ++EL  I + K+ QSSD
Sbjct: 64  HFARFDIATLRHNLGIQVQPVFCTKIASKLARTYTNRHGLKEVVQELEHIELDKSSQSSD 123

Query: 140 WSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGW 198
           W    +LS+ QL YAA+DV +L ++R +  E LQR  R ++A  C   L     LDLL +
Sbjct: 124 WGNAANLSEAQLNYAANDVRYLISVRQKLMEMLQREERWEIAQECFQVLPTLVTLDLLQF 183

Query: 199 ENVDIFSH 206
           +  D+F H
Sbjct: 184 K--DLFEH 189


>gi|300867874|ref|ZP_07112515.1| 3'-5' exonuclease [Oscillatoria sp. PCC 6506]
 gi|300334110|emb|CBN57691.1| 3'-5' exonuclease [Oscillatoria sp. PCC 6506]
          Length = 210

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 99/209 (47%), Positives = 132/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           MT   V + D+P    + Y   +AIA DTET+GL+P RDRLC+VQL   +G V ++RIA 
Sbjct: 1   MTDFNVCDRDLPDTLLSHYLTAEAIAADTETMGLLPWRDRLCLVQLCDAEGIVTVVRIAK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  ++      KIFH+ RFD+A L Y   + V PVFC+KIAS+L RTYT +HG
Sbjct: 61  GQREAPNLKKLMEASNIVKIFHFARFDMATLKYHLDIHVAPVFCSKIASKLARTYTGKHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD ++EL  + + K  QSSDW    +LS++QL+YAA+DV +L + R +    LQR  R 
Sbjct: 121 LKDLVQELEQVELDKTAQSSDWGNAANLSEKQLRYAANDVRYLISAREKLITMLQREDRW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDLL ++  DIF H
Sbjct: 181 QLAQECFQCLPVIVSLDLLQFK--DIFDH 207


>gi|291571594|dbj|BAI93866.1| ribonuclease D [Arthrospira platensis NIES-39]
          Length = 207

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 131/209 (62%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M   +V + D+     + +   +A+A+DTET+GL+P RDRLC+VQ+    G V  IRI  
Sbjct: 1   MNDFQVCDRDLSDSRVSEFMEAEALAIDTETMGLLPWRDRLCLVQICDPKGQVVAIRIER 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  +L      K+FH+ RFD+A L +  G+ V PVFCTKIAS+L RTYT +HG
Sbjct: 61  GQREAPNLKTLLETTNILKVFHFARFDVATLRHNLGIEVNPVFCTKIASKLARTYTGKHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + EL G+ + K+ QSSDW    +LS+ QL YAA+DV +L + + +  + L+R  R 
Sbjct: 121 LKDLIMELEGVELDKSSQSSDWGNAANLSENQLNYAANDVRYLLSAKDKLNQMLKREERW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           DLA  C   L     LDL+ ++  DIF H
Sbjct: 181 DLALDCFQCLPTIVTLDLMQFD--DIFKH 207


>gi|148284142|ref|YP_001248232.1| ribonuclease D [Orientia tsutsugamushi str. Boryong]
 gi|146739581|emb|CAM79331.1| ribonuclease D [Orientia tsutsugamushi str. Boryong]
          Length = 210

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 94/212 (44%), Positives = 127/212 (59%), Gaps = 9/212 (4%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPG-------DGTVDII 54
             I +   DIP          +A+DTET+GL   RDRLC++Q           D  V ++
Sbjct: 1   MKIHIFINDIPDNLMIS--GDLAIDTETMGLNFARDRLCLLQFCQESKDDNIDDKEVFLV 58

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
           +    Q N+ NL  +L+D  R KIFH+ RFD+A + Y  GV +  +FCT +AS+L RTYT
Sbjct: 59  KFEDQQYNSHNLKKLLMDCSRTKIFHFARFDLAAIQYYLGVTLNNIFCTNVASKLVRTYT 118

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           + HGLKD  +ELLGI ISK  QSSDW    L+ +Q +YAA DVV+LH ++    E L R 
Sbjct: 119 DSHGLKDLCRELLGIQISKQCQSSDWGRQSLTSDQEEYAAKDVVYLHRIKNILEEMLIRE 178

Query: 175 GRSDLATSCCNFLMDRAELDLLGWENVDIFSH 206
            R D+A     FL  RAELD++GW+++DI SH
Sbjct: 179 HRLDIAQKIFKFLPARAELDVIGWQDIDILSH 210


>gi|298491354|ref|YP_003721531.1| 3'-5' exonuclease ['Nostoc azollae' 0708]
 gi|298233272|gb|ADI64408.1| 3'-5' exonuclease ['Nostoc azollae' 0708]
          Length = 209

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 97/209 (46%), Positives = 134/209 (64%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+ A   +     +AIAVDTET+GL+P+RDRLC+VQL    G V  I IA 
Sbjct: 3   LPDFQVSDRDLDAASLSEYLQSEAIAVDTETMGLLPQRDRLCLVQLCNSQGKVTAICIAK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  +L      K+FH+ RFD+A L +   ++V+PVFCTKIAS+L RTYTN HG
Sbjct: 63  GQTEAPNLKQLLEATHILKVFHFARFDVATLRHNLEIQVQPVFCTKIASKLARTYTNLHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD ++EL  + + K+ QSSDW    +LS+ QL YAA+DV +L  ++ + T+ L+R GR 
Sbjct: 123 LKDVVQELEQVELDKSAQSSDWGNAVNLSETQLSYAANDVRYLLNVQQKLTQMLEREGRW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C   L     LDLL ++  D+F H
Sbjct: 183 ELAQQCFQVLPTLVSLDLLQFK--DLFEH 209


>gi|332709748|ref|ZP_08429707.1| ribonuclease D [Lyngbya majuscula 3L]
 gi|332351575|gb|EGJ31156.1| ribonuclease D [Lyngbya majuscula 3L]
          Length = 216

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 95/209 (45%), Positives = 130/209 (62%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+P      Y   D++AVDTET+GL+ +RDRLC+VQL    G V  +RI  
Sbjct: 10  LKDFQVCDRDLPESICQEYLRADSLAVDTETMGLIYQRDRLCLVQLCDPQGRVTFVRIDK 69

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  AP L  +L      K+FH+ RFD+A+L    G+ V PVFCTKIAS+L RTYT+ HG
Sbjct: 70  GQTEAPRLKQLLEATNVLKVFHFARFDVAMLRQNLGIDVNPVFCTKIASKLARTYTSSHG 129

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK+ +KEL  I++ K+ QSSDW    +LSD+QL+YAA+DV +L  +R +    L+R  R 
Sbjct: 130 LKELVKELERIDLDKSAQSSDWGNVANLSDQQLEYAANDVRYLLNVRQKLINMLEREDRW 189

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C   L     LDLL +   D+F H
Sbjct: 190 ELAQQCFEALPTMVSLDLLHYR--DVFEH 216


>gi|284053636|ref|ZP_06383846.1| 3'-5' exonuclease [Arthrospira platensis str. Paraca]
          Length = 209

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 94/209 (44%), Positives = 131/209 (62%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M   +V + D+     + +   +A+A+DTET+GL+P RDRLC+VQ+    G V  IRI  
Sbjct: 3   MNDFQVCDRDLSDSRVSEFMEAEALAIDTETMGLLPWRDRLCLVQICDPKGQVVAIRIER 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ+ APNL  +L      K+FH+ RFD+A L +  G+ V PVFCTKIAS+L RTYT +HG
Sbjct: 63  GQREAPNLKTLLETTNILKVFHFARFDVATLRHNLGIEVNPVFCTKIASKLARTYTGKHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + EL G+ + K+ QSSDW    +LS+ QL YAA+DV +L + + +  + L+R  R 
Sbjct: 123 LKDLIMELEGVELDKSSQSSDWGNAANLSENQLNYAANDVRYLLSAKDKLNQMLKREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           DLA  C   L     LDL+ ++  DIF H
Sbjct: 183 DLALDCFQCLPTIVTLDLMQFD--DIFKH 209


>gi|282899306|ref|ZP_06307275.1| 3'-5' exonuclease [Cylindrospermopsis raciborskii CS-505]
 gi|281195763|gb|EFA70691.1| 3'-5' exonuclease [Cylindrospermopsis raciborskii CS-505]
          Length = 209

 Score =  161 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 98/209 (46%), Positives = 137/209 (65%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V +GD+     + Y   DA+AVDTET+GL+P+RDRLC+VQL   +G V  +RIA 
Sbjct: 3   LDDFQVVDGDLDYPTLSEYLRSDALAVDTETMGLLPQRDRLCLVQLCNPEGKVTAVRIAK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ +APNL  +L      K+FH+ RFD+A L +   + V+PVFCTKIAS+L RTYTN+HG
Sbjct: 63  GQTHAPNLQQLLESTDVVKVFHFARFDLATLRHNLKIHVQPVFCTKIASKLARTYTNRHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK+ ++EL  + + K+ QSSDW     LSD QL YAA+DV +L +L+ + ++ LQR  R 
Sbjct: 123 LKELVQELEQVELDKSSQSSDWGNPVSLSDAQLSYAANDVRYLLSLKQKLSQMLQREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C +FL     LDLL ++ +  F H
Sbjct: 183 QLAQECFSFLPTLVSLDLLQFKEL--FEH 209


>gi|282897776|ref|ZP_06305775.1| 3'-5' exonuclease [Raphidiopsis brookii D9]
 gi|281197455|gb|EFA72352.1| 3'-5' exonuclease [Raphidiopsis brookii D9]
          Length = 209

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 98/209 (46%), Positives = 137/209 (65%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V +GD+     + Y   DA+AVDTET+GL+P+RDRLC+VQL   +G V  +RIA 
Sbjct: 3   LDDFQVLDGDLDHPTLSEYLRSDALAVDTETMGLVPQRDRLCLVQLCNPEGKVTAVRIAK 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ +APNL  +L      K+FH+ RFD+A L +   + V+PVFCTKIAS+L RTYTN+HG
Sbjct: 63  GQTHAPNLQQLLESTHVVKVFHFARFDLATLRHNLKIYVQPVFCTKIASKLARTYTNRHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK+ ++EL  + + K+ QSSDW     LSD QL YAA+DV +L +L+ + ++ LQR  R 
Sbjct: 123 LKELVQELEQLELDKSSQSSDWGNPVSLSDAQLSYAANDVRYLLSLKQKLSQMLQREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            L   C +FL     LDLL ++  D+F H
Sbjct: 183 QLVQECFSFLPTLVSLDLLQFK--DLFEH 209


>gi|170078658|ref|YP_001735296.1| putative ribonuclease D [Synechococcus sp. PCC 7002]
 gi|157811866|gb|ABV80286.1| ribonuclease D [Synechococcus sp. PCC 7002]
 gi|169886327|gb|ACB00041.1| putative ribonuclease D [Synechococcus sp. PCC 7002]
          Length = 207

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 97/209 (46%), Positives = 126/209 (60%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M    + + D+  E   R     AIA+DTET+GL P RDRLC+VQL    G V  IRIA 
Sbjct: 1   MDQFALFDQDLSLEILERYLKSGAIAIDTETMGLNPYRDRLCLVQLCDDAGYVSAIRIAQ 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  ++   +  K+FH+ RFD+A L + FG+  RP FCTKIAS+L RTYT+ HG
Sbjct: 61  GQTAAPNLKALMEAPEITKVFHFARFDLAQLRHVFGIETRPFFCTKIASKLGRTYTSSHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK  +KEL+G+ + K+ QSSDW     LS EQL+YA++DV +L  +  + T  LQR  R 
Sbjct: 121 LKALVKELMGVELDKSAQSSDWGNVAVLSAEQLKYASNDVRYLIPMMRKLTAMLQRENRW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            L   C   L     LDL  ++NV  F H
Sbjct: 181 PLMEECLRCLPTFISLDLAFYDNV--FEH 207


>gi|220907657|ref|YP_002482968.1| 3'-5' exonuclease [Cyanothece sp. PCC 7425]
 gi|219864268|gb|ACL44607.1| 3'-5' exonuclease [Cyanothece sp. PCC 7425]
          Length = 217

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 98/208 (47%), Positives = 138/208 (66%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           T  +V++ D+PA+  + +   D IAVDTET+GL P+RDRLC+VQL+   G + +IRI  G
Sbjct: 12  TDFQVYDRDLPADTLSYFLTADRIAVDTETMGLKPQRDRLCLVQLAHPQGLITVIRIGQG 71

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q++AP+L  +L      K+FH+ RFDI  L Y   + V+P+FCTKIAS+L RTY+ +HGL
Sbjct: 72  QRSAPHLKQLLEHPGTTKVFHFARFDITTLRYHLDIWVQPLFCTKIASKLARTYSPRHGL 131

Query: 120 KDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           KD ++EL G+ + K  QSSDW    +L++EQL+YA++DV +L A + +  E LQR  R  
Sbjct: 132 KDLIRELEGVELDKTVQSSDWGNPNNLTEEQLRYASNDVRYLLAAQAKLVEMLQRENRWQ 191

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C + L   A LDLL +E   IF H
Sbjct: 192 LAQECFHCLPTLASLDLLEFEA--IFEH 217


>gi|254409855|ref|ZP_05023636.1| 3'-5' exonuclease, putative [Microcoleus chthonoplastes PCC 7420]
 gi|196183852|gb|EDX78835.1| 3'-5' exonuclease, putative [Microcoleus chthonoplastes PCC 7420]
          Length = 207

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 97/209 (46%), Positives = 129/209 (61%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           M   +V + D+P          +AIAVDTET+GL+ +RDRLC+VQL      V +IRI  
Sbjct: 1   MAEFQVCDRDLPDALLKTYLNAEAIAVDTETMGLIYQRDRLCLVQLCDPQDRVTVIRIDK 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
            Q  APNL  +L  +   K+FH+ RFD+A+L     + V+PVFCTKIAS+L RTYTN+HG
Sbjct: 61  KQTEAPNLKQLLEAQTVLKVFHFARFDLAILRQNLDIYVQPVFCTKIASKLARTYTNRHG 120

Query: 119 LKDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + +L  + + K+ QSSDW    +LSDEQL+YAA+DV +L ++R +    LQR  R 
Sbjct: 121 LKDLVMDLEQVELDKSSQSSDWGNPNNLSDEQLRYAANDVRYLLSVRQKLITMLQREERW 180

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA  C   L     LDLL +   DIF H
Sbjct: 181 QLAQECFEALSVMVSLDLLLYR--DIFEH 207


>gi|319898371|ref|YP_004158464.1| Ribonuclease D [Bartonella clarridgeiae 73]
 gi|319402335|emb|CBI75874.1| Ribonuclease D [Bartonella clarridgeiae 73]
          Length = 193

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 119/186 (63%), Positives = 147/186 (79%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           ++IA+DTETLGL P RDRLC+VQLS GDGT DII++A GQ  APNLV +L D+   KIFH
Sbjct: 7   NSIAIDTETLGLKPHRDRLCVVQLSSGDGTADIIQVAKGQNRAPNLVALLEDKAITKIFH 66

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
           +GRFD+A+L +TFGV    VFCTKIAS+LTRTYT++HGLK+   ELL INISK QQSSDW
Sbjct: 67  FGRFDLAILAHTFGVIPDVVFCTKIASKLTRTYTDRHGLKEICSELLNINISKQQQSSDW 126

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLLGWEN 200
           +AD LS  Q++YAASDV++LH L+  F E+L+R  R D+A +C  FL  RA+LDLLGW  
Sbjct: 127 AADALSRAQIEYAASDVLYLHRLKNIFEERLKREEREDIAKACFQFLPVRAKLDLLGWSE 186

Query: 201 VDIFSH 206
           VDIF+H
Sbjct: 187 VDIFAH 192


>gi|17231283|ref|NP_487831.1| ribonuclease D [Nostoc sp. PCC 7120]
 gi|17132925|dbj|BAB75490.1| ribonuclease D [Nostoc sp. PCC 7120]
          Length = 209

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 92/209 (44%), Positives = 131/209 (62%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+     A+    +AIAVDTET+GL+P+RDRLC++QL   +G V  IRIA 
Sbjct: 3   LQDFQVGDRDLSDATVAQYLQSEAIAVDTETMGLLPQRDRLCLIQLCNPEGKVTAIRIAQ 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  +L      K+FH+ RFD+A L +   + V+P+FCTKIAS+L RTYTN+HG
Sbjct: 63  GQTAAPNLKKLLEATNVLKVFHFARFDVATLLHHLDIHVQPIFCTKIASKLARTYTNRHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + EL  + + K+ Q SDW    +L++ QL YAA+DV +L + + +    L+R  R 
Sbjct: 123 LKDLVHELEQVELDKSAQGSDWGNAANLTEAQLSYAANDVRYLLSAQQKLVAMLKREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C   L     LDLL ++  D+F H
Sbjct: 183 ELAQQCFQVLPTIVSLDLLQFK--DLFEH 209


>gi|262276702|ref|ZP_06054497.1| ribonuclease D [alpha proteobacterium HIMB114]
 gi|262225133|gb|EEY75590.1| ribonuclease D [alpha proteobacterium HIMB114]
          Length = 204

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 121/204 (59%), Gaps = 3/204 (1%)

Query: 3   TIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
              +   D+  + + +   +IA+D E  GL P  D+L ++Q+  G   V  ++   G+ +
Sbjct: 4   KYNISYNDLEDDSSLKNASSIAIDGEFSGLNPLTDKLHLLQICDGSNFVHFVKFD-GEYD 62

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           AP L  +L +   +KIFH+GR D+  +     + V+ ++ TKIAS++ R +T+ HGLKD 
Sbjct: 63  APKLKKVLENNSIKKIFHFGRADLGFIKKHLNINVKNIYDTKIASKICRKFTSSHGLKDL 122

Query: 123 LKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            ++L+ IN+SK  Q+SDW   + SD+Q++YAA+DV+HLH ++ +  + L R  + +LA  
Sbjct: 123 SRDLININLSKEHQTSDWGKKEYSDDQIKYAANDVLHLHKIKEELDKILIRENKVELAEK 182

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C  FL  R +LDL G    DIF H
Sbjct: 183 CFQFLETRTDLDLCGLG--DIFEH 204


>gi|113955257|ref|YP_729699.1| 3'-5' exonuclease family protein [Synechococcus sp. CC9311]
 gi|113882608|gb|ABI47566.1| 3'-5' exonuclease family protein [Synechococcus sp. CC9311]
          Length = 214

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 94/216 (43%), Positives = 129/216 (59%), Gaps = 12/216 (5%)

Query: 1   MTTIR-------VHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTV 51
           MT I        V +GD+ A+ A RY    A+AVDTE +GL+  RDRLC+VQ+   +  V
Sbjct: 1   MTDISAQPRAFAVFDGDLDADWAERYSHATALAVDTEAMGLIHGRDRLCLVQICDAEDQV 60

Query: 52  DIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTR 111
             +RIA GQ  AP L  ++     EK+FH+ RFD+A L    G+RV P+FCTK+ SRL R
Sbjct: 61  SCVRIALGQTEAPRLKELMERASIEKVFHFARFDVAALATGLGIRVNPIFCTKVGSRLAR 120

Query: 112 TYTNQHGLKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEK 170
           TY+ +HGLK+ + EL+G+ + K  QSSDW   D+LS+ QL YAA+D  +L   R +  E 
Sbjct: 121 TYSPRHGLKEVVMELVGVELDKQAQSSDWGRVDELSETQLAYAANDARYLLPARDRLKEM 180

Query: 171 LQRLGRSDLATSCCNFLMDRAELDLLGWENVDIFSH 206
           LQR GR +LA  C   +   ++LD   +     F H
Sbjct: 181 LQREGRWELAERCFECIPVMSDLDRFRFNQT--FEH 214


>gi|116075800|ref|ZP_01473059.1| putative ribonuclease D [Synechococcus sp. RS9916]
 gi|116067115|gb|EAU72870.1| putative ribonuclease D [Synechococcus sp. RS9916]
          Length = 214

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 93/204 (45%), Positives = 126/204 (61%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A  A RY    A+AVDTE +GL+  RDRLC+VQ+   D  V  +RI  GQ  A
Sbjct: 13  VFDGDLDAAWAERYGRAKALAVDTEAMGLIHGRDRLCLVQICDPDDHVACVRIGLGQTEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++  +  EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTYT +HGLKD +
Sbjct: 73  PRLEALMESKAVEKVFHFARFDVAALASGLGIAVNPIFCTKVASRLARTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L++ QL YAA+D  +L   R +    L+R GR +LA  
Sbjct: 133 MELVGVELDKQAQSSDWGRVDELTEAQLAYAANDARYLLPARDRLELMLRREGRWELAER 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   A+LD L +  V  F H
Sbjct: 193 CFPCIPVIADLDRLRFNQV--FEH 214


>gi|318042597|ref|ZP_07974553.1| ribonuclease [Synechococcus sp. CB0101]
          Length = 234

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 91/204 (44%), Positives = 121/204 (59%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+  E         A+AVDTE +GL+  RDRLC+VQ+S     V  IRI  GQ  A
Sbjct: 31  VLDGDLTPEWHELLGRSSALAVDTEAMGLVHGRDRLCLVQISDDQDNVCCIRILRGQSEA 90

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++      K+FH+ RFD+A L    G+ V P+FCTK+ASRL RTYTN+HGLK+ +
Sbjct: 91  PLLKQLMEHSGIVKVFHFARFDVAALGEGLGIAVNPLFCTKVASRLARTYTNRHGLKELV 150

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL G+ + K  QSSDW   ++LS+ QL YAA+DV +L   R + T+ L+R  R DLA  
Sbjct: 151 SELCGVELDKGAQSSDWGRVEELSETQLAYAANDVRYLLPARERLTQMLEREERLDLAQR 210

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
               +   AELD   +    IF H
Sbjct: 211 SFQCIPVIAELDRGRFGA--IFEH 232


>gi|75908135|ref|YP_322431.1| 3'-5' exonuclease [Anabaena variabilis ATCC 29413]
 gi|75701860|gb|ABA21536.1| 3'-5' exonuclease [Anabaena variabilis ATCC 29413]
          Length = 209

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 93/209 (44%), Positives = 131/209 (62%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           +   +V + D+      +    +AIAVDTET+GL+P+RDRLC++QL   +G V  IRIA 
Sbjct: 3   LQDFQVGDRDLSDAAVDQYLQSEAIAVDTETMGLLPQRDRLCLIQLCNPEGKVTAIRIAR 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ  APNL  +L      K+FH+ RFD+A L +   + V+P+FCTKIAS+L RTYTN+HG
Sbjct: 63  GQTAAPNLKKLLEATNVLKVFHFARFDVATLRHHLDIHVQPIFCTKIASKLARTYTNRHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LKD + EL  + + K+ QSSDW    +L+D QL YAA+DV +L + + +    L+R  R 
Sbjct: 123 LKDLVYELEQVELDKSAQSSDWGNAANLTDAQLSYAANDVRYLLSAQQKLVAMLKREERW 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA  C   L     LDLL ++  D+F H
Sbjct: 183 ELAQQCFQVLPTIVSLDLLQFK--DLFEH 209


>gi|297183461|gb|ADI19592.1| ribonuclease d [uncultured SAR11 cluster bacterium HF0770_37D02]
          Length = 214

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 85/211 (40%), Positives = 121/211 (57%), Gaps = 6/211 (2%)

Query: 1   MTTIRVHEGDIPAECA--ARYVDAIAVDTETLGL-MPRRDRLCIVQLSPGDGTVDIIRIA 57
           MT I   + DI AE         ++A+DTE  GL +P RD+L +VQ S G+    II+  
Sbjct: 5   MTKIYKFQDDIAAEALKELENHSSLAIDTEGSGLQIPHRDKLSLVQFSTGNNDAYIIQPN 64

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                APN+  +L ++K  KI HY R+DI+ L Y     V+ +F TK+AS+L RTY+  H
Sbjct: 65  RKDYKAPNIKKILENDKITKIGHYLRYDISGLEYFLKCNVKNIFDTKLASKLCRTYSQNH 124

Query: 118 GLKDNLKELLGINISKAQQSSDWSA--DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           GLKD   E  G  + K   SSDW+   D+L+D QLQY ++DV++LH ++ +  + L R  
Sbjct: 125 GLKDLALEFCGKKLDKRLGSSDWNKNLDELTDAQLQYCSNDVIYLHKIKDELYKMLVREN 184

Query: 176 RSDLATSCCNFLMDRAELDLLGWENVDIFSH 206
           R +L  +C  FL  R +LD  G+   DIF H
Sbjct: 185 RLELYENCIKFLKTRIKLDQSGFAE-DIFQH 214


>gi|33863970|ref|NP_895530.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9313]
 gi|33635554|emb|CAE21878.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9313]
          Length = 214

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 91/204 (44%), Positives = 127/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ ++ A RY    AIAVDTE +GL+  RDRLC+VQ+      V  +RI  GQ +A
Sbjct: 13  VFDGDLDSDWANRYLRASAIAVDTEAMGLIHGRDRLCLVQICDPADNVACVRIGLGQTSA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+ +HGLK+ +
Sbjct: 73  PRLQKLMEAPSVEKVFHFARFDVAALASGLGIYVLPIFCTKVASRLARTYSPRHGLKEVV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   ++LSD QL YAA+D  +L   R +    L+R GR ++A  
Sbjct: 133 MELVGVELDKQAQSSDWGRVEELSDVQLAYAANDARYLLPARQRLEMMLRREGRWEIAQR 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C + +   AELD L +    IF H
Sbjct: 193 CFSCIPVIAELDRLRFTQ--IFEH 214


>gi|260436505|ref|ZP_05790475.1| 3'-5' exonuclease [Synechococcus sp. WH 8109]
 gi|260414379|gb|EEX07675.1| 3'-5' exonuclease [Synechococcus sp. WH 8109]
          Length = 225

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 94/204 (46%), Positives = 124/204 (60%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V + D+ A    R      +AVDTE +GL+  RDRLC+VQ++  +  V  +RI  GQ  A
Sbjct: 24  VFDRDLDAAWTERYLQSPRLAVDTEAMGLIHGRDRLCLVQIADAEDRVACVRIGLGQTEA 83

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L     EK+FH+ RFD+A L    G+ V PVFCTK+ SRL RTYT +HGLKD +
Sbjct: 84  PNLKRLLEAPTVEKVFHFARFDVAALAAGLGIEVNPVFCTKVGSRLGRTYTPRHGLKDLV 143

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R +  + L+R GR DLA  
Sbjct: 144 MELVGVELDKGAQSSDWGRVDELTDAQLAYAANDVRYLLPARERLEKMLRREGRWDLAQR 203

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   AELD L +    IF H
Sbjct: 204 CFQCVPVVAELDRLRFHQ--IFEH 225


>gi|78211959|ref|YP_380738.1| 3'-5' exonuclease [Synechococcus sp. CC9605]
 gi|78196418|gb|ABB34183.1| 3'-5' exonuclease [Synechococcus sp. CC9605]
          Length = 214

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 92/204 (45%), Positives = 122/204 (59%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V + D+ A    R      +AVDTE +GL+  RDRLC+VQ++  +  V  +RI  GQ  A
Sbjct: 13  VFDRDLDAAWTERYLQSPRLAVDTEAMGLIHGRDRLCLVQIADAEDRVACVRIGLGQTEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +      EK+FH+ RFD+A L     + V PVFCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLKRLFEAPTVEKVFHFARFDVAALAAGLSIEVNPVFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R +  + L+R GR DLA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELTDAQLAYAANDVRYLLPARERLEQMLRREGRWDLAQR 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   AELD L +    IF H
Sbjct: 193 CFQCVPVVAELDRLRFHQ--IFEH 214


>gi|158334839|ref|YP_001516011.1| ribonuclease D [Acaryochloris marina MBIC11017]
 gi|158305080|gb|ABW26697.1| ribonuclease D [Acaryochloris marina MBIC11017]
          Length = 209

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 133/209 (63%), Gaps = 5/209 (2%)

Query: 1   MTTIRVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           ++  +V + D+           D IAVDTET+GL P RDRLC+VQ+   +G V ++RIA 
Sbjct: 3   LSEFQVCDRDLSDAFLQDYLQADRIAVDTETMGLKPHRDRLCLVQICNPEGQVTVVRIAQ 62

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           GQ +APNL  ++  +   K+FH+ RFDIA L +   +   P+FCTKIAS+L RTY+ +HG
Sbjct: 63  GQMDAPNLKQLMESDTVLKVFHFARFDIATLLHHLDIETMPIFCTKIASKLVRTYSPRHG 122

Query: 119 LKDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           LK+ ++EL+G  + K+ QSSDW   ++LS+EQL YA++DV +L + +    + L+R  R 
Sbjct: 123 LKELVRELVGEELDKSAQSSDWGNAENLSEEQLNYASNDVRYLLSAQATLVKMLEREERL 182

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
           +LA +C   L     LDL+ ++N  IF H
Sbjct: 183 ELAMACFQCLPTIVTLDLMHFDN--IFEH 209


>gi|262276742|ref|ZP_06054535.1| 3'-5' exonuclease family protein [alpha proteobacterium HIMB114]
 gi|262223845|gb|EEY74304.1| 3'-5' exonuclease family protein [alpha proteobacterium HIMB114]
          Length = 206

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 123/208 (59%), Gaps = 4/208 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M   + +  DI  + + +   +IA+D E  GL P  D+L ++QL  G   V +++   G+
Sbjct: 1   MKNYKFYLSDIDGDTSLKNASSIAIDGEFSGLNPLTDKLHLLQLCDGSDFVHLVKF-EGK 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            NAPNL  +L + K +KIFH+GR D+A L     + V  +F TKI S+++R ++  HGLK
Sbjct: 60  YNAPNLKEILENNKIKKIFHFGRADLAFLKQHLDIHVTNIFDTKIGSKISRKFSPHHGLK 119

Query: 121 DNLKELLGINISKAQQSSDWSAD--DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           D  ++L+ IN+SK  Q+SDW     + S++Q+ YA  DV++LH ++ +  + L+R  + +
Sbjct: 120 DLCRDLININLSKEYQTSDWGKKIEEYSEDQILYACKDVLYLHKIKNELEKILKRENKLE 179

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C  FL  R  LDL+G    DIF H
Sbjct: 180 LAEQCFKFLETRTALDLVGLTG-DIFEH 206


>gi|167041251|gb|ABZ06007.1| putative 3'-5' exonuclease [uncultured marine microorganism
           HF4000_005D21]
 gi|167045755|gb|ABZ10401.1| putative 3'-5' exonuclease [uncultured marine bacterium
           HF4000_APKG3108]
          Length = 214

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 81/211 (38%), Positives = 115/211 (54%), Gaps = 6/211 (2%)

Query: 1   MTTIRVHEGDIPAECA--ARYVDAIAVDTETLGL-MPRRDRLCIVQLSPGDGTVDIIRIA 57
           MT I   + DI  +         ++A+DTE  GL +P RD+L +VQ S G+    I++  
Sbjct: 5   MTKIYKFQDDISTDALKELEKHSSLAIDTEGSGLQIPHRDKLSLVQFSAGNNDAYIVQPN 64

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                APN+V +L + K  KI HY R+D++ L Y     V+ +F TKIAS+L RTY+  H
Sbjct: 65  RKSYKAPNIVKILENAKITKIGHYLRYDVSGLEYFLKCNVKNIFDTKIASKLCRTYSQNH 124

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLS--DEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           GLKD   E     + K   SSDW+ +     D QLQY ++DV++LH ++    + L R  
Sbjct: 125 GLKDLALEFCSKKLDKRLGSSDWNKNLYELTDAQLQYCSNDVIYLHKIKDALYKMLVREN 184

Query: 176 RSDLATSCCNFLMDRAELDLLGWENVDIFSH 206
           R +L  SC  FL  R +LD  G+   DIF H
Sbjct: 185 RLELYESCIQFLKTRIKLDQSGFAE-DIFQH 214


>gi|124026737|ref|YP_001015852.1| putative ribonuclease D [Prochlorococcus marinus str. NATL1A]
 gi|123961805|gb|ABM76588.1| putative ribonuclease D [Prochlorococcus marinus str. NATL1A]
          Length = 214

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 125/208 (60%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAE--CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           +T  + + DI +E   A R   A+AVDTE +GL+  RDRLC++Q+      V  IRI   
Sbjct: 9   STFNIFDQDIDSETEIALRSSSALAVDTEAMGLIHGRDRLCLIQICDEFDNVICIRIERN 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q +AP+L  +L ++  EK+FH+ RFD+A L     + V P+FCTKIAS++ RTY+ +HGL
Sbjct: 69  QHSAPHLKSILENKTIEKVFHFARFDVAALASNLNINVNPIFCTKIASKIGRTYSPRHGL 128

Query: 120 KDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K+ + E +G+ + K  QSSDW    DL+ +QL YAA+DV +L   + +  E L+R  R  
Sbjct: 129 KEVVLETVGVELDKQAQSSDWGKVGDLTQKQLIYAANDVRYLLGAKHKLEEMLKREERWG 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C   +   +ELD   + N  IF H
Sbjct: 189 LAQKCFQCVPVLSELDRRRFTN--IFDH 214


>gi|87124930|ref|ZP_01080777.1| putative ribonuclease D [Synechococcus sp. RS9917]
 gi|86167250|gb|EAQ68510.1| putative ribonuclease D [Synechococcus sp. RS9917]
          Length = 213

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 92/207 (44%), Positives = 125/207 (60%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
              V +GD+ A  A RY  A  +AVDTE +GL+  RDRLC+VQL  GD  V  +RI  GQ
Sbjct: 9   DFAVFDGDLDAAWADRYAKASRLAVDTEAMGLVHGRDRLCLVQLCDGDDNVSCVRIGLGQ 68

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
             AP L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+ +HGLK
Sbjct: 69  CEAPRLKALMEAAAVEKVFHFARFDVAALASGLGIAVDPIFCTKVASRLARTYSPKHGLK 128

Query: 121 DNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           + + EL+G+ + K  QSSDW   ++LS+ QL YAA+D  +L   R +    L+R GR +L
Sbjct: 129 EVVLELVGVELDKQAQSSDWGRVEELSEAQLAYAANDARYLLPARERLEVMLRREGRWEL 188

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   +ELD L +     F H
Sbjct: 189 AQRCFRCIPVMSELDRLRFAQT--FEH 213


>gi|22298627|ref|NP_681874.1| putative ribonuclease D [Thermosynechococcus elongatus BP-1]
 gi|22294807|dbj|BAC08636.1| tlr1083 [Thermosynechococcus elongatus BP-1]
          Length = 211

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 128/203 (63%), Gaps = 5/203 (2%)

Query: 7   HEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
            + D+     A     D +AVDTET+GL   RDRLC+VQ+   +G V +++I  GQK AP
Sbjct: 10  FDYDLSPTALAHFLNADQLAVDTETMGLNIPRDRLCLVQVCDPEGQVAVVKIGRGQKEAP 69

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
           +L  +L   +  KIFHY RFD+A L Y  G+RV PVFCTKIAS++ RTY+ +HGLKD + 
Sbjct: 70  HLQQLLEHPRITKIFHYARFDLATLRYHLGIRVHPVFCTKIASKIARTYSPRHGLKDLVL 129

Query: 125 ELLGINISKAQQSSDWSADD-LSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +LLG+ I K+ QSSDW     L ++QL+YAA+DV +L  LR Q T  L+R  R +L  + 
Sbjct: 130 DLLGVEIDKSAQSSDWGNATALREDQLRYAANDVRYLIPLRQQLTAMLKREERFELVQTA 189

Query: 184 CNFLMDRAELDLLGWENVDIFSH 206
            + L    +LDL G+  V  F H
Sbjct: 190 LSCLPAIVDLDLAGYTQV--FEH 210


>gi|33866568|ref|NP_898127.1| putative ribonuclease D [Synechococcus sp. WH 8102]
 gi|33633346|emb|CAE08551.1| putative ribonuclease D [Synechococcus sp. WH 8102]
          Length = 214

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 96/204 (47%), Positives = 128/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A+   RY  + A+AVDTE +GL+  RDRLC+VQ++  D  V  IRI  GQ +A
Sbjct: 13  VFDGDLDADWTERYLRMSALAVDTEAMGLIHGRDRLCLVQIADADDRVCCIRIGLGQTSA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +L     EK+FH+ RFD+A L    G+ V P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLQRLLEAASVEKVFHFARFDVAALASGLGIAVSPIFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+LSD QL YAA+DV +L   R +    L+R GR DLA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELSDVQLAYAANDVRYLLPARQKLEAMLRREGRWDLAQR 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   A+LD + +     F H
Sbjct: 193 CFGCIPVIADLDRMRFNQT--FEH 214


>gi|56750860|ref|YP_171561.1| ribonuclease D [Synechococcus elongatus PCC 6301]
 gi|81299489|ref|YP_399697.1| 3'-5' exonuclease [Synechococcus elongatus PCC 7942]
 gi|56685819|dbj|BAD79041.1| probable ribonuclease D [Synechococcus elongatus PCC 6301]
 gi|81168370|gb|ABB56710.1| 3'-5' exonuclease [Synechococcus elongatus PCC 7942]
          Length = 211

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 96/208 (46%), Positives = 126/208 (60%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAECAA--RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           +   + E D+  E  A  R   AIA+DTE +GL   RDRLC+VQL    G    +RIA G
Sbjct: 6   SDFHLCEQDLTDELLAQYRQSPAIAIDTEAMGLNFHRDRLCLVQLCDSAGITTCVRIAQG 65

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q  APNL  +  D +  K+FH+ RFDI  L +  G+ V+P+FCTKIAS+L RTY++QHGL
Sbjct: 66  QTVAPNLQALCEDPQITKVFHFARFDITALKHGLGIAVQPIFCTKIASKLARTYSSQHGL 125

Query: 120 KDNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K  L+EL+G+ + K  QSSDW     LS EQ++YA +DV +L A + + T  LQR GR  
Sbjct: 126 KSLLQELVGVELDKTAQSSDWGNAAALSHEQMRYACNDVRYLLAAQAKLTTMLQREGRWQ 185

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C   L   A LDL  + +V  F H
Sbjct: 186 LAQDCFACLPTFAALDLAQFGSV--FEH 211


>gi|72382995|ref|YP_292350.1| putative ribonuclease D [Prochlorococcus marinus str. NATL2A]
 gi|72002845|gb|AAZ58647.1| 3'-5' exonuclease [Prochlorococcus marinus str. NATL2A]
          Length = 214

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 125/208 (60%), Gaps = 5/208 (2%)

Query: 2   TTIRVHEGDIPAE--CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           +T  + + DI +E   A R   A+AVDTE +GL+  RDRLC++Q+      V  IRI   
Sbjct: 9   STFNIFDQDIDSETEIALRSSSALAVDTEAMGLIHGRDRLCLIQICDEFDNVICIRIERN 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q +AP+L  +L ++  EK+FH+ RFD+A L     + V P+FCTKIAS++ RTY+ +HGL
Sbjct: 69  QHSAPHLKSILENKTIEKVFHFARFDVAALASNLNINVNPIFCTKIASKIGRTYSPRHGL 128

Query: 120 KDNLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           K+ + E +G+ + K  QSSDW    DL+ +QL YA++DV +L   + +  E L+R  R  
Sbjct: 129 KEVVLETVGVELDKQAQSSDWGKVGDLTQKQLIYASNDVRYLLGAKHKLEEMLKREERWG 188

Query: 179 LATSCCNFLMDRAELDLLGWENVDIFSH 206
           LA  C   +   +ELD   + N  IF H
Sbjct: 189 LAQKCFQCVPVLSELDRRRFTN--IFDH 214


>gi|159904246|ref|YP_001551590.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9211]
 gi|159889422|gb|ABX09636.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9211]
          Length = 214

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 84/207 (40%), Positives = 126/207 (60%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAECAARYVD--AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           T  + + D+  +    +    ++A+DTE +GLM  RDRLC+VQ+      V  IRI   Q
Sbjct: 10  TFHILDRDLDEKSFKEFSTKASLAIDTEAMGLMHGRDRLCLVQICDESDNVICIRIERNQ 69

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           K+AP L  +L +   +KIFH+ RFD+A L     ++V P+FCTK+AS++ RTY+ +HGLK
Sbjct: 70  KSAPLLKNLLENPSIQKIFHFARFDVAALEVNLDIKVTPIFCTKVASKIGRTYSPRHGLK 129

Query: 121 DNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           + + EL+ + + K  QSSDW A +DLS +QL YAA+DV +L   + +    L+R GR +L
Sbjct: 130 EVVMELVNVELDKQAQSSDWGAVEDLSAKQLAYAANDVRYLIKAKEKLEHMLKREGRWEL 189

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
            T C   +   +ELD+  + N  IF H
Sbjct: 190 TTKCFQCIPVMSELDIYRFGN--IFEH 214


>gi|78185488|ref|YP_377923.1| 3'-5' exonuclease [Synechococcus sp. CC9902]
 gi|78169782|gb|ABB26879.1| 3'-5' exonuclease [Synechococcus sp. CC9902]
          Length = 214

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A    R   +  +AVDTE +GL+  RDRLC+VQ++     V  +RIA GQ  A
Sbjct: 13  VFDGDLDASWTERYLQMPCLAVDTEAMGLIHGRDRLCLVQIADAQDRVACVRIALGQSTA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +      EK+FH+ RFD+A L     + V+P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLQRLFEAPSVEKVFHFARFDVAALAAGLDIAVQPLFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R +    L+R GR +LA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELTDVQLAYAANDVRYLLPARNKLETMLRREGRWELAQR 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   AELD + +     F H
Sbjct: 193 CFACIPVMAELDRMRFNQT--FEH 214


>gi|148243178|ref|YP_001228335.1| ribonuclease [Synechococcus sp. RCC307]
 gi|147851488|emb|CAK28982.1| Ribonuclease [Synechococcus sp. RCC307]
          Length = 217

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 122/204 (59%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+  E     +   A+AVDTE +GL+  RDRLC+VQ+      V  IRIA GQ  A
Sbjct: 14  VFDGDLSPEWFGHYKNAKALAVDTEAMGLIHGRDRLCLVQICDDQDRVCCIRIARGQSEA 73

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FHY RFD+A +    G+ V P+FCTK+ASRL RTY+ +HGL   +
Sbjct: 74  PLLKELMEATGIEKVFHYARFDVAAMASGLGIAVNPIFCTKVASRLARTYSPRHGLAAVV 133

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+++ K  QSSDW   ++LS++QL YAA+DV +L   R +  + L R  R  LA  
Sbjct: 134 SELVGVDLDKQAQSSDWGRVEELSEQQLAYAANDVRYLLPARDRLEQMLVREERWSLAQR 193

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   ++LD   ++   IF H
Sbjct: 194 CFLCIPVFSDLDR--FQYGSIFEH 215


>gi|254431401|ref|ZP_05045104.1| RNAse D protein [Cyanobium sp. PCC 7001]
 gi|197625854|gb|EDY38413.1| RNAse D protein [Cyanobium sp. PCC 7001]
          Length = 224

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 92/205 (44%), Positives = 125/205 (60%), Gaps = 5/205 (2%)

Query: 6   VHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A  A  Y  A  +AVDTE +GL+  RDRLC+VQ+      V  IR+  GQ +A
Sbjct: 17  VFDGDLDAGWAELYAGARALAVDTEAMGLIHGRDRLCLVQICDDADNVCCIRLRRGQSSA 76

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P+L  ++ +   EK+FH+ RFD+A L    G+ V P+FCTKI SRL RTY+ +HGLKD +
Sbjct: 77  PHLQALMENAAIEKVFHFARFDVAALAENLGIAVHPIFCTKIGSRLARTYSPRHGLKDVV 136

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           +EL+G+ + K  QSSDW   DDLS+ QL YAA DV +L   R +    L+R  R +LA  
Sbjct: 137 QELVGVELDKRAQSSDWGEVDDLSEAQLAYAAGDVRYLLQARDRLERMLRREERWELAQR 196

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C   L   A+LD   +  +  F HS
Sbjct: 197 CFTCLPVFADLDRQRFHLL--FEHS 219


>gi|116072599|ref|ZP_01469865.1| 3'-5' exonuclease [Synechococcus sp. BL107]
 gi|116064486|gb|EAU70246.1| 3'-5' exonuclease [Synechococcus sp. BL107]
          Length = 214

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ A    R   + ++AVDTE +GL+  RDRLC+VQ++     V  +RI  GQ  A
Sbjct: 13  VFDGDLDASWTERYLQMPSLAVDTEAMGLIHGRDRLCLVQIADAQDRVACVRIGLGQSTA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           PNL  +      EK+FH+ RFD+A L     + V+P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PNLQRLFEAASVEKVFHFARFDVAALAAGLDIAVQPLFCTKVGSRLGRTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+DV +L   R Q    L+R GR +LA  
Sbjct: 133 MELVGVELDKGAQSSDWGRVDELTDVQLAYAANDVRYLLPARNQLETMLRREGRWELAQR 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   AELD + +     F H
Sbjct: 193 CFTCIPVIAELDRMRFNQT--FEH 214


>gi|148238801|ref|YP_001224188.1| ribonuclease D [Synechococcus sp. WH 7803]
 gi|147847340|emb|CAK22891.1| Ribonuclease D [Synechococcus sp. WH 7803]
          Length = 214

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 94/204 (46%), Positives = 127/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ AE + R+    A+AVDTE +GL+  RDRLC+VQ+      V  IRIA GQ  A
Sbjct: 13  VLDGDLNAEWSERFAASTALAVDTEAMGLIHGRDRLCLVQICDDKDQVACIRIALGQSEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+RV P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PRLKALMEAATIEKVFHFARFDVAALATGLGIRVNPIFCTKVGSRLARTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+D  +L   R Q    L+R GR +LA S
Sbjct: 133 MELVGVELDKQAQSSDWGRVDELTDVQLAYAANDARYLLPARRQLEVMLRREGRWELAQS 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   ++LD   +  V+ F H
Sbjct: 193 CFQCIPVMSDLDR--FRFVNTFEH 214


>gi|88807852|ref|ZP_01123363.1| putative ribonuclease D [Synechococcus sp. WH 7805]
 gi|88787891|gb|EAR19047.1| putative ribonuclease D [Synechococcus sp. WH 7805]
          Length = 214

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 94/204 (46%), Positives = 127/204 (62%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAECAARYVDA--IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+  E + RY  +  +AVDTE +GL+  RDRLC+VQ+      V  IRIA GQ  A
Sbjct: 13  VLDGDLNEEWSERYARSTALAVDTEAMGLIHGRDRLCLVQICDDKDQVACIRIALGQTEA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+RV P+FCTK+ SRL RTYT +HGLKD +
Sbjct: 73  PRLKALMEATTIEKVFHFARFDVAALATGLGIRVNPLFCTKVGSRLARTYTPRHGLKDLV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL+G+ + K  QSSDW   D+L+D QL YAA+D  +L A R Q    L+R GR +LA S
Sbjct: 133 MELVGVELDKQAQSSDWGRVDELTDVQLAYAANDARYLLAARRQLEVMLRREGRWELAQS 192

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   ++LD   +  V+ F H
Sbjct: 193 CFQCIPVMSDLDR--FRFVNTFEH 214


>gi|37522692|ref|NP_926069.1| ribonuclease D [Gloeobacter violaceus PCC 7421]
 gi|35213694|dbj|BAC91064.1| ribonuclease D [Gloeobacter violaceus PCC 7421]
          Length = 208

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 89/205 (43%), Positives = 130/205 (63%), Gaps = 5/205 (2%)

Query: 5   RVHEGDIPAECAAR--YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           ++   D+  E A        +AVD+E +GL+P RDRLC+VQL    G V ++R++AG   
Sbjct: 6   QIFTDDLSPEVAGTYLQSGLLAVDSEAMGLLPHRDRLCLVQLCDEAGLVSLVRLSAGLTQ 65

Query: 63  APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDN 122
           A  L  +L      K+FHY RFD+A+L +  G+RV+P+ CTK+AS+L RTY+ +HGLKD 
Sbjct: 66  ASQLQKVLEAPAVIKLFHYARFDVAMLRHHLGIRVQPIVCTKVASKLARTYSPRHGLKDL 125

Query: 123 LKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
           + E +G+ + K+ QSSDW A  +LS+EQL+YAA+DV +L     +    L+R GR +LA 
Sbjct: 126 VLETVGVELDKSAQSSDWGAVLELSEEQLRYAANDVRYLIPAWRKLETMLRREGRFELAR 185

Query: 182 SCCNFLMDRAELDLLGWENVDIFSH 206
            C   L  + +LDLLG+ +V  F H
Sbjct: 186 RCFAHLETQVDLDLLGYSSV--FEH 208


>gi|317968782|ref|ZP_07970172.1| ribonuclease [Synechococcus sp. CB0205]
          Length = 225

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 90/204 (44%), Positives = 118/204 (57%), Gaps = 5/204 (2%)

Query: 6   VHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V + D+  E         A+AVDTE +GL+  RDRLC+VQ+S     V  IRI  GQ  A
Sbjct: 22  VLDHDLNPEWRALLGASSALAVDTEAMGLIHGRDRLCLVQISDDHDNVCCIRIHRGQTEA 81

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L     + V P+FCTKI SRL RTYTN+HGLKD +
Sbjct: 82  PLLKELMEAAGIEKVFHFARFDVAALAEGLDIHVSPIFCTKIGSRLARTYTNRHGLKDLV 141

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
            EL  + + K  QSSDW   ++LS+ QL YAA+DV +L A R +  E L R  R DLA  
Sbjct: 142 NELCHVELDKGAQSSDWGRVEELSESQLAYAANDVRYLLAARTRLIEMLVREERLDLAQR 201

Query: 183 CCNFLMDRAELDLLGWENVDIFSH 206
           C   +   ++LD   +    IF H
Sbjct: 202 CFACIPVISDLDRGRFGA--IFEH 223


>gi|254526817|ref|ZP_05138869.1| 3'-5' exonuclease [Prochlorococcus marinus str. MIT 9202]
 gi|221538241|gb|EEE40694.1| 3'-5' exonuclease [Prochlorococcus marinus str. MIT 9202]
          Length = 211

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 86/207 (41%), Positives = 122/207 (58%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I     D+ ++     +    +A+DTE +GL+  RDRLC+VQ+    G    I+I    
Sbjct: 7   NIDFFYNDLTSDLYNLYKNSSFLAIDTEAMGLIHGRDRLCLVQICNEFGRTSCIKIELNT 66

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            ++ +L  +L D+K  KIFHY RFD+A L     +  + +FCTKIAS+L RTYTN+HGLK
Sbjct: 67  SSSTHLKALLEDDKITKIFHYARFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLK 126

Query: 121 DNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           D + ELLGI + K+ QSSDW   +DL+ EQL YAA+DV +L     +    L+R  R +L
Sbjct: 127 DLINELLGIELDKSSQSSDWGSNEDLTKEQLDYAANDVRYLIEAMHKLKVILKRENRYEL 186

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   A+LD+L + N  IF H
Sbjct: 187 AQKCFETVPVHADLDILKFSN--IFEH 211


>gi|123967004|ref|YP_001012085.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9515]
 gi|123201370|gb|ABM72978.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9515]
          Length = 213

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 85/207 (41%), Positives = 123/207 (59%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAECAA--RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I ++  DI        +    +AVDTE +GL+  RDRLC++Q+S        I+I    
Sbjct: 9   KITLYNNDITQNLYNIYKDSSYLAVDTEAMGLIHGRDRLCLIQISNEFHLTSCIKIELNN 68

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            ++P++  +  D K  KIFHY RFD+A L     +    +FCTKIAS+L RTYT++HGLK
Sbjct: 69  SDSPHIKKLFEDNKIMKIFHYARFDVAALKCNLNINTNNIFCTKIASKLARTYTHKHGLK 128

Query: 121 DNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           + + EL+GI + K+ QSSDW + +DLSD+Q+ YAA+DV +L     +    L+R GR DL
Sbjct: 129 ELIHELIGIELDKSSQSSDWGSCEDLSDKQIDYAANDVKYLIEAMRKLRIILEREGRYDL 188

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   +ELD+L + N  IF H
Sbjct: 189 AQKCFQTIPVHSELDILKFSN--IFEH 213


>gi|254718869|ref|ZP_05180680.1| Rnd, ribonuclease D [Brucella sp. 83/13]
 gi|265983854|ref|ZP_06096589.1| ribonuclease D [Brucella sp. 83/13]
 gi|306837628|ref|ZP_07470498.1| ribonuclease D [Brucella sp. NF 2653]
 gi|264662446|gb|EEZ32707.1| ribonuclease D [Brucella sp. 83/13]
 gi|306407277|gb|EFM63486.1| ribonuclease D [Brucella sp. NF 2653]
          Length = 385

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 55/181 (30%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DEK 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEKI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|306842001|ref|ZP_07474675.1| ribonuclease D [Brucella sp. BO2]
 gi|306843696|ref|ZP_07476296.1| ribonuclease D [Brucella sp. BO1]
 gi|306276006|gb|EFM57715.1| ribonuclease D [Brucella sp. BO1]
 gi|306287929|gb|EFM59346.1| ribonuclease D [Brucella sp. BO2]
          Length = 385

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 55/181 (30%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DEK 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEKI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|157414190|ref|YP_001485056.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9215]
 gi|157388765|gb|ABV51470.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9215]
          Length = 211

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 87/207 (42%), Positives = 122/207 (58%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I     D+ ++     +    +A+DTE +GL+  RDRLC+VQ+    G    I+I    
Sbjct: 7   NIDFFYNDLTSDLYNLYKNSSFLAIDTEAMGLIHGRDRLCLVQICNEFGRTSCIKIELNT 66

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            ++ +L  +L DEK  KIFHY RFD+A L     +  + +FCTKIAS+L RTYTN+HGLK
Sbjct: 67  SSSTHLKALLEDEKITKIFHYARFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLK 126

Query: 121 DNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           D + ELLGI + K+ QSSDW   +DL+ EQL YAA+DV +L     +    L+R  R +L
Sbjct: 127 DLINELLGIELDKSSQSSDWGSNEDLTKEQLDYAANDVRYLIEAMHKLKVILKRENRYEL 186

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   A+LD+L + N  IF H
Sbjct: 187 AQKCFETVSVHADLDILKFSN--IFEH 211


>gi|294852115|ref|ZP_06792788.1| ribonuclease D [Brucella sp. NVSL 07-0026]
 gi|294820704|gb|EFG37703.1| ribonuclease D [Brucella sp. NVSL 07-0026]
          Length = 385

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 53/181 (29%), Positives = 90/181 (49%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++   ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTSKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|254689015|ref|ZP_05152269.1| Rnd, ribonuclease D [Brucella abortus bv. 6 str. 870]
 gi|260754508|ref|ZP_05866856.1| ribonuclease D [Brucella abortus bv. 6 str. 870]
 gi|260674616|gb|EEX61437.1| ribonuclease D [Brucella abortus bv. 6 str. 870]
          Length = 384

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|82699633|ref|YP_414207.1| 3'-5' exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|82615734|emb|CAJ10730.1| HRDC domain:3'-5' exonuclease:Ribonuclease D [Brucella melitensis
           biovar Abortus 2308]
          Length = 385

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDELAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|62289703|ref|YP_221496.1| RND, ribonuclease D [Brucella abortus bv. 1 str. 9-941]
 gi|148560669|ref|YP_001258731.1| ribonuclease D [Brucella ovis ATCC 25840]
 gi|163843022|ref|YP_001627426.1| ribonuclease D [Brucella suis ATCC 23445]
 gi|189023953|ref|YP_001934721.1| Rnd, ribonuclease D [Brucella abortus S19]
 gi|225627251|ref|ZP_03785288.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|237815192|ref|ZP_04594190.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|254693498|ref|ZP_05155326.1| Rnd, ribonuclease D [Brucella abortus bv. 3 str. Tulya]
 gi|254697150|ref|ZP_05158978.1| Rnd, ribonuclease D [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701527|ref|ZP_05163355.1| Rnd, ribonuclease D [Brucella suis bv. 5 str. 513]
 gi|254707023|ref|ZP_05168851.1| Rnd, ribonuclease D [Brucella pinnipedialis M163/99/10]
 gi|254709868|ref|ZP_05171679.1| Rnd, ribonuclease D [Brucella pinnipedialis B2/94]
 gi|254713869|ref|ZP_05175680.1| Rnd, ribonuclease D [Brucella ceti M644/93/1]
 gi|254717074|ref|ZP_05178885.1| Rnd, ribonuclease D [Brucella ceti M13/05/1]
 gi|254730046|ref|ZP_05188624.1| Rnd, ribonuclease D [Brucella abortus bv. 4 str. 292]
 gi|256031360|ref|ZP_05444974.1| Rnd, ribonuclease D [Brucella pinnipedialis M292/94/1]
 gi|256060870|ref|ZP_05451030.1| Rnd, ribonuclease D [Brucella neotomae 5K33]
 gi|256257265|ref|ZP_05462801.1| Rnd, ribonuclease D [Brucella abortus bv. 9 str. C68]
 gi|256369183|ref|YP_003106691.1| ribonuclease D [Brucella microti CCM 4915]
 gi|260168494|ref|ZP_05755305.1| ribonuclease D [Brucella sp. F5/99]
 gi|260545541|ref|ZP_05821282.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260757729|ref|ZP_05870077.1| ribonuclease D [Brucella abortus bv. 4 str. 292]
 gi|260761554|ref|ZP_05873897.1| ribonuclease D [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883537|ref|ZP_05895151.1| ribonuclease D [Brucella abortus bv. 9 str. C68]
 gi|261213756|ref|ZP_05928037.1| ribonuclease D [Brucella abortus bv. 3 str. Tulya]
 gi|261218885|ref|ZP_05933166.1| ribonuclease D [Brucella ceti M13/05/1]
 gi|261314491|ref|ZP_05953688.1| ribonuclease D [Brucella pinnipedialis M163/99/10]
 gi|261317409|ref|ZP_05956606.1| ribonuclease D [Brucella pinnipedialis B2/94]
 gi|261321616|ref|ZP_05960813.1| ribonuclease D [Brucella ceti M644/93/1]
 gi|261324867|ref|ZP_05964064.1| ribonuclease D [Brucella neotomae 5K33]
 gi|261752075|ref|ZP_05995784.1| ribonuclease D [Brucella suis bv. 5 str. 513]
 gi|261757962|ref|ZP_06001671.1| ribonuclease D [Brucella sp. F5/99]
 gi|265988446|ref|ZP_06101003.1| ribonuclease D [Brucella pinnipedialis M292/94/1]
 gi|297248110|ref|ZP_06931828.1| ribonuclease D [Brucella abortus bv. 5 str. B3196]
 gi|62195835|gb|AAX74135.1| Rnd, ribonuclease D [Brucella abortus bv. 1 str. 9-941]
 gi|148371926|gb|ABQ61905.1| ribonuclease D [Brucella ovis ATCC 25840]
 gi|163673745|gb|ABY37856.1| ribonuclease D [Brucella suis ATCC 23445]
 gi|189019525|gb|ACD72247.1| Rnd, ribonuclease D [Brucella abortus S19]
 gi|225617256|gb|EEH14301.1| ribonuclease D [Brucella ceti str. Cudo]
 gi|237790029|gb|EEP64239.1| ribonuclease D [Brucella abortus str. 2308 A]
 gi|255999343|gb|ACU47742.1| ribonuclease D [Brucella microti CCM 4915]
 gi|260096948|gb|EEW80823.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260668047|gb|EEX54987.1| ribonuclease D [Brucella abortus bv. 4 str. 292]
 gi|260671986|gb|EEX58807.1| ribonuclease D [Brucella abortus bv. 2 str. 86/8/59]
 gi|260873065|gb|EEX80134.1| ribonuclease D [Brucella abortus bv. 9 str. C68]
 gi|260915363|gb|EEX82224.1| ribonuclease D [Brucella abortus bv. 3 str. Tulya]
 gi|260923974|gb|EEX90542.1| ribonuclease D [Brucella ceti M13/05/1]
 gi|261294306|gb|EEX97802.1| ribonuclease D [Brucella ceti M644/93/1]
 gi|261296632|gb|EEY00129.1| ribonuclease D [Brucella pinnipedialis B2/94]
 gi|261300847|gb|EEY04344.1| ribonuclease D [Brucella neotomae 5K33]
 gi|261303517|gb|EEY07014.1| ribonuclease D [Brucella pinnipedialis M163/99/10]
 gi|261737946|gb|EEY25942.1| ribonuclease D [Brucella sp. F5/99]
 gi|261741828|gb|EEY29754.1| ribonuclease D [Brucella suis bv. 5 str. 513]
 gi|264660643|gb|EEZ30904.1| ribonuclease D [Brucella pinnipedialis M292/94/1]
 gi|297175279|gb|EFH34626.1| ribonuclease D [Brucella abortus bv. 5 str. B3196]
          Length = 385

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|161618719|ref|YP_001592606.1| ribonuclease D [Brucella canis ATCC 23365]
 gi|260566676|ref|ZP_05837146.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335530|gb|ABX61835.1| ribonuclease D [Brucella canis ATCC 23365]
 gi|260156194|gb|EEW91274.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 382

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|23501637|ref|NP_697764.1| ribonuclease D [Brucella suis 1330]
 gi|254704076|ref|ZP_05165904.1| ribonuclease D [Brucella suis bv. 3 str. 686]
 gi|261754734|ref|ZP_05998443.1| ribonuclease D [Brucella suis bv. 3 str. 686]
 gi|23347555|gb|AAN29679.1| ribonuclease D [Brucella suis 1330]
 gi|261744487|gb|EEY32413.1| ribonuclease D [Brucella suis bv. 3 str. 686]
          Length = 385

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|87300944|ref|ZP_01083786.1| putative ribonuclease D [Synechococcus sp. WH 5701]
 gi|87284815|gb|EAQ76767.1| putative ribonuclease D [Synechococcus sp. WH 5701]
          Length = 228

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 127/205 (61%), Gaps = 5/205 (2%)

Query: 6   VHEGDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V EGD+ AE         A+AVDTE +GL+  RDRLC+VQ++     V  IRIA GQ+ A
Sbjct: 22  VFEGDLDAEWLSLLAQAPALAVDTEAMGLVHGRDRLCLVQIADHLDNVCCIRIARGQQEA 81

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+++HGLK+ +
Sbjct: 82  PRLRELMESPAIEKVFHFARFDLAALGEGLGIAVAPLFCTKVASRLARTYSSRHGLKEVV 141

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
           +EL+G+ + K  QSSDW   ++L + QL YAA+DV +L A R      L+R  R DLA  
Sbjct: 142 QELVGVELDKQSQSSDWGRVEELGEAQLVYAANDVRYLLAARHALAAILEREERLDLARR 201

Query: 183 CCNFLMDRAELDLLGWENVDIFSHS 207
           C   L   AELD   + +V  F HS
Sbjct: 202 CFACLPVFAELDRSRFGSV--FEHS 224


>gi|256159482|ref|ZP_05457250.1| Rnd, ribonuclease D [Brucella ceti M490/95/1]
 gi|256254768|ref|ZP_05460304.1| Rnd, ribonuclease D [Brucella ceti B1/94]
 gi|261221947|ref|ZP_05936228.1| ribonuclease D [Brucella ceti B1/94]
 gi|265997910|ref|ZP_06110467.1| ribonuclease D [Brucella ceti M490/95/1]
 gi|260920531|gb|EEX87184.1| ribonuclease D [Brucella ceti B1/94]
 gi|262552378|gb|EEZ08368.1| ribonuclease D [Brucella ceti M490/95/1]
          Length = 385

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLMQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEMAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|33241189|ref|NP_876131.1| putative ribonuclease D [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|33238719|gb|AAQ00784.1| Ribonuclease D [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 214

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 79/206 (38%), Positives = 118/206 (57%), Gaps = 5/206 (2%)

Query: 4   IRVHEGDIPAECAA--RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
            +V E D+  +          +A+DTE +GL+  RDRLC+VQ+      V  I+I   Q 
Sbjct: 11  FKVFETDLDDQWTQHFSTQSCLAIDTEAMGLIHGRDRLCLVQICDEQDNVACIKIQQHQT 70

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
            A NL  ++ D   EK+FHY RFD+A +     + V  +FCTK+AS++ RTY+ +HGLK+
Sbjct: 71  KANNLQSLMEDSAIEKVFHYARFDVAAISCNLNIAVNSIFCTKLASKIGRTYSPRHGLKE 130

Query: 122 NLKELLGINISKAQQSSDWSAD-DLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            + EL+GI + K  QSSDW    +L+++QL+YA +DV +L   R Q  + L R  R +L 
Sbjct: 131 VILELVGIELDKQAQSSDWGRVGELTEKQLEYATNDVRYLIQARNQLEKMLIREDRWELT 190

Query: 181 TSCCNFLMDRAELDLLGWENVDIFSH 206
             C   +   +ELD+  + N  IF H
Sbjct: 191 KRCFECISVMSELDIRRFHN--IFEH 214


>gi|239831578|ref|ZP_04679907.1| ribonuclease D [Ochrobactrum intermedium LMG 3301]
 gi|239823845|gb|EEQ95413.1| ribonuclease D [Ochrobactrum intermedium LMG 3301]
          Length = 385

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  + T  +  +A G   AP    ++ DEK 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPNHTALVDALAPGLDLAPFF-SLMADEKV 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF +++A+     + +       ++++ G +I K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGDLIPSPVFDSQVAAM-VCGFGDAISYDQLVQKVTGKHIDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LS++QL YA +DV +L  + L   ++L++ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSEKQLDYALADVTYLRDIYLYLKQELEKEGRSEWVNEEMAVLTSRETYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|17987486|ref|NP_540120.1| ribonuclease D [Brucella melitensis bv. 1 str. 16M]
 gi|225852267|ref|YP_002732500.1| ribonuclease D [Brucella melitensis ATCC 23457]
 gi|256044440|ref|ZP_05447344.1| ribonuclease D [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113284|ref|ZP_05454152.1| ribonuclease D [Brucella melitensis bv. 3 str. Ether]
 gi|256264225|ref|ZP_05466757.1| RND family transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|260563791|ref|ZP_05834277.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990860|ref|ZP_06103417.1| ribonuclease D [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994696|ref|ZP_06107253.1| ribonuclease D [Brucella melitensis bv. 3 str. Ether]
 gi|17983183|gb|AAL52384.1| ribonuclease d [Brucella melitensis bv. 1 str. 16M]
 gi|225640632|gb|ACO00546.1| ribonuclease D [Brucella melitensis ATCC 23457]
 gi|260153807|gb|EEW88899.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|262765809|gb|EEZ11598.1| ribonuclease D [Brucella melitensis bv. 3 str. Ether]
 gi|263001644|gb|EEZ14219.1| ribonuclease D [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094471|gb|EEZ18293.1| RND family transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|326408773|gb|ADZ65838.1| ribonuclease D [Brucella melitensis M28]
 gi|326538491|gb|ADZ86706.1| ribonuclease D [Brucella melitensis M5-90]
          Length = 385

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE+ 
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADEEI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF T++A+     + +       ++++ G ++ K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGNLIPSPVFDTQVAAM-VCGFGDAISYDQLVQKVTGKHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+LQ+ GRS+        L  R   DL
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELQKEGRSEWVNEEIAVLTARQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|183220183|ref|YP_001838179.1| ribonuclease D [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
 gi|189910303|ref|YP_001961858.1| ribonuclease D-like [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167774979|gb|ABZ93280.1| Ribonuclease D-related [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167778605|gb|ABZ96903.1| Ribonuclease D [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 212

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 89/209 (42%), Positives = 129/209 (61%), Gaps = 6/209 (2%)

Query: 2   TTIR--VHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           +TI+  V +GD+  +   A +  D +AVD E +GL PRRDRLC+VQ+S     V +++I 
Sbjct: 6   STIKPAVLQGDLNEDFFEAFKKDDRLAVDCEMMGLNPRRDRLCVVQISDSKNKVALVQIL 65

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
            GQK AP++  +   ++  KIFH+ R D+  L    G++V+ VFCTKIAS+L RTYT++H
Sbjct: 66  PGQKEAPHIQKLFESKEITKIFHFARMDMTFLRARLGIKVQNVFCTKIASKLARTYTDKH 125

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           GLK+ ++E    NI K  QSSDW    L+ +Q+ YA++DV  L +L    TE + R  R 
Sbjct: 126 GLKELIREFFEENIDKKNQSSDWGKKILTKDQVDYASTDVRFLISLESILTEMMIRENRF 185

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            +A  C  FL  + ELDLL  E  ++F H
Sbjct: 186 TIAEKCFGFLETQVELDLL--EVYNLFEH 212


>gi|153009869|ref|YP_001371084.1| ribonuclease D [Ochrobactrum anthropi ATCC 49188]
 gi|151561757|gb|ABS15255.1| ribonuclease D [Ochrobactrum anthropi ATCC 49188]
          Length = 385

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/181 (28%), Positives = 89/181 (49%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++  D T  +  +A G   AP    ++ DE  
Sbjct: 16  ALAKSDFVTVDTEFIRETTFWPELCLIQMASPDHTALVDALAPGLDLAPFFR-LMADETI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI ++F+   +   PVF +++A+     + +       ++++ G  I K+ 
Sbjct: 75  VKVFHAARQDIEIVFHLGDLIPSPVFDSQVAAM-VCGFGDAISYDQLVQKVTGKQIDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV +L  + L   E+L++ GRS+        L  R   D+
Sbjct: 134 RFTDWRRRPLSDKQLDYALADVTYLRDIYLYLKEELEKEGRSEWVNEEMAVLTSRETYDM 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|33862140|ref|NP_893701.1| putative ribonuclease D [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|33634358|emb|CAE20043.1| putative ribonuclease D [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 213

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 84/207 (40%), Positives = 120/207 (57%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I     DI  +     +    +AVDTE +GL+  RDRLC++Q+         I+I    
Sbjct: 9   KINFSHNDINTDLYNLYKDSSYLAVDTEAMGLIHGRDRLCLIQICNELNLTACIKIELNN 68

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            ++PN+  +  D+   KIFHY RFD+A L     +  R +FCTKIAS+L RTYTN+HGLK
Sbjct: 69  SDSPNIKKLFEDKNIMKIFHYARFDVAALRCNLEINTRNIFCTKIASKLARTYTNKHGLK 128

Query: 121 DNLKELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           D + ELL + + K+ QSSDW + +DLS++Q+ YAA+DV +L     +    L R GR +L
Sbjct: 129 DLINELLEVELDKSSQSSDWGSLEDLSNKQIDYAANDVRYLIETMHKLKLILDREGRYEL 188

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   +ELD+L + N  IF H
Sbjct: 189 AQKCFKTIPVHSELDILKFSN--IFEH 213


>gi|91070231|gb|ABE11151.1| putative ribonuclease D [uncultured Prochlorococcus marinus clone
           HF10-11H11]
          Length = 211

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 85/207 (41%), Positives = 122/207 (58%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I +   D+  +     +    +A+DTE +GL+  RDRLC+VQ+         I+I    
Sbjct: 7   NIDLLYSDLTEDLYHLYKKSSYLAIDTEAMGLIHGRDRLCLVQICNEFNRTSCIKIELNT 66

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            ++P+L  +L D+K  KIFHY RFD+A L     +  + +FCTKIAS+L RTYTN+HGLK
Sbjct: 67  SSSPHLKALLEDDKITKIFHYARFDVAALKCNLKINTKNIFCTKIASKLARTYTNKHGLK 126

Query: 121 DNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           D + ELLGI + K+ QSSDW   +DL+ +QL YAA+DV +L     +    L+R  R +L
Sbjct: 127 DLINELLGIELDKSSQSSDWGSNEDLTKDQLDYAANDVRYLIEAMHKLKVILERENRYEL 186

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   A+LD+L + N  IF H
Sbjct: 187 AQKCFETVSVHADLDILKFSN--IFEH 211


>gi|15964944|ref|NP_385297.1| ribonuclease D protein [Sinorhizobium meliloti 1021]
 gi|307301014|ref|ZP_07580783.1| ribonuclease D [Sinorhizobium meliloti BL225C]
 gi|15074123|emb|CAC45770.1| Probable ribonuclease D [Sinorhizobium meliloti 1021]
 gi|306903969|gb|EFN34555.1| ribonuclease D [Sinorhizobium meliloti BL225C]
          Length = 383

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 52/197 (26%), Positives = 88/197 (44%), Gaps = 6/197 (3%)

Query: 10  DIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C        I +DTE L        LC++Q++  +  V +  +A G   AP    
Sbjct: 7   DLEAACRELARSSYITIDTEFLRETTFWPVLCLIQMASPEMAVIVDPMAPGIDLAPFF-A 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +    K+FH  R DI ++ +   +   P+F T++A+     + +       +  +  
Sbjct: 66  LMSNPDVVKVFHAARQDIEIIHHLGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVNRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             I K+ + +DWS   L+D+QL YA +DV HL  +    T++L R GRS         L 
Sbjct: 125 EQIDKSSRFTDWSRRPLTDKQLDYALADVTHLRDIYQYLTKELDREGRSSWLAEEMAILE 184

Query: 189 DRAELDL---LGWENVD 202
            R   DL     W+ + 
Sbjct: 185 SRETYDLHPDNAWQRLK 201


>gi|116327594|ref|YP_797314.1| ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331795|ref|YP_801513.1| ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116120338|gb|ABJ78381.1| Ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125484|gb|ABJ76755.1| Ribonuclease D-related [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 212

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 119/209 (56%), Gaps = 6/209 (2%)

Query: 2   TTIR--VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           +TI+  +  GD+  +    Y   D +AVD E +GL PRRDRLC+VQ+      V +++I 
Sbjct: 6   STIKPELFLGDLSEKRLEEYKADDRLAVDCEMMGLNPRRDRLCVVQICDSSNNVSLVQIL 65

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
             QK AP L  +  + +  KIFH+ R D   L Y  G+ +  VFCTKIAS+L RTYT++H
Sbjct: 66  PDQKEAPLLKSLFENPEIVKIFHFARMDSLFLRYRLGISLENVFCTKIASKLARTYTDKH 125

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           GLKD +KE     I K  QSSDW    L+ +Q++YA+ DV +L +L  + TE L R GR 
Sbjct: 126 GLKDLIKEFYDEVIDKKNQSSDWGKKILTKDQIEYASGDVKYLISLEQKLTEILVREGRD 185

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA      L    ++D L  E   +F H
Sbjct: 186 SLAREAFRCLPVFNQIDWL--EMPSLFEH 212


>gi|307317748|ref|ZP_07597186.1| ribonuclease D [Sinorhizobium meliloti AK83]
 gi|306896510|gb|EFN27258.1| ribonuclease D [Sinorhizobium meliloti AK83]
          Length = 383

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 52/197 (26%), Positives = 88/197 (44%), Gaps = 6/197 (3%)

Query: 10  DIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C        I +DTE L        LC++Q++  +  V +  +A G   AP    
Sbjct: 7   DLEAACRELARSSYITIDTEFLRETTFWPVLCLIQMASPEMAVIVDPMAPGIDLAPFF-A 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +    K+FH  R DI ++ +   +   P+F T++A+     + +       +  +  
Sbjct: 66  LMSNPDVVKVFHAARQDIEIIHHLGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVNRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             I K+ + +DWS   L+D+QL YA +DV HL  +    T++L R GRS         L 
Sbjct: 125 EQIDKSSRFTDWSRRPLTDKQLDYALADVTHLRDIYQYLTKELDREGRSSWLAEEMAILE 184

Query: 189 DRAELDL---LGWENVD 202
            R   DL     W+ + 
Sbjct: 185 SRETYDLHPDNAWQRLK 201


>gi|94497624|ref|ZP_01304192.1| ribonuclease D [Sphingomonas sp. SKA58]
 gi|94422841|gb|EAT07874.1| ribonuclease D [Sphingomonas sp. SKA58]
          Length = 412

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/197 (25%), Positives = 86/197 (43%), Gaps = 5/197 (2%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   CA       +AVDTE +        LC+VQ++       I   A G    P L  +
Sbjct: 37  LSDFCARIANSPYVAVDTEFMRENSYWPDLCLVQVADSHEAAAIDPKAPGIDLTPLLNLL 96

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + +E   K+FH G  DI ++    G    P+F T+IA+     +  Q G  + +   LG+
Sbjct: 97  VDNEDVLKVFHAGGQDIEIVHNLTGKAPHPMFDTQIAAMALG-FGEQIGYGNLVDAWLGV 155

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            + K  + +DW+   L   Q+ YA  DV +L  +  +  E+L++ GR D        + +
Sbjct: 156 QLDKGARFTDWARRPLDKRQIDYAIGDVTYLIKIFPKMLEELKKTGRGDWLDQEMERISN 215

Query: 190 RAELDL---LGWENVDI 203
            +  +      W+ V I
Sbjct: 216 PSNYENDPADAWKRVRI 232


>gi|222148187|ref|YP_002549144.1| ribonuclease D [Agrobacterium vitis S4]
 gi|221735175|gb|ACM36138.1| ribonuclease D [Agrobacterium vitis S4]
          Length = 384

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 92/188 (48%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      + I +DTE L        LC++Q++  D  V +  +A G   AP    
Sbjct: 7   DLEAACEKLAKSEFITIDTEFLRETTFWPELCLIQMASPDLEVIVDPLAEGLDLAPFFK- 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +    K+FH  R DI ++F+   +   P+F T++A+     + +       ++++  
Sbjct: 66  LMANGDVIKVFHAARQDIEIIFHLGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVQKIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           I+I K+ + +DWS   LS++QL YA +DV HL  + L    +L+R GR+   +     L 
Sbjct: 125 IHIDKSSRFTDWSRRPLSEKQLDYALADVTHLRDVYLTLNAELEREGRASWLSEEMAILE 184

Query: 189 DRAELDLL 196
            R   DL 
Sbjct: 185 SRDTYDLH 192


>gi|24215616|ref|NP_713097.1| ribonuclease D [Leptospira interrogans serovar Lai str. 56601]
 gi|45657025|ref|YP_001111.1| ribonuclease D [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|24196771|gb|AAN50115.1|AE011455_9 ribonuclease D [Leptospira interrogans serovar Lai str. 56601]
 gi|45600262|gb|AAS69748.1| ribonuclease D [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 212

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 86/209 (41%), Positives = 120/209 (57%), Gaps = 6/209 (2%)

Query: 2   TTIR--VHEGDIPAECAARYV--DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           +TI+  +  GD+  +    Y   D +AVD E +GL PRRDRLC+VQ+      V +++I 
Sbjct: 6   STIKPELFPGDLSEQRFEEYKLDDRLAVDCEMMGLNPRRDRLCVVQICDSSNNVSLVQIL 65

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
             QK AP L  +  + +  KIFH+ R D   L Y  G+ ++ VFCTKIAS+L RTYT++H
Sbjct: 66  PDQKEAPLLKSLFENPEIVKIFHFARMDSLFLRYRLGINLQNVFCTKIASKLARTYTDKH 125

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           GLKD +KE     I K  QSSDW    L+ +Q++YA+ DV +L +L  + TE L R GR 
Sbjct: 126 GLKDLIKEFYDEVIDKKNQSSDWGKKILTKDQIEYASGDVKYLISLEQKLTEILVREGRD 185

Query: 178 DLATSCCNFLMDRAELDLLGWENVDIFSH 206
            LA      L    ++D L  E   +F H
Sbjct: 186 SLAREAFRCLPVFNQIDWL--EMPTLFEH 212


>gi|227821514|ref|YP_002825484.1| ribonuclease D [Sinorhizobium fredii NGR234]
 gi|227340513|gb|ACP24731.1| ribonuclease D [Sinorhizobium fredii NGR234]
          Length = 383

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 84/189 (44%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 I +DTE L        LC++Q++  D  V +  +A G   AP    ++ +    
Sbjct: 15  LALSSYITIDTEFLRETTFWPELCLIQMAGPDTAVIVDPMAPGIDLAPFF-ALMANADVV 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++ +   +   P+F T++A+     + +       +  +  + I K+ +
Sbjct: 74  KVFHAARQDIEIIHHLGNLIPHPLFDTQVAAM-VCGFGDSVSYDQLVSRIKNVQIDKSSR 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL- 195
            +DWS   L+D+QL YA +DV HL  +      +L+R GRS         L  R   DL 
Sbjct: 133 FTDWSRRPLTDKQLDYALADVTHLRDVYHYLKAELEREGRSSWLAEEMAILESRETYDLH 192

Query: 196 --LGWENVD 202
               W+ + 
Sbjct: 193 PENAWQRLK 201


>gi|209548705|ref|YP_002280622.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534461|gb|ACI54396.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 381

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTTEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADPKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LSD+QL+YA +DV HL  + L    +L R GR+   +   + L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLSEEMDILE 184

Query: 189 DRAELDLL 196
            R   DL 
Sbjct: 185 ARETYDLH 192


>gi|150396023|ref|YP_001326490.1| ribonuclease D [Sinorhizobium medicae WSM419]
 gi|150027538|gb|ABR59655.1| ribonuclease D [Sinorhizobium medicae WSM419]
          Length = 383

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/197 (25%), Positives = 88/197 (44%), Gaps = 6/197 (3%)

Query: 10  DIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C        I +DTE L        LC++Q++  D  V +  +A G   A     
Sbjct: 7   DLEAACRELASSSYITIDTEFLRETTFWPELCLIQMASPDMAVIVDPMAPGIDLASFF-A 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +    K+FH  R DI ++ +   +   P+F T++A+     + +       +  +  
Sbjct: 66  LMGNADVVKVFHAARQDIEIIHHLGNLIPHPLFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             I K+ + +DWS   L+D+QL YA +DV HL  +     ++L+R GRS         L 
Sbjct: 125 EQIDKSSRFTDWSRRPLTDKQLDYALADVTHLRDIYHYLVQELEREGRSSWLAEEMAILE 184

Query: 189 DRAELDL---LGWENVD 202
           +R   DL     W+ + 
Sbjct: 185 NRETYDLHPDNAWQRLK 201


>gi|78780061|ref|YP_398173.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9312]
 gi|78713560|gb|ABB50737.1| 3'-5' exonuclease [Prochlorococcus marinus str. MIT 9312]
          Length = 211

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 88/207 (42%), Positives = 123/207 (59%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAECAA--RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I     D+ A+     +    +A+DTE +GL+  RDRLC+VQ+         I+I   +
Sbjct: 7   NIDFLYSDLTADLYNIYKKSSYLAIDTEAMGLIHGRDRLCLVQICNELRRTACIKIELNR 66

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +APNL  +L DEK  KIFHY RFD+A L    G+  + +FCTKIAS+L RTYTN+HGLK
Sbjct: 67  SSAPNLKALLEDEKITKIFHYARFDVAALKCNLGINTKNIFCTKIASKLARTYTNKHGLK 126

Query: 121 DNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           D + ELLG+ + K+ QSSDW   +DL+ +QL YA++DV +L     +    L R  R +L
Sbjct: 127 DLINELLGVELDKSSQSSDWGSKEDLTKDQLDYASNDVRYLIEAMHKLKVILDRENRYEL 186

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   A+LD+L + N  IF H
Sbjct: 187 AQKCFKTVSVHADLDILKFSN--IFEH 211


>gi|126697114|ref|YP_001092000.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9301]
 gi|126544157|gb|ABO18399.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9301]
          Length = 211

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 86/207 (41%), Positives = 122/207 (58%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I +   D+  +     +    +A+DTE +GL+  RDRLC+VQ+         I+I    
Sbjct: 7   NIDLLYSDLTVDLYNLYKKSSYLAIDTEAMGLIHGRDRLCLVQICNEFKRTSCIKIELNT 66

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            ++P+L  +L DEK  KIFHY RFD+A L     +  + +FCTKIAS+L RTYTN+HGLK
Sbjct: 67  SSSPHLKKLLEDEKITKIFHYARFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLK 126

Query: 121 DNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           D + ELLGI + K+ QSSDW   +DL+ +QL YAA+DV +L     +    L+R  R +L
Sbjct: 127 DLINELLGIELDKSSQSSDWGSNEDLTKDQLDYAANDVRYLIEAMHKLKVILEREDRYEL 186

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   A+LD+L + N  IF H
Sbjct: 187 AQKCFETVSVHADLDILKFSN--IFEH 211


>gi|86357133|ref|YP_469025.1| RNase D protein [Rhizobium etli CFN 42]
 gi|86281235|gb|ABC90298.1| RNase D protein [Rhizobium etli CFN 42]
          Length = 381

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 53/188 (28%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTMEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LS++QL+YA +DV HL  + L  + +L R GR+       + L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSEKQLEYALADVTHLRDVYLSLSSQLDREGRTSWLREEMDILE 184

Query: 189 DRAELDLL 196
            R   D+ 
Sbjct: 185 ARETYDMH 192


>gi|123969324|ref|YP_001010182.1| putative ribonuclease D [Prochlorococcus marinus str. AS9601]
 gi|123199434|gb|ABM71075.1| putative ribonuclease D [Prochlorococcus marinus str. AS9601]
          Length = 211

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 87/207 (42%), Positives = 122/207 (58%), Gaps = 5/207 (2%)

Query: 3   TIRVHEGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            I     D+  +     +    +A+DTE +GL+  RDRLC+VQ+         I+I    
Sbjct: 7   NIDFLYSDLTVDLYNLYKKSSYLAIDTEAMGLIHGRDRLCLVQICNEFKRTSCIKIELNT 66

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            ++PNL  +L D+K  KIFHY RFD+A L     +  + +FCTKIAS+L RTYTN+HGLK
Sbjct: 67  SSSPNLKALLEDDKITKIFHYARFDVAALKCNLEINTKNIFCTKIASKLARTYTNKHGLK 126

Query: 121 DNLKELLGINISKAQQSSDWS-ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           D + ELLGI + K+ QSSDW   +DL+ +QL YAA+DV +L    L+    L+R  R +L
Sbjct: 127 DLINELLGIELDKSSQSSDWGSNEDLTKDQLDYAANDVRYLIEAMLKLKVILKRENRYEL 186

Query: 180 ATSCCNFLMDRAELDLLGWENVDIFSH 206
           A  C   +   A+LD+L + N  IF H
Sbjct: 187 AQKCFETVSVHADLDILKFSN--IFEH 211


>gi|167646508|ref|YP_001684171.1| ribonuclease D [Caulobacter sp. K31]
 gi|167348938|gb|ABZ71673.1| ribonuclease D [Caulobacter sp. K31]
          Length = 389

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 80/178 (44%), Gaps = 3/178 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE +       +LC++Q++  D    I  +A G    P L  +  D    
Sbjct: 17  LKGQPFIAVDTEFMRETTYWPKLCLIQVASPDIEACIDPLAEGMDLEPLLEILR-DPGVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +      +   P+F T++A         Q      ++++L I + K+ +
Sbjct: 76  KVFHAARQDVEIFNNLNAM-PTPLFDTQVAGMAAGFGE-QIAYDALVRQMLKIELDKSSR 133

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
            +DW+   LSD QL YA +DV HL  L     E+L++ GR          L D A  D
Sbjct: 134 FTDWARRPLSDAQLTYAVADVTHLATLFPILRERLEKAGRLAWVEEEMKALNDPAAYD 191


>gi|222085490|ref|YP_002544020.1| ribonuclease D [Agrobacterium radiobacter K84]
 gi|221722938|gb|ACM26094.1| ribonuclease D [Agrobacterium radiobacter K84]
          Length = 381

 Score =  134 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 82/180 (45%), Gaps = 2/180 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + I +DTE L        LC++Q++     V +  +A G  +      ++ +    
Sbjct: 15  LAKSEFITIDTEFLRETTFWPELCLIQMASPTTEVLVDPLAKG-LDLKPFFELMANTAVM 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++F    +   P+F T++A+     + +       +  +  I I K+ +
Sbjct: 74  KVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKNIQIDKSSR 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   LS++QL YA +DV HL  + L   E+L+R GR+         L  R   DL 
Sbjct: 133 FTDWSRRPLSEKQLDYALADVTHLRDVYLSLKEQLEREGRASWLLEEMAILEARETYDLH 192


>gi|89069870|ref|ZP_01157204.1| ribonuclease D [Oceanicola granulosus HTCC2516]
 gi|89044546|gb|EAR50665.1| ribonuclease D [Oceanicola granulosus HTCC2516]
          Length = 385

 Score =  134 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 54/197 (27%), Positives = 88/197 (44%), Gaps = 6/197 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRI 56
           M TI   E D+   CA A     + VDTE L        LC+VQL+    G     ++  
Sbjct: 1   MRTITTTE-DLATFCAEAAKAPYVTVDTEFLRERTYYPHLCLVQLAYPGDGKTDAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
             G  +   L  +  D    K+FH  R D+ + ++   V   P+F T++A+     +  Q
Sbjct: 60  LEGGLDLAPLYALFQDHGVVKVFHAARQDLEIFWHGGQVIPEPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++++   N+ K+ + +DWS   LS+ Q +YA +DV HL  +  +   +L + GR
Sbjct: 119 VGYETLVRKIARENLDKSSRFTDWSRRPLSEAQKRYALADVTHLRVIYEELKAELDKSGR 178

Query: 177 SDLATSCCNFLMDRAEL 193
                     L D A  
Sbjct: 179 IKWLAEEMAILKDPATY 195


>gi|163736203|ref|ZP_02143622.1| ribonuclease D [Phaeobacter gallaeciensis BS107]
 gi|161390073|gb|EDQ14423.1| ribonuclease D [Phaeobacter gallaeciensis BS107]
          Length = 385

 Score =  134 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 58/206 (28%), Positives = 94/206 (45%), Gaps = 8/206 (3%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRIAAGQKNAP 64
            D+ A C AA   D + VDTE L       +LC+VQL+    GD    ++   A   +  
Sbjct: 8   EDLQAFCEAAAQHDYVTVDTEFLRERTYYSKLCLVQLAYPGAGDENAVLVDPLADGLSLE 67

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +  +E   K+FH  R D+ + +    V  +P+F T++A+     +  Q G +  ++
Sbjct: 68  PLYDLFRNETVVKVFHAARQDLEIFWVDAQVFPKPLFDTQVAAM-VCGFGEQVGYETLVR 126

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           +++   + K  + +DWS   LSD Q  YA +DV HL  +      +L+R GR+       
Sbjct: 127 KIVKQGLDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEYLAAELKRTGRARWVEEEL 186

Query: 185 NFLMDRAELD---LLGWENVDIFSHS 207
             L D A  D      W  V   ++S
Sbjct: 187 QVLTDPATYDVDPQEAWRRVKTRTNS 212


>gi|163741269|ref|ZP_02148661.1| ribonuclease D [Phaeobacter gallaeciensis 2.10]
 gi|161385622|gb|EDQ09999.1| ribonuclease D [Phaeobacter gallaeciensis 2.10]
          Length = 385

 Score =  134 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 58/206 (28%), Positives = 94/206 (45%), Gaps = 8/206 (3%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRIAAGQKNAP 64
            D+ A C AA   D + VDTE L       +LC+VQL+    GD    ++   A   +  
Sbjct: 8   EDLQAFCEAAAQHDYVTVDTEFLRERTYYSKLCLVQLAYPGAGDENAVLVDPLADGLSLE 67

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +  +E   K+FH  R D+ + +    V  +P+F T++A+     +  Q G +  ++
Sbjct: 68  PLYDLFRNETVVKVFHAARQDLEIFWVDAQVFPKPLFDTQVAAM-VCGFGEQVGYETLVR 126

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           +++   + K  + +DWS   LSD Q  YA +DV HL  +      +L+R GR+       
Sbjct: 127 KIVKQGLDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEYLAAELKRTGRARWVEEEL 186

Query: 185 NFLMDRAELD---LLGWENVDIFSHS 207
             L D A  D      W  V   ++S
Sbjct: 187 QVLTDPATYDVDPQEAWRRVKTRTNS 212


>gi|327194287|gb|EGE61150.1| ribonuclease III protein [Rhizobium etli CNPAF512]
          Length = 381

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LSD+QL+YA +DV HL  + L    +L R GR+   T   N L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLTEEMNILE 184

Query: 189 DRAELDLL 196
            R   D+ 
Sbjct: 185 ARETYDMH 192


>gi|190891177|ref|YP_001977719.1| ribonuclease III protein [Rhizobium etli CIAT 652]
 gi|190696456|gb|ACE90541.1| ribonuclease III protein [Rhizobium etli CIAT 652]
          Length = 381

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LSD+QL+YA +DV HL  + L    +L R GR+   T   N L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLTEEMNILE 184

Query: 189 DRAELDLL 196
            R   D+ 
Sbjct: 185 ARETYDMH 192


>gi|116251369|ref|YP_767207.1| ribonuclease D [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256017|emb|CAK07098.1| putative ribonuclease D [Rhizobium leguminosarum bv. viciae 3841]
          Length = 381

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTTEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LSD+QL YA +DV HL  + L    +L R GRS   +   + L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLDYALADVTHLRDVYLSLKAELDREGRSSWLSEEMDILE 184

Query: 189 DRAELDLL 196
            R   D+ 
Sbjct: 185 SRETYDMH 192


>gi|241203984|ref|YP_002975080.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857874|gb|ACS55541.1| ribonuclease D [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 381

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPRTEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LSD+QL YA +DV HL  + L    +L R GRS   +   + L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLDYALADVTHLRDVYLSLKAELDREGRSSWLSEEMDILE 184

Query: 189 DRAELDLL 196
            R   D+ 
Sbjct: 185 SRETYDMH 192


>gi|325292526|ref|YP_004278390.1| Ribonuclease D [Agrobacterium sp. H13-3]
 gi|325060379|gb|ADY64070.1| Ribonuclease D [Agrobacterium sp. H13-3]
          Length = 386

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 87/180 (48%), Gaps = 2/180 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + I +DTE L        LC+VQ++     V +  +A G  +   L  ++ +    
Sbjct: 15  LAKSEFITIDTEFLRETTFWPELCLVQMASPTLEVLVDPLAKG-LDLTPLFELMANPDVV 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   P+F T++A+     + +       ++ +  + I K+ +
Sbjct: 74  KVFHAARQDIEIIYHLGGLIPHPIFDTQVAAM-VCGFGDSISYDQLVQRIKNVQIDKSSR 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L+++QL YA +DV HL  + L    +L+R GRS   T   + L  R   D+ 
Sbjct: 133 FTDWSRRPLTEKQLDYALADVTHLRDVYLALKAQLEREGRSLWLTEEMDILESRETYDMH 192


>gi|296117272|ref|ZP_06835863.1| ribonuclease D [Gluconacetobacter hansenii ATCC 23769]
 gi|295976165|gb|EFG82952.1| ribonuclease D [Gluconacetobacter hansenii ATCC 23769]
          Length = 421

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 57/176 (32%), Positives = 89/176 (50%), Gaps = 2/176 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            R    I +DTE +        LC+VQL+  D  V +  +A G   AP L  +L DE   
Sbjct: 49  LRREPFITIDTEFVRERTYWPELCLVQLASADEVVVVDALAPGMDLAP-LGELLADEGVI 107

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +  + F    +P+F T++A+     Y +Q G    +  ++G  I K+ +
Sbjct: 108 KVFHAARQDLEIFLHLFDRLPQPLFDTQVAAM-VAGYGDQVGYDSLVASVVGAQIDKSHR 166

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            SDW+A  LS  Q++YAA+DV +L  +  +   +L R GR D  T+  + L   A 
Sbjct: 167 FSDWAARPLSAAQIEYAAADVTYLREVYQRLVAQLDREGRKDWMTAEMDVLNSPAT 222


>gi|254419933|ref|ZP_05033657.1| ribonuclease D [Brevundimonas sp. BAL3]
 gi|196186110|gb|EDX81086.1| ribonuclease D [Brevundimonas sp. BAL3]
          Length = 383

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 62/206 (30%), Positives = 95/206 (46%), Gaps = 8/206 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           MT I  +E  +   CA       I VDTE +       RLC++Q +  D    I  +A G
Sbjct: 1   MTPITTNEA-LADFCARLATAPFITVDTEFMRETTYWPRLCLIQAASADHAGIIDPMAEG 59

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
               P L  +L D K  K+FH  R D+ +      +  RP+F T++A+        Q   
Sbjct: 60  LDLEPFL-DLLRDPKIIKVFHACRQDVEIFVRLGAM-PRPMFDTQVAAMAAGFGE-QVAY 116

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++++L + + K  + +DW+   LSD QL YA  DV HL AL  +  ++L++ GR D 
Sbjct: 117 DSLVRQMLRVELDKGSRFTDWARRPLSDSQLVYALGDVTHLAALYPKLRDRLKKEGRLDW 176

Query: 180 ATSCCNFLMDRAELDL---LGWENVD 202
             S    L+D A  D      W+ + 
Sbjct: 177 VMSEMESLIDPALYDTNPENAWKRLK 202


>gi|197105155|ref|YP_002130532.1| ribonuclease D [Phenylobacterium zucineum HLK1]
 gi|196478575|gb|ACG78103.1| ribonuclease D [Phenylobacterium zucineum HLK1]
          Length = 392

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/201 (27%), Positives = 92/201 (45%), Gaps = 7/201 (3%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           + A CA  +    +AVDTE +       +LC++Q +       I  +A     +  L  +
Sbjct: 10  LEAFCAKLKGQPFVAVDTEFMRETTYWPKLCLIQAAAPSAEAVIDPLADDIDLSCFLDIL 69

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
             DE  +K+FH  R D+ +      +  +P+F T++A         Q      ++++L I
Sbjct: 70  R-DESIQKVFHAARQDVEIFNNLGAM-PKPLFDTQVAGMAAGFGE-QIAYDALVRQMLKI 126

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            I K+ + +DW+   LSD QL YA +DV HL  L     ++L+R GR    T   N L D
Sbjct: 127 EIDKSSRFTDWARRPLSDSQLTYALADVTHLAKLYPLLRQRLEREGRLAWVTDEMNDLTD 186

Query: 190 RAELDL---LGWENVDIFSHS 207
            A  D+     W+ +    H+
Sbjct: 187 PANYDVEPENAWKRLRPRRHT 207


>gi|163792851|ref|ZP_02186827.1| Ribonuclease D [alpha proteobacterium BAL199]
 gi|159181497|gb|EDP66009.1| Ribonuclease D [alpha proteobacterium BAL199]
          Length = 386

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 91/199 (45%), Gaps = 6/199 (3%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           + A C        +AVDTE +       +LC+VQL+  D  V +  +A G   AP L  +
Sbjct: 10  LSALCDRLARERYVAVDTEFMRDKTYYAKLCLVQLAGADEAVAVDTLAPGIDLAP-LYAL 68

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + +    K+FH  R D+ +  +       P+F T+IA+     + +       ++ L G+
Sbjct: 69  MANPDVLKVFHAARQDVEIFVHQADAVPAPLFDTQIAAM-VCGFGDAVSYDRLVRGLTGV 127

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            + K  + +DWS   LS  Q++YA +DV+HL     +   KL++ GR +  +     L D
Sbjct: 128 KLDKTSRFTDWSHRPLSSRQIEYALADVIHLRPAYEKLHRKLEKTGRLEWLSEEMAVLTD 187

Query: 190 RAELDL---LGWENVDIFS 205
            A   +     W  + I S
Sbjct: 188 TATYKVPPEQSWRRLKIRS 206


>gi|319784197|ref|YP_004143673.1| ribonuclease D [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170085|gb|ADV13623.1| ribonuclease D [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 383

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 82/188 (43%), Gaps = 5/188 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
              D + VDTE +        LC++Q++    T  I  +A      P    ++ +E   K
Sbjct: 18  EKSDFVTVDTEFIRETTFWPILCLIQMAAPGVTALIDPLAPDIDLKPFFR-LMANEAVVK 76

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R DI ++ +   +   PVF T++A+     + +       ++ + G  + K+ + 
Sbjct: 77  VFHAARQDIEIIVHLGDLVPHPVFDTQVAAM-VCGFGDSVSYDQLVQRITGARLDKSSRF 135

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD--- 194
           +DW    LSD+QL YA +DV HL  +    + +L+R  R+         L  R   D   
Sbjct: 136 TDWRHRPLSDKQLDYALADVTHLIEVYQHLSAELERENRAHWLNEEMEVLTSRETYDPHP 195

Query: 195 LLGWENVD 202
              W+ + 
Sbjct: 196 EDAWKRLK 203


>gi|259416057|ref|ZP_05739977.1| ribonuclease D [Silicibacter sp. TrichCH4B]
 gi|259347496|gb|EEW59273.1| ribonuclease D [Silicibacter sp. TrichCH4B]
          Length = 385

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/197 (24%), Positives = 87/197 (44%), Gaps = 7/197 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A     + VDTE L       +LC++Q++    G     ++   +   +   L  +  +E
Sbjct: 17  AANYPYVTVDTEFLRERTYYSKLCLIQIAFRGDGKTDAVLVDPLSSDLSLEPLYELFRNE 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + +    V  +P+F T++A+     +  Q G +  ++++    + K
Sbjct: 77  DVVKVFHAARQDLEIFWVDASVFPKPLFDTQVAAM-VCGFGEQVGYETLVRKICKQGLDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
             + +DWS   LSD Q  YA +DV HL  +     ++L + GRS         L D A  
Sbjct: 136 TSRFTDWSRRPLSDAQKTYALADVTHLRQIYEHLRKELDKTGRSHWVAEELQVLTDPATY 195

Query: 194 DL---LGWENVDIFSHS 207
           D+     W  V   ++S
Sbjct: 196 DIQPREAWRRVKTRTNS 212


>gi|307295006|ref|ZP_07574848.1| ribonuclease D [Sphingobium chlorophenolicum L-1]
 gi|306879480|gb|EFN10698.1| ribonuclease D [Sphingobium chlorophenolicum L-1]
          Length = 388

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 51/190 (26%), Positives = 84/190 (44%), Gaps = 4/190 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 IA+DTE +        LC+VQ++       I   A G   +P L  M+ +E   
Sbjct: 20  IAKSPYIAIDTEFMRENSYWPDLCLVQVADEHEAAAIDPKAPGLDLSPLLDLMVDNEDVL 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH G  D+ +++   G    P+F T+IA+        Q G  + +   LG+ + K  +
Sbjct: 80  KVFHAGGQDLEIIYNLTGKTPHPLFDTQIAAMALG-LGEQIGYGNLVDAWLGVQLDKGAR 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL- 195
            +DW+   L   Q+ YA  DV +L  +  +  E+L+R GR D        + D +  +  
Sbjct: 139 FTDWARRPLDKRQIDYAIGDVTYLIQIFPKMLEELRRTGRGDWLDQEMERISDPSNYENK 198

Query: 196 --LGWENVDI 203
               W+ V I
Sbjct: 199 PDEAWQRVRI 208


>gi|87199358|ref|YP_496615.1| ribonuclease D [Novosphingobium aromaticivorans DSM 12444]
 gi|87135039|gb|ABD25781.1| ribonuclease D [Novosphingobium aromaticivorans DSM 12444]
          Length = 405

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 51/189 (26%), Positives = 89/189 (47%), Gaps = 7/189 (3%)

Query: 10  DIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           D+    A    D + VDTE +        LC+VQ++       I  +A G   +P L  +
Sbjct: 15  DLCERLA--KADFVTVDTEFMRENTYWPELCLVQIADDKEAAAIDPLAPGLDMSPLLDLL 72

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + +E   K+FH G  D+ +++   G    P+F T+IA       + Q G  + ++  LG+
Sbjct: 73  VDNEDVLKVFHAGGQDVEIIYNLTGKTPHPIFDTQIAMMAVS-QSEQIGYSNLVESWLGL 131

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-- 187
           +I K  + +DWS   L++ Q++YA  DV HL  +  +  ++L + GR +        L  
Sbjct: 132 SIDKGARFTDWSRRPLTERQIEYAIGDVTHLSKIFPKLLKRLIKTGRGEWLDIEMEKLAD 191

Query: 188 --MDRAELD 194
               R ++D
Sbjct: 192 PENYRTDMD 200


>gi|159184639|ref|NP_354170.2| ribonuclease D [Agrobacterium tumefaciens str. C58]
 gi|159139937|gb|AAK86955.2| ribonuclease D [Agrobacterium tumefaciens str. C58]
          Length = 388

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 2/180 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + I +DTE L        LC+VQ++     V +  +A G    P    ++ +    
Sbjct: 15  LAKSEFITIDTEFLRETTFWPELCLVQMASPTLEVLVDPLAKGIDLTPMF-ELMANPNVV 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   P+F T++A+     + +       ++++  + I K+ +
Sbjct: 74  KVFHAARQDIEIIYHLGGLIPHPIFDTQVAAM-VCGFGDSISYDQLVQKIKNVQIDKSSR 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L+++QL YA +DV HL  + L    +L+R GRS   T   N L  R   D+ 
Sbjct: 133 FTDWSRRPLTEKQLDYALADVTHLRDVYLSLKAQLEREGRSLWLTEEMNILESRDTYDMH 192


>gi|170746940|ref|YP_001753200.1| ribonuclease D [Methylobacterium radiotolerans JCM 2831]
 gi|170653462|gb|ACB22517.1| ribonuclease D [Methylobacterium radiotolerans JCM 2831]
          Length = 395

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 44/171 (25%), Positives = 78/171 (45%), Gaps = 1/171 (0%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE +       +LC++Q++  DGT  ++   A   +    + ++ DE+  
Sbjct: 17  LAEQPFVTVDTEFMRETTYYPKLCLIQMAAPDGTAVLVDPLAPGIDLDPFIALMADERTV 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +++   G+   P F T++A+     Y +    +  + ++    I K+ +
Sbjct: 77  KVFHSARQDLEIIWLIGGILPHPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKAKIDKSSR 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DWS   LS+ QL YA SDV HL  +      +L R  R          L
Sbjct: 136 FTDWSRRPLSEAQLTYALSDVTHLVKIYEVLVAELLRTDRGAWLDEEMAVL 186


>gi|170742646|ref|YP_001771301.1| ribonuclease D [Methylobacterium sp. 4-46]
 gi|168196920|gb|ACA18867.1| ribonuclease D [Methylobacterium sp. 4-46]
          Length = 394

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 82/187 (43%), Gaps = 2/187 (1%)

Query: 9   GDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ + CA       + VDTE +       +LC++Q++  DGT  ++   A   +     
Sbjct: 8   DDLTSACAHLSTQPFVTVDTEFMRETTYYPKLCLIQIAAPDGTTALVDPLAPGIDLAPFF 67

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ DE   K+FH  R D+ +++   G+  +P F T++A+     Y +    +  + ++ 
Sbjct: 68  ALMGDEGVLKVFHSARQDLEIIWLQGGLLPQPFFDTQVAAM-VCGYGDSVSYEQLVNDVA 126

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
              + K+ + +DWS   LS+ QL YA SDV HL  +      +L    R          L
Sbjct: 127 KAKVDKSSRFTDWSRRPLSEAQLTYALSDVTHLIKVYEALARQLLASDRGAWLDEEMAVL 186

Query: 188 MDRAELD 194
                 +
Sbjct: 187 TSPETYE 193


>gi|288958469|ref|YP_003448810.1| ribonuclease D [Azospirillum sp. B510]
 gi|288910777|dbj|BAI72266.1| ribonuclease D [Azospirillum sp. B510]
          Length = 396

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 60/194 (30%), Positives = 91/194 (46%), Gaps = 4/194 (2%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           MT I   +  + A C +    + I VDTE L       +LC+VQ+   DG V I  +A G
Sbjct: 1   MTLITTTDA-LQAFCQSLAGTEYITVDTEFLREKTYWPQLCLVQVGGPDGAVAIDPLAEG 59

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
               P L  ++ D    K+FH  R D+ + ++  G    P+F T++A+     +    G 
Sbjct: 60  IDLTP-LFALMSDPSVLKVFHAARQDVEIFWHLSGQIPHPLFDTQVAAM-VCGFGESVGY 117

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           +  + +L G  I K+ + +DWS   L++ QL YA SDV+HL     +   +L R GRS  
Sbjct: 118 ETLVTKLAGARIDKSSRFTDWSHRPLTERQLTYALSDVIHLRPAYEKLKRRLARSGRSHW 177

Query: 180 ATSCCNFLMDRAEL 193
                  L D A  
Sbjct: 178 LEEEMAILTDPATY 191


>gi|294013278|ref|YP_003546738.1| ribonuclease D [Sphingobium japonicum UT26S]
 gi|292676608|dbj|BAI98126.1| ribonuclease D [Sphingobium japonicum UT26S]
          Length = 401

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 84/190 (44%), Gaps = 4/190 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 IAVDTE +        LC+VQ++       I   A G   +P L  M+ +E   
Sbjct: 33  IAKSPYIAVDTEFMRENSYWPDLCLVQVADEHEAAAIDPKAPGLDLSPLLDLMVDNEDVL 92

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH G  D+ +++   G    P+F T+IA+        Q G  + +   LG+ + K  +
Sbjct: 93  KVFHAGGQDLEIIYNLTGKTPHPLFDTQIAAMALG-LGEQIGYGNLVDAWLGVQLDKGAR 151

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL- 195
            +DW+   L   Q+ YA  DV +L  +  +  E+L+R GR D        + D +  +  
Sbjct: 152 FTDWARRPLDKRQIDYAIGDVTYLIQIFPKMLEELRRTGRGDWLDQEMERISDPSNYENK 211

Query: 196 --LGWENVDI 203
               W+ V I
Sbjct: 212 PEEAWQRVRI 221


>gi|254294269|ref|YP_003060292.1| ribonuclease D [Hirschia baltica ATCC 49814]
 gi|254042800|gb|ACT59595.1| ribonuclease D [Hirschia baltica ATCC 49814]
          Length = 390

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 5/190 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +  + IAVDTE         +LC++Q +  +    I  ++     AP L  ++ D  R 
Sbjct: 25  LKKGEFIAVDTEFHRESTFWPKLCLIQAATLEFDCLIDPLSPNIDLAPFL-DLMADTSRV 83

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +     G    P+F +++A+       +    ++ + +LL   + K+ Q
Sbjct: 84  KVFHAARQDMEIFTKLIGTPPAPIFDSQVAAM-ACGLGDSVSYENLVSQLLKARVDKSSQ 142

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD-- 194
            +DW    L+++QL YA  DV HL    ++   KL++LGR          L++    D  
Sbjct: 143 FTDWQRRPLTEKQLDYARGDVTHLRHCYVKLKAKLEKLGRMGWIEEETEILVNPDTYDTN 202

Query: 195 -LLGWENVDI 203
               W+ + I
Sbjct: 203 PKNAWKRMKI 212


>gi|114326875|ref|YP_744031.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
 gi|114315049|gb|ABI61109.1| ribonuclease D [Granulibacter bethesdensis CGDNIH1]
          Length = 429

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 58/186 (31%), Positives = 85/186 (45%), Gaps = 3/186 (1%)

Query: 9   GDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A C   R    + +DTE +        LC+VQL   D    I  +A     AP   
Sbjct: 53  EDLAALCTTLRREPYVTIDTEFMRERTYWPELCVVQLGGADCVAVIDTLAPELDLAPV-G 111

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D    K+FH  R DI +    FG   +P+F T++A+     + +Q G    +  L 
Sbjct: 112 ELLADPAVIKVFHACRQDIEIFLLRFGSIPQPMFDTQVAAM-VAGFGDQVGYDTLVSSLT 170

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G +I KA + SDWS   LS  Q+ YAA+DV HL  +     ++L++ GR    +     L
Sbjct: 171 GGHIDKAHRFSDWSRRPLSQAQIDYAAADVTHLRGVYETLRDRLEKEGRLAWVSEEMAVL 230

Query: 188 MDRAEL 193
            D A  
Sbjct: 231 NDPATY 236


>gi|218461991|ref|ZP_03502082.1| RNase D protein [Rhizobium etli Kim 5]
          Length = 293

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +     
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRSKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LSD+QL+YA +DV HL  + L  + +L R GR+       + L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLSSQLDREGRTSWLREEMDVLE 184

Query: 189 DRAELDLL 196
            R   D+ 
Sbjct: 185 ARETYDMH 192


>gi|260466883|ref|ZP_05813067.1| ribonuclease D [Mesorhizobium opportunistum WSM2075]
 gi|259029385|gb|EEW30677.1| ribonuclease D [Mesorhizobium opportunistum WSM2075]
          Length = 383

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/205 (22%), Positives = 88/205 (42%), Gaps = 6/205 (2%)

Query: 2   TTIRVHEGDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
             +   + ++    AA    D + VDTE +        LC++Q++    T  I  +++  
Sbjct: 1   MHVITTQKELETALAAFEKSDFVTVDTEFIRETTFWPILCLIQMAAPGVTALIDPLSSDI 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
              P    ++ +E   K+FH  R DI ++ +   +   PVF T++A+     + +     
Sbjct: 61  DLRPFFK-LMANEAVVKVFHAARQDIEIIVHLGDLVPHPVFDTQVAAM-VCGFGDSVSYD 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             ++ + G  + K+ + +DW    LSD+QL YA +DV HL  +      +L R  R+   
Sbjct: 119 QLVQRITGARLDKSSRFTDWRHRPLSDKQLDYALADVTHLIEVYQHLNAELARENRAHWL 178

Query: 181 TSCCNFLMDRAELD---LLGWENVD 202
               + L  R   D      W+ + 
Sbjct: 179 NEEMDVLTSRETYDPHPEDAWKRLK 203


>gi|85373619|ref|YP_457681.1| ribonuclease D [Erythrobacter litoralis HTCC2594]
 gi|84786702|gb|ABC62884.1| ribonuclease D [Erythrobacter litoralis HTCC2594]
          Length = 401

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/197 (24%), Positives = 84/197 (42%), Gaps = 5/197 (2%)

Query: 2   TTIRVHEGD---IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
             I     D   +   C      + + +DTE +        LC++Q+   +    +  +A
Sbjct: 1   MKIHDLITDTATLAELCDRLAQHEFVCIDTEFMRENTYWPELCLIQIGNEEEAAAVDPLA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
            G    P L  M  +E   K+FH G  D+ +++   G    P+F T+IA       + Q 
Sbjct: 61  DGIDLQPLLDLMCENEDILKVFHAGGQDVEIVYNLTGKTPFPIFDTQIAMMAIS-QSEQI 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G  + ++  L   I K  + +DWS   L+D Q++YA  DV +L  +  +   KL + GR 
Sbjct: 120 GYANLVESWLNKTIDKGARFTDWSRRPLTDRQIEYAIGDVTYLAKIFPKILNKLVKTGRG 179

Query: 178 DLATSCCNFLMDRAELD 194
               +  + L D A  +
Sbjct: 180 AWLNAEMDKLADPANYE 196


>gi|329850483|ref|ZP_08265328.1| ribonuclease D [Asticcacaulis biprosthecum C19]
 gi|328840798|gb|EGF90369.1| ribonuclease D [Asticcacaulis biprosthecum C19]
          Length = 417

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 55/177 (31%), Positives = 85/177 (48%), Gaps = 4/177 (2%)

Query: 9   GDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A C A +    I VDTE +       +LC++Q +  D    I  +A      P L 
Sbjct: 8   NDLIAFCEAIKSAPFITVDTEFMRETTYWPKLCLIQAASEDHAAIIDPLAKSLDLKPFL- 66

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L DEK  K+FH  R D+ +      +   P+F T++A+        Q      +++ L
Sbjct: 67  DILADEKILKVFHACRQDMEIFVNLGTM-PMPIFDTQVAAMAAGYGD-QVAYDSLVRQKL 124

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            I+I K  + +DWS   LSD+QLQYA  DV HL  L  +  ++L R GR +  ++  
Sbjct: 125 KIDIDKGSRFTDWSRRPLSDQQLQYALGDVTHLAKLYPKLRDRLAREGRLEWVSAEM 181


>gi|330991792|ref|ZP_08315742.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
 gi|329761260|gb|EGG77754.1| Ribonuclease D [Gluconacetobacter sp. SXCC-1]
          Length = 395

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/176 (30%), Positives = 88/176 (50%), Gaps = 2/176 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            R    + +DTE +        LC+VQL+ G+  V +I   A   +  +L G+L D    
Sbjct: 28  LRREPFVTIDTEFVRERTYWPELCLVQLA-GENDVVVIDTTAPGIDLSSLGGLLDDAGVI 86

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +  + F      +F T++A+     Y +Q G  + +  LLG+ I K+ +
Sbjct: 87  KVFHAARQDLEIFLHLFDRLPAALFDTQVAAM-VAGYGDQVGYDNLVWSLLGVQIDKSHR 145

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            SDWS   LS  Q+ YAA+DV +L  +  Q   +L++ GR D   +  + L + A 
Sbjct: 146 FSDWSVRPLSAAQIGYAAADVTYLRQVYGQLLAQLEKEGRLDWVAAELDVLNNPAT 201


>gi|13476899|ref|NP_108468.1| ribonuclease D [Mesorhizobium loti MAFF303099]
 gi|14027660|dbj|BAB53929.1| ribonuclease D [Mesorhizobium loti MAFF303099]
          Length = 383

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 5/188 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
              D + VDTE +        LC++Q++    T  I  ++     AP    ++ +E   K
Sbjct: 18  EKSDFVTVDTEFIRETTFWPILCLIQMAAPGVTALIDPLSPDINLAPFFR-LMANEAVVK 76

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R DI ++ +   +   PVF T++A+     + +       ++ + G  + K+ + 
Sbjct: 77  VFHAARQDIEIIVHLGDLVPHPVFDTQVAAM-VCGFGDSVSYDQLVQRITGARLDKSSRF 135

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD--- 194
           +DW    LSD+QL YA +DV HL  +    + +L R  R+       + L  R   D   
Sbjct: 136 TDWRHRPLSDKQLDYALADVTHLIEVYQHLSAELARENRAHWLNEEMDVLTSRETYDPHP 195

Query: 195 LLGWENVD 202
              W+ + 
Sbjct: 196 EDAWKRLK 203


>gi|254466167|ref|ZP_05079578.1| ribonuclease D [Rhodobacterales bacterium Y4I]
 gi|206687075|gb|EDZ47557.1| ribonuclease D [Rhodobacterales bacterium Y4I]
          Length = 385

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 53/198 (26%), Positives = 92/198 (46%), Gaps = 7/198 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVD 72
           AA     + VDTE L       +LC++QL+    G+    ++   A   +   L  +  D
Sbjct: 16  AAAQHPYVTVDTEFLRERTYYSKLCLIQLAFSGNGEDDAVLVDPLADGISLEPLYALFRD 75

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
           E   K+FH  R D+ + +   GV  +P+F T++A+     +  Q G +  +++++   + 
Sbjct: 76  ENVVKVFHAARQDLEIFWVDAGVFPKPLFDTQVAAM-VCGFGEQAGYETLVRKIVKQGLD 134

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           K  + +DWS   LS+ Q  YA +DV HL  +      +L++ GRS         L D A 
Sbjct: 135 KTSRFTDWSRRPLSEAQKTYALADVTHLRKIYEFLAAELEKSGRSHWVAEELQVLTDPAT 194

Query: 193 LDL---LGWENVDIFSHS 207
            D+     W+ V   ++S
Sbjct: 195 YDIQPQEAWQRVKTRTNS 212


>gi|300024345|ref|YP_003756956.1| ribonuclease D [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526166|gb|ADJ24635.1| ribonuclease D [Hyphomicrobium denitrificans ATCC 51888]
          Length = 384

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/195 (28%), Positives = 90/195 (46%), Gaps = 4/195 (2%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           M TI      + A C      D +AVDTE L        LC++QL+  +    +  +A G
Sbjct: 1   MQTITTTPE-LAALCETLSRSDYVAVDTEFLREQTFWPLLCLIQLAGPEAEAIVDPLAPG 59

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
              AP    ++ D    K+FH  R DI ++F   GV   PVF +++A+     + +    
Sbjct: 60  LDLAP-FYHLMADTSTVKVFHAARQDIEIVFLKSGVVPTPVFDSQVAAM-VCGFGDSISY 117

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
            + +K+  G ++ K+ + +DWS   LS +QL YA +DV +L  +  +  + L + GR+  
Sbjct: 118 VNLVKKTTGADLDKSSRFTDWSRRPLSPKQLDYALADVTYLRDVYQRLRQTLDKTGRTPW 177

Query: 180 ATSCCNFLMDRAELD 194
                  L   A  D
Sbjct: 178 LQEEMGVLTSPATYD 192


>gi|110633474|ref|YP_673682.1| ribonuclease D [Mesorhizobium sp. BNC1]
 gi|110284458|gb|ABG62517.1| ribonuclease D [Chelativorans sp. BNC1]
          Length = 392

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 85/179 (47%), Gaps = 2/179 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +        LC++Q++    T  +  +A G   AP    ++ +E+ 
Sbjct: 16  ALENSDFVTVDTEFIRETTFWPELCLIQMAAPGVTALVDPLADGMDLAPFFR-LMGNEQV 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI +++   G+   P+F T++A+     + +       +  + G +I K  
Sbjct: 75  VKVFHAARQDIEIIYNRGGLIPHPIFDTQVAAM-VCGFGDSISYDQLVLRITGEHIDKTS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
           + +DW    LS++QL+YA +DV HL  +    T +LQR GR        + L  R   D
Sbjct: 134 RFTDWRHRPLSEKQLRYALADVTHLIPVYAHLTTELQRGGREGWLKEEMDVLTARETYD 192


>gi|326388937|ref|ZP_08210519.1| ribonuclease D [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206537|gb|EGD57372.1| ribonuclease D [Novosphingobium nitrogenifigens DSM 19370]
          Length = 445

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 81/171 (47%), Gaps = 1/171 (0%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + + VDTE +        LC+VQ++       I  +A G   +P L  ++ +E   
Sbjct: 20  LAKAEFVTVDTEFMRENTYWPELCLVQIADDKEAAAIDPMAPGIDLSPLLDLLVDNEDVL 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH G  D+ +++   G    P+F T+IA       + Q G  + ++  LG +I K  +
Sbjct: 80  KVFHAGGQDVEIIYNLTGRTPHPIFDTQIAMMAVS-QSEQIGYSNLVESWLGFSIDKGAR 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DWS   L++ Q++YA  DV HL  +  +  ++L + GR +        L
Sbjct: 139 FTDWSRRPLTERQIEYAIGDVTHLSKIFPRILKRLIKTGRGEWLDIEMEKL 189


>gi|163759179|ref|ZP_02166265.1| putative ribonuclease D [Hoeflea phototrophica DFL-43]
 gi|162283583|gb|EDQ33868.1| putative ribonuclease D [Hoeflea phototrophica DFL-43]
          Length = 383

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/180 (26%), Positives = 82/180 (45%), Gaps = 2/180 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + + VDTE L        LC++Q++  D    +  +A G  +      ++ D    
Sbjct: 17  LAAHEFVTVDTEFLRETTYWPELCLIQMAGPDDEGIVDPLAEGI-DLKPFFELMADTSVV 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++ +   +   P+F T++A+     +         +  + G +I K+ +
Sbjct: 76  KVFHAARQDIEIMVHRGDLVPHPIFDTQVAAM-VCGFGESISYDQLVSRITGAHIDKSSR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   LSD+QL YA +DV HL  + L+   +L+  GRS         L  RA  ++ 
Sbjct: 135 FTDWSRRPLSDKQLDYALADVTHLRDVYLELLSRLKAEGRSHWVADEMAVLESRATYEIE 194


>gi|149186862|ref|ZP_01865172.1| ribonuclease D [Erythrobacter sp. SD-21]
 gi|148829529|gb|EDL47970.1| ribonuclease D [Erythrobacter sp. SD-21]
          Length = 411

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 10/209 (4%)

Query: 1   MTTIR--VHEGD-IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI 56
           M  I   + + D + A C      D + VDTE +        LC+VQ++  +    I  +
Sbjct: 1   MMKIHDLITDTDTLAAMCERLAKSDFVTVDTEFMRENTYWPELCLVQIANEEEAAAIDPL 60

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
           A G    P    +  +E+  K+FH G  D+ +++   G    P+F T+IA         Q
Sbjct: 61  ADGIDLQPLWDLLCDNEEVLKVFHAGGQDVEIVYNFTGKTPHPIFDTQIAMMAIS-QNEQ 119

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G  + ++  +GI + K  + +DW    L+D Q++YA  DV HL  +     +KL + GR
Sbjct: 120 IGYANLVESWMGITVDKGARFTDWGRRPLTDRQIEYAIGDVTHLSKIFPMILKKLIKTGR 179

Query: 177 SDLATSCCNFLMDRAEL----DLLGWENV 201
                +  + L D A      DL  W+ +
Sbjct: 180 GVWLDAEMDKLADPANYANNADLA-WKRI 207


>gi|83593408|ref|YP_427160.1| ribonuclease D [Rhodospirillum rubrum ATCC 11170]
 gi|83576322|gb|ABC22873.1| Ribonuclease D [Rhodospirillum rubrum ATCC 11170]
          Length = 386

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 83/185 (44%), Gaps = 3/185 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+   CA       + VDTE +       +LC++QL+ G      +   A   +   L  
Sbjct: 9   DLADFCARLSTESFVTVDTEFMREKTYWPKLCLIQLA-GTTEAHCVDPLAPDIDMAPLFA 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +E   K+FH  R D+ +  +  G   +P+F T++A+     + +  G +  + +L  
Sbjct: 68  LMANESVLKVFHAARQDLEIFLHESGHLPKPIFDTQVAAM-VCGFGDSVGYETLVAKLAK 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             I K+ + +DW+   L+D QL YAA DV HL  +  +  E L   GR+         L 
Sbjct: 127 ARIDKSMRFTDWARRPLNDRQLVYAAGDVTHLRVVYERLAETLAANGRTAWLDQEMAILT 186

Query: 189 DRAEL 193
           D A  
Sbjct: 187 DPAHY 191


>gi|84501108|ref|ZP_00999343.1| ribonuclease D [Oceanicola batsensis HTCC2597]
 gi|84391175|gb|EAQ03593.1| ribonuclease D [Oceanicola batsensis HTCC2597]
          Length = 385

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 89/191 (46%), Gaps = 6/191 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGTVDIIRI 56
           M TI   E D+ A C  A   D + VDTE L       +LC++Q++     D    +I  
Sbjct: 1   MRTITTTE-DLAAFCNEAASCDYVTVDTEFLRERTYYSQLCLIQMAMPGEDDENAVLIDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            +G  +   L  +  ++   K+FH  R D+ + +   GV  +P+F T+IA+     +  Q
Sbjct: 60  LSGNLDLAPLYELFRNQAVVKVFHAARQDLEIFYVDAGVIPQPLFDTQIAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K +    + K+ + +DWS   L++ Q +YA +DV HL  +     +KL+R  R
Sbjct: 119 VGYETLVKRIAKQQLDKSSRFTDWSRRPLTEAQKKYALADVTHLRKIYEYLADKLRRQKR 178

Query: 177 SDLATSCCNFL 187
                     L
Sbjct: 179 EAWVEEELGIL 189


>gi|217976404|ref|YP_002360551.1| ribonuclease D [Methylocella silvestris BL2]
 gi|217501780|gb|ACK49189.1| ribonuclease D [Methylocella silvestris BL2]
          Length = 405

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 86/187 (45%), Gaps = 5/187 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE L       +LC+VQL+  D  V +  +A+G   AP L  ++ D    
Sbjct: 23  LASHAFVTVDTEFLRETTFWPKLCVVQLASADEAVAVDALASGLDLAP-LFELMADPAVV 81

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +++    +   P+F T++A+     + +Q    D ++ +  +++ K+ +
Sbjct: 82  KVFHAARQDLEIVWNLAKIIPAPLFDTQVAAM-VCGFGDQVSYGDLVQTVCKVSLDKSSR 140

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL- 195
            +DWS   L   Q+ YA +DV +L  +     +KL+  GR    +     L   A  +  
Sbjct: 141 FTDWSRRPLLPAQVDYAIADVTYLRDIYAILQDKLKETGRLGWLSDEMALLTSPATYEQH 200

Query: 196 --LGWEN 200
               WE 
Sbjct: 201 PDNAWER 207


>gi|148255258|ref|YP_001239843.1| ribonuclease D (RNase D) [Bradyrhizobium sp. BTAi1]
 gi|146407431|gb|ABQ35937.1| Ribonuclease D (RNase D) [Bradyrhizobium sp. BTAi1]
          Length = 384

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 53/197 (26%), Positives = 86/197 (43%), Gaps = 6/197 (3%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A CA       I VDTE L        LC+VQ++  D    +I   A   +  +   
Sbjct: 9   DLSAACARLAQHPVITVDTEFLRETTYYPLLCVVQMASPDE-ALVIDALAEGIDLTSFFE 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +EK  K+FH  R DI ++++   +   P+F T++A+ +             ++ + G
Sbjct: 68  LMANEKVLKVFHAARQDIEIIWHRANIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
               K  + +DWS   LS EQ+ YA +DV HL  +       L++ GRSD  +     L 
Sbjct: 127 HRPDKTHRFTDWSRRPLSKEQVHYAEADVTHLRDVFAALDADLKKRGRSDWVSEEMEILT 186

Query: 189 DRAELDLL---GWENVD 202
                D      WE + 
Sbjct: 187 SPRTYDFHPERAWERLK 203


>gi|99081315|ref|YP_613469.1| ribonuclease D [Ruegeria sp. TM1040]
 gi|99037595|gb|ABF64207.1| ribonuclease D [Ruegeria sp. TM1040]
          Length = 385

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 49/197 (24%), Positives = 89/197 (45%), Gaps = 7/197 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A     + VDTE L       +LC++Q++    G+    ++   +G  +   L  +  +E
Sbjct: 17  AAKYPYVTVDTEFLRERTYYSKLCLIQIAYRGDGETDAVLVDPLSGDLSLEPLYELFRNE 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + +   GV  +P+F T++A+     +  Q G +  ++++    + K
Sbjct: 77  DVVKVFHAARQDLEIFWVDAGVFPKPLFDTQVAAM-VCGFGEQVGYETLVRKICKQGLDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
             + +DWS   LSD Q  YA +DV HL  +     ++L +  RS         L D A  
Sbjct: 136 TSRFTDWSRRPLSDAQKTYALADVTHLRQIYEHLRKELDKTKRSHWVAEELQVLTDPATY 195

Query: 194 DL---LGWENVDIFSHS 207
           ++     W  V   ++S
Sbjct: 196 NIQPREAWRRVKTRTNS 212


>gi|294084191|ref|YP_003550949.1| ribonuclease D [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663764|gb|ADE38865.1| ribonuclease D [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 409

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 86/192 (44%), Gaps = 7/192 (3%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R    +A+DTE +       +LC++Q+  G   V I  +A    N   L  ++ DE   K
Sbjct: 45  RGKPFLAIDTEFMRERTYYPQLCLIQVGDGTKAVAIDPLAK-NLNLEPLWSLMRDESIIK 103

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH G  D+ +     G    PV+ T+IA  L   + +Q G    +K +LG N+ K  + 
Sbjct: 104 VFHAGNQDMEIFLNEMGGLPSPVYDTQIA-GLVCGHGDQIGYDSLVKSILGKNVDKTSRF 162

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL---- 193
           +DWS   L+D Q+ YA  DV++L  +     +K+    R++          D A      
Sbjct: 163 TDWSKRPLTDRQISYALDDVIYLAQIYPIMLDKIASENRTNWLDEEFKKFSDPATYVTKP 222

Query: 194 DLLGWENVDIFS 205
           +   W+ + I  
Sbjct: 223 E-NAWKRIKIRH 233


>gi|13195121|gb|AAK13017.1| RNase D [Agrobacterium tumefaciens]
          Length = 388

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 86/180 (47%), Gaps = 2/180 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + I  DTE L        LC+VQ++     V +  +A G    P    ++ +    
Sbjct: 15  LAKSEFITTDTEFLRETTFWPELCLVQMASPTLEVLVDPLAKGIDLTPMF-ELMANPNVV 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   P+F T++A+     + +       ++++  + I K+ +
Sbjct: 74  KVFHAARQDIEIIYHLGGLIPHPIFDTQVAAM-VCGFGDSISYDQLVQKIKNVQIDKSSR 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L+++QL YA +DV HL  + L    +L+R GRS   T   N L  R   D+ 
Sbjct: 133 FTDWSRRPLTEKQLDYALADVTHLRDVYLSLKAQLEREGRSLWLTEEMNILESRDTYDMH 192


>gi|15895183|ref|NP_348532.1| ribonuclease D [Clostridium acetobutylicum ATCC 824]
 gi|15024889|gb|AAK79872.1|AE007698_6 Ribonuclease D [Clostridium acetobutylicum ATCC 824]
 gi|325509325|gb|ADZ20961.1| Ribonuclease D [Clostridium acetobutylicum EA 2018]
          Length = 205

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 105/208 (50%), Gaps = 7/208 (3%)

Query: 1   MTTIRVHEGDIPAEC---AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M  I++ + D+              IA+DTET GL P +D+LC++Q+   +    I    
Sbjct: 1   MYNIKLCKLDLDNNDKRYILNNCKYIAIDTETTGLDPLKDKLCLIQICAKEKIFLI---K 57

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYT-FGVRVRPVFCTKIASRLTRTYTNQ 116
               N  NL+G+L   K  KIFH+  FD+  L        +  V CTKIA++L      +
Sbjct: 58  YNNSNQKNLIGILQCSKIIKIFHHANFDLRFLMKNLKIYNINNVVCTKIAAKLLNGIEIE 117

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
           + LK  L++ L INI K  Q S+WSA++L+ EQ+QYA  DV++L  L      +L +   
Sbjct: 118 NSLKKLLRKYLNINIDKKLQKSNWSAENLTKEQIQYATYDVIYLEKLWRALKAELIKANL 177

Query: 177 SDLATSCCNFLMDRAELDLLGWENVDIF 204
             LA  C  +L   A L   G EN+ I+
Sbjct: 178 YSLAEECFKYLPTNAILHNRGIENIFIY 205


>gi|188582284|ref|YP_001925729.1| ribonuclease D [Methylobacterium populi BJ001]
 gi|179345782|gb|ACB81194.1| ribonuclease D [Methylobacterium populi BJ001]
          Length = 384

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 2/178 (1%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   CA       + VDTE +       +LC++Q++  DG   ++   A   +      +
Sbjct: 10  LSDACARLAAQTFVTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFEL 69

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + DE   K+FH  R D+ +++   G+   P F T++A+     Y +    +  + ++   
Sbjct: 70  MADESTVKVFHSARQDLEIIWLLGGLLPHPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKA 128

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            I K+ + +DWS   LS+ QL YA SDV HL  +      +L    R          L
Sbjct: 129 RIDKSSRFTDWSRRPLSEAQLAYALSDVTHLVTIYQVLAAELLSTDRGLWLDEEMAVL 186


>gi|254474856|ref|ZP_05088242.1| ribonuclease D [Ruegeria sp. R11]
 gi|214029099|gb|EEB69934.1| ribonuclease D [Ruegeria sp. R11]
          Length = 385

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 54/214 (25%), Positives = 92/214 (42%), Gaps = 9/214 (4%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGTVDIIRI 56
           M TI   +  +   C  A     + VDTE L       +LC+VQL+     +    ++  
Sbjct: 1   MKTITTTDE-LETFCQEAAQHPYVTVDTEFLRERTYFSKLCLVQLAYPGKDNENAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            A   +   L  +  +E   K+FH  R D+ + +    V   P+F T++A+     +  Q
Sbjct: 60  LADGLSLEPLYALFRNESVVKVFHAARQDLEIFWVDAQVFPTPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +++++   + K  + +DWS   LSD Q  YA +DV HL  +      +L+R  R
Sbjct: 119 VGYETLVRKIVKQGLDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEHLAAELKRTER 178

Query: 177 SDLATSCCNFLMDRAELDLL---GWENVDIFSHS 207
           S         L D A  ++     W  V   ++S
Sbjct: 179 SHWVAEELQVLTDPATYEINPRDAWRRVKTRTNS 212


>gi|296446899|ref|ZP_06888835.1| ribonuclease D [Methylosinus trichosporium OB3b]
 gi|296255574|gb|EFH02665.1| ribonuclease D [Methylosinus trichosporium OB3b]
          Length = 388

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 85/197 (43%), Gaps = 6/197 (3%)

Query: 9   GDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A CA       + VDTE L       ++C++QL+  +     +   A   +     
Sbjct: 8   EDLAAACARLSRHPFVTVDTEFLRETTFWPKVCVIQLASPEE-AFAVDTLAEGLDLSPFF 66

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ D    K+FH  R D+ +++    +   P+F T++A+     + +Q    + +K + 
Sbjct: 67  ELMADASVVKVFHAARQDLEIIWRLARLIPTPLFDTQVAAM-VCGFGDQASYVELVKAIA 125

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++ K+ + +DWS   LS  Q+ YA +DV HL  +     ++L+R  R D        L
Sbjct: 126 KESLDKSSRFTDWSKRPLSVAQIDYAIADVTHLRQIYTHLRQRLERSNRLDWLVDEMRTL 185

Query: 188 MDRAELDL---LGWENV 201
                 +      WE +
Sbjct: 186 TSPETYEQSPENAWERL 202


>gi|254461790|ref|ZP_05075206.1| ribonuclease D [Rhodobacterales bacterium HTCC2083]
 gi|206678379|gb|EDZ42866.1| ribonuclease D [Rhodobacteraceae bacterium HTCC2083]
          Length = 385

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 90/210 (42%), Gaps = 9/210 (4%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRI 56
           M TI   E  +   C  A+    + VDTE L       +LC+VQL+     D    ++  
Sbjct: 1   MLTITTTEA-LAEFCEEAKKHAYVTVDTEFLRERTYYSKLCLVQLAMPGTDDSNGCLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +  D    K+FH  R DI +     GV   P+F T++AS     +  Q
Sbjct: 60  LVEGISLEPLYDLFRDTSVVKVFHAARQDIEIFQVDAGVIPTPLFDTQVASM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++++    I K+ + +DWS   LSD Q +YA +DV HL  +     +KL+  GR
Sbjct: 119 VGYETLVRKIAKQEIDKSSRFTDWSRRPLSDAQAKYALADVTHLRQVYEFLAKKLKDQGR 178

Query: 177 SDLATSCCNFLMDR---AELDLLGWENVDI 203
           S         L +      L    W+ V I
Sbjct: 179 SHWVDEEMKILNNPDTYITLPENAWKRVKI 208


>gi|16125948|ref|NP_420512.1| ribonuclease D [Caulobacter crescentus CB15]
 gi|221234713|ref|YP_002517149.1| ribonuclease D [Caulobacter crescentus NA1000]
 gi|13423116|gb|AAK23680.1| ribonuclease D [Caulobacter crescentus CB15]
 gi|220963885|gb|ACL95241.1| ribonuclease D [Caulobacter crescentus NA1000]
          Length = 389

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/178 (26%), Positives = 81/178 (45%), Gaps = 3/178 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +AVDTE +       +LC++Q++       I  +A    +   L+ ++ DE+  
Sbjct: 17  LAGEPFVAVDTEFMRETTYWPKLCLIQVASPTQEAVIDPLA-DNIDLEPLLVVMRDERIL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +      +  +P+F T++A         Q      ++++L I I K+ +
Sbjct: 76  KVFHAARQDVEIFNNLKAM-PKPLFDTQVAGMAAGFGE-QIAYDALVRQMLRIEIDKSSR 133

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
            +DW+   L+D QL YA +DV HL  L     E+L+  GR          + D A  D
Sbjct: 134 FTDWARRPLTDAQLSYALADVTHLAKLFPILRERLETSGRLAWVEEEMTAISDPAAYD 191


>gi|85708161|ref|ZP_01039227.1| ribonuclease D [Erythrobacter sp. NAP1]
 gi|85689695|gb|EAQ29698.1| ribonuclease D [Erythrobacter sp. NAP1]
          Length = 400

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 88/196 (44%), Gaps = 5/196 (2%)

Query: 2   TTIR--VHEGD-IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
             I   +   D +   C      + +AVDTE +        LC+VQ++  +    I  +A
Sbjct: 1   MKIHDLITTSDALADLCERLSQSEFVAVDTEFMRENTYWPELCLVQIANTEEAAAIDPLA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
            G   +P L  +  +++  K+FH G  D+ ++    G    P+F T+I S +  + + Q 
Sbjct: 61  DGIDLSPLLELLTENDEVLKVFHAGGQDVEIIVNMTGKTPFPIFDTQI-SMMAISQSEQI 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G  + +   L I + K  + +DWS   L+D Q++YA  DV HL  +  +  +KL +  R 
Sbjct: 120 GYANLVDHWLNITVDKGARFTDWSRRPLTDRQIEYAIGDVTHLSKIFPKILKKLMKTERG 179

Query: 178 DLATSCCNFLMDRAEL 193
               +    L D +  
Sbjct: 180 AWLDAEMEKLADPSNY 195


>gi|126737525|ref|ZP_01753255.1| ribonuclease D [Roseobacter sp. SK209-2-6]
 gi|126720918|gb|EBA17622.1| ribonuclease D [Roseobacter sp. SK209-2-6]
          Length = 388

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/208 (25%), Positives = 92/208 (44%), Gaps = 8/208 (3%)

Query: 2   TTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIA 57
             I     ++ + C  A     + VDTE L       +LC++QL+    G+    ++   
Sbjct: 1   MKIITTTDELQSFCEEAAQYAYVTVDTEFLRERTYYSKLCLIQLAFAGDGEEDAVLVDPL 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
           A       L  +  +E   K+FH  R D+ + +   GV  +P+F T++A+     +  Q 
Sbjct: 61  AEGLALDPLYDLFRNEAVVKVFHAARQDLEIFWVDAGVFPKPLFDTQVAAM-VCGFGEQV 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G +  ++++   ++ K+ + +DWS   LS  Q  YA +DV HL  +     ++L++ GRS
Sbjct: 120 GYETLVRKIAKQSLDKSSRFTDWSRRPLSGAQKTYALADVTHLRRIYEFLAKELEKSGRS 179

Query: 178 DLATSCCNFLMDRAELDL---LGWENVD 202
                    L D A  D+     W  V 
Sbjct: 180 HWVAEELKVLTDPATYDIRPEEAWRRVK 207


>gi|260433597|ref|ZP_05787568.1| ribonuclease D [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417425|gb|EEX10684.1| ribonuclease D [Silicibacter lacuscaerulensis ITI-1157]
          Length = 424

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/214 (23%), Positives = 95/214 (44%), Gaps = 9/214 (4%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGTVDIIRI 56
           M T++  +  +   C  A     + VDTE L       +LC++Q++     + +  ++  
Sbjct: 40  MKTLKTTQE-LADFCRLAANFPYVTVDTEFLRERTYYSKLCLIQMAVPSEDEDSAVLVDP 98

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            A   +   L  +  +E   K+FH  R D+ + +   G+  +P+F T++A+     +  Q
Sbjct: 99  LADGLSLDPLYELFQNEDVVKVFHAARQDLEIFWVEAGIFPKPLFDTQVAAM-VCGFGEQ 157

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++++    + K  + +DWS   LSD Q  YA +DV HL  +      +L++ GR
Sbjct: 158 VGYETLVRKICKQGLDKTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEYLAAELEKTGR 217

Query: 177 SDLATSCCNFLMDRAELDL---LGWENVDIFSHS 207
           S         L +    D+     W  V   ++S
Sbjct: 218 SRWVAEELRVLTNPETYDIRPEEAWRRVKTRTNS 251


>gi|46202610|ref|ZP_00208583.1| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 398

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 88/195 (45%), Gaps = 7/195 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    + VDTE +       +LC+VQ++  D    I  +A G    P L  ++ D    
Sbjct: 17  LKSAPFVTVDTEFMREKTYWPQLCLVQVAGPDEARAIDPLAPGMDLTP-LFELMADTNVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +  +       P+F T+IA+     + +  G +    +L    I K+ +
Sbjct: 76  KVFHAARQDVEIFLHLADAIPTPIFDTQIAAM-VCGFGDSVGYETLASQLAKARIDKSMR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD----RAE 192
            +DWS   LS++Q+QYA +DV HL     +   KL+R GR +  +     L +    R +
Sbjct: 135 FTDWSIRPLSEKQIQYALADVTHLRVAYEKLVRKLERNGRIEWLSEEMALLTEPGTYRVD 194

Query: 193 LDLLGWENVDIFSHS 207
            +   W  +   S S
Sbjct: 195 PE-NAWRRLKPRSTS 208


>gi|103487237|ref|YP_616798.1| ribonuclease D [Sphingopyxis alaskensis RB2256]
 gi|98977314|gb|ABF53465.1| ribonuclease D [Sphingopyxis alaskensis RB2256]
          Length = 395

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/189 (28%), Positives = 83/189 (43%), Gaps = 4/189 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +  D IAVDTE +        LC++Q++  +    I  +A G    P L  ++ +E   K
Sbjct: 21  KDSDFIAVDTEFMRENTFWPELCLIQVADTEHAAAIDPMAQGMDLKPLLDLLVDNEDMLK 80

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH G  D+ ++F   G    P+F T+I          Q G  + ++  LG+ + K  + 
Sbjct: 81  VFHAGGQDVEIIFNLTGKTPHPIFDTQIGQMALG-QAEQVGYSNLVEAWLGLQLDKGARF 139

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL-- 195
           +DWS   L   Q+ YA  DV HL  +     +KL R GR          L D A   +  
Sbjct: 140 TDWSRRPLDKRQIDYAIGDVTHLAKIFPMMLDKLIRTGRGHWLDEEMEKLADPANYSVDP 199

Query: 196 -LGWENVDI 203
              W+ + I
Sbjct: 200 DKAWQRIKI 208


>gi|46204778|ref|ZP_00049503.2| COG0349: Ribonuclease D [Magnetospirillum magnetotacticum MS-1]
          Length = 214

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 79/178 (44%), Gaps = 2/178 (1%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   CA       + VDTE +       +LC++Q++  DG   ++   A   +    + +
Sbjct: 10  LSDACARLAAQSFVTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKGLDLKPFLDL 69

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + DE   K+FH  R D+ +++   G+   P F T++A+     Y +    +  + ++   
Sbjct: 70  MADESTVKVFHSARQDLEIIWLLGGLLPHPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKA 128

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            I K+ + +DWS   LSD QL YA SDV HL  +      +L R  R          L
Sbjct: 129 RIDKSSRFTDWSRRPLSDAQLAYALSDVTHLVTIYQVLAAELVRTDRGLWLDEEMAVL 186


>gi|75675781|ref|YP_318202.1| ribonuclease D [Nitrobacter winogradskyi Nb-255]
 gi|74420651|gb|ABA04850.1| ribonuclease D [Nitrobacter winogradskyi Nb-255]
          Length = 382

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 I VDTE L        LC++QL+  D    ++   AG  +      ++ +E   
Sbjct: 17  LARHPVITVDTEFLRETTYYPLLCVIQLASPDE-AVVVDALAGGIDLKPFFALMSNESVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   PVF T++A+ +             ++ + G    K  +
Sbjct: 76  KVFHAARQDIEIIWHQAGLIPHPVFDTQVAAMVLGHGD-SIAYDALVERITGHRPDKTHR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L+ EQL+YA +DV HL  +       L + GRSD  +     L      D  
Sbjct: 135 FTDWSRRPLTAEQLEYAVADVTHLRDVFAALDADLSKRGRSDWVSEEMEVLTSPKTYDFH 194

Query: 197 ---GWENVD 202
               WE + 
Sbjct: 195 PERAWERLK 203


>gi|146340329|ref|YP_001205377.1| ribonuclease D (RNase D) [Bradyrhizobium sp. ORS278]
 gi|146193135|emb|CAL77147.1| Ribonuclease D (RNase D) [Bradyrhizobium sp. ORS278]
          Length = 389

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 55/197 (27%), Positives = 87/197 (44%), Gaps = 6/197 (3%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A CA       I VDTE L        LC+VQ++  D  V I  +A G  +      
Sbjct: 16  DLAAACARLAQHPVITVDTEFLRETTYYPLLCVVQMASQDEAVVIDALAEGI-DLKAFFE 74

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +EK  K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G
Sbjct: 75  LMANEKVLKVFHAARQDIEIIWHRAGIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITG 133

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
               K  + +DWS   L+ EQ  YA +DV HL  +       L++ GRSD  +     L 
Sbjct: 134 HRPDKTHRFTDWSRRPLTKEQAHYAEADVTHLRDVFAALDTDLKKRGRSDWVSEEMEILT 193

Query: 189 DRAELDLL---GWENVD 202
                D      WE + 
Sbjct: 194 SPKTYDFHPERAWERLK 210


>gi|332185190|ref|ZP_08386939.1| ribonuclease D [Sphingomonas sp. S17]
 gi|332014914|gb|EGI56970.1| ribonuclease D [Sphingomonas sp. S17]
          Length = 392

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 76/171 (44%), Gaps = 1/171 (0%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               D I VDTE +        LC++Q++       I   A G    P L  ++ +++  
Sbjct: 20  LSQADFITVDTEFMRESTYWPELCLIQIADTQEAAAIDPKAPGLDMTPLLDLLVNNDEVL 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH G  DI +++   G    P+F T+IA+        Q G  + +   LGI + K  +
Sbjct: 80  KVFHAGGQDIEIIYNLTGKTPHPLFDTQIAAMALG-QGEQIGYSNLVDSWLGIQVDKGAR 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DWS   L   Q+ YA  DV HL  +  +  E+L++ GR          L
Sbjct: 139 FTDWSRRPLDQRQVDYAIGDVTHLSDIFPRMLERLRKTGRGAWLDQEMERL 189


>gi|218670444|ref|ZP_03520115.1| ribonuclease III protein [Rhizobium etli GR56]
          Length = 212

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 54/188 (28%), Positives = 90/188 (47%), Gaps = 3/188 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKS 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           ++I K+ + +DWS   LSD+QL+YA +DV HL  + L    +L R GR+   +   + L 
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSWLSEEMDILE 184

Query: 189 DRAELDLL 196
            R   D+ 
Sbjct: 185 ARETYDMH 192


>gi|92117640|ref|YP_577369.1| ribonuclease D [Nitrobacter hamburgensis X14]
 gi|91800534|gb|ABE62909.1| ribonuclease D [Nitrobacter hamburgensis X14]
          Length = 396

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 81/189 (42%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE L        LC+VQ++  D    ++   A   +      ++ +E+  
Sbjct: 31  LANYPVVTVDTEFLRETTYYPLLCVVQMASPDE-AVVVDALAEGIDLKPFFDLMSNERVL 89

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G    K  +
Sbjct: 90  KVFHAARQDIEIVWHQAGIIPHPIFDTQVAAMVLGYGD-SIAYDALVERVNGHRPDKTHR 148

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L+ +QL+YA +DV HL  +       L++ GR D  +     L      D  
Sbjct: 149 FTDWSRRPLTKDQLEYAVADVTHLRDVFAALDADLKKRGRGDWVSEEMEVLTSPKTYDFH 208

Query: 197 ---GWENVD 202
               WE + 
Sbjct: 209 PERAWERLK 217


>gi|91977418|ref|YP_570077.1| ribonuclease D [Rhodopseudomonas palustris BisB5]
 gi|91683874|gb|ABE40176.1| ribonuclease D [Rhodopseudomonas palustris BisB5]
          Length = 392

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 80/189 (42%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 I VDTE L        LC+VQ++  D    ++   A   +      ++ +E   
Sbjct: 17  LASHPVITVDTEFLRETTYYPLLCVVQMASPDE-AVVVDTLAPGIDLKPFFDLMANENVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G    K  +
Sbjct: 76  KVFHAARQDIEIVWHRAGIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITGHRPDKTHR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L+DEQL YA SDV HL  +       L++  RSD  +     L      D  
Sbjct: 135 FTDWSRRPLTDEQLHYAVSDVTHLRDVFAALDADLKKRDRSDWVSEEMEILTSPKTYDFH 194

Query: 197 ---GWENVD 202
               WE + 
Sbjct: 195 PESAWERLK 203


>gi|255261512|ref|ZP_05340854.1| ribonuclease D [Thalassiobium sp. R2A62]
 gi|255103847|gb|EET46521.1| ribonuclease D [Thalassiobium sp. R2A62]
          Length = 385

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/197 (24%), Positives = 85/197 (43%), Gaps = 6/197 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRI 56
           M TI   +  + A C  A     + VDTE L       +LC++QL+    GD    ++  
Sbjct: 1   MITITTTQE-LAAFCQEAAAHPYVTVDTEFLRERTYYSKLCLIQLAYPGEGDENAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +  +L  +  D    K+FH  R D+ + F   G+   P+F T++A+     +  Q
Sbjct: 60  LEDGLSLASLYDLFRDPNVVKVFHAARQDLEIFFVDEGIIPAPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++++    + K+ + +DWS   LSD Q +YA  DV +L  +     +KL +  R
Sbjct: 119 VGYETLVRKIAKAPLDKSSRFTDWSRRPLSDAQKKYALGDVTYLREIYEFLADKLAKNNR 178

Query: 177 SDLATSCCNFLMDRAEL 193
           +         L      
Sbjct: 179 AKWVAEEMAVLNAPKTY 195


>gi|115525280|ref|YP_782191.1| ribonuclease D [Rhodopseudomonas palustris BisA53]
 gi|115519227|gb|ABJ07211.1| ribonuclease D [Rhodopseudomonas palustris BisA53]
          Length = 392

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 83/187 (44%), Gaps = 5/187 (2%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
               I VDTE L        LC+VQ++  D  V I  +A G  +      ++ DE   K+
Sbjct: 19  KQPVITVDTEFLRETTYYPLLCVVQIASADEAVVIDSLAPGI-DLKPFFELMADEHVLKV 77

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R DI ++++  G+   P+F T++A+ +             ++ + G    K  + +
Sbjct: 78  FHAARQDIEIVWHRAGILPHPIFDTQVAAMVLGYGD-SIAYDQLVERITGHRPDKTHRFT 136

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL-- 196
           DWS   L++EQ+ YA SDV HL  +       L++ GRSD  +     L      D    
Sbjct: 137 DWSRRPLTEEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEILTSPKTYDFHPE 196

Query: 197 -GWENVD 202
             WE + 
Sbjct: 197 RAWERLK 203


>gi|86749614|ref|YP_486110.1| ribonuclease D [Rhodopseudomonas palustris HaA2]
 gi|86572642|gb|ABD07199.1| ribonuclease D [Rhodopseudomonas palustris HaA2]
          Length = 382

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 I VDTE L        LC+VQ++  D    ++   A   +      ++ +E   
Sbjct: 17  LASHPVITVDTEFLRETTYYPLLCVVQMASRDE-AVVVDTLAPGIDLKPFFDLMANENVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G    K  +
Sbjct: 76  KVFHAARQDIEIVWHRAGIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITGHRPDKTHR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L+DEQL YA SDV HL  +       L++ GRSD  +     L      D  
Sbjct: 135 FTDWSRRPLTDEQLHYAVSDVTHLRDVFAALDADLKQRGRSDWVSEEMEVLTSPKTYDFH 194

Query: 197 ---GWENVD 202
               WE + 
Sbjct: 195 PESAWERLK 203


>gi|295689658|ref|YP_003593351.1| ribonuclease D [Caulobacter segnis ATCC 21756]
 gi|295431561|gb|ADG10733.1| ribonuclease D [Caulobacter segnis ATCC 21756]
          Length = 389

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 46/178 (25%), Positives = 82/178 (46%), Gaps = 3/178 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +AVDTE +       +LC++Q++       I  +A    +   L+ ++ DE+  
Sbjct: 17  LAGEPFVAVDTEFMRETTYWPKLCLIQVASPTHEAVIDPLA-DDIDLEPLLAVMRDERIL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +      +  +P+F T++A         Q      ++++L I + K+ +
Sbjct: 76  KVFHAARQDVEIFNNLKAM-PKPLFDTQVAGMAAGFGE-QIAYDALVRQMLRIELDKSSR 133

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
            +DW+   L++ QL YA +DV HL AL     E+L+  GR          + D A  D
Sbjct: 134 FTDWARRPLTEAQLTYALADVTHLAALFPILRERLETSGRLAWVEEEMTAISDPAAYD 191


>gi|296536446|ref|ZP_06898543.1| ribonuclease D [Roseomonas cervicalis ATCC 49957]
 gi|296263225|gb|EFH09753.1| ribonuclease D [Roseomonas cervicalis ATCC 49957]
          Length = 394

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 59/177 (33%), Positives = 82/177 (46%), Gaps = 2/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            R    + VDTE +        LC+VQL+  +    I   A G   AP L  +L D K  
Sbjct: 28  LRTEPFVTVDTEFMRERTYWPELCVVQLAGAEDVAVIDAQAEGLDLAP-LGELLADPKVT 86

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +    FG   RP+F T+IA+     + +Q      ++ L G  I KA +
Sbjct: 87  KVFHAARQDVEICILRFGAPPRPLFDTQIAAM-VAGFGDQASYDSLVRALAGAQIDKAHR 145

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            SDW+A  LS  Q+ YAA+DV HL  +     E+L + GR          L D A  
Sbjct: 146 FSDWAARPLSPAQINYAAADVTHLRRVYTALVERLTQEGRLSWVAEEMAELTDPATY 202


>gi|114797633|ref|YP_760953.1| ribonuclease D [Hyphomonas neptunium ATCC 15444]
 gi|114737807|gb|ABI75932.1| ribonuclease D [Hyphomonas neptunium ATCC 15444]
          Length = 388

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/197 (25%), Positives = 84/197 (42%), Gaps = 6/197 (3%)

Query: 11  IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   C A    D + VDTE          LC++Q S       I   A      P L  +
Sbjct: 15  LEDLCGALSESDFVCVDTEFHRETTYWPELCLIQASAPGVEGLIDPRAEDLDIRPFL-DL 73

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           +  +++ K+FH  R DI +     G    P+F T++A+             + ++ +L  
Sbjct: 74  IASDRQLKVFHAARQDIEIFNRLIGHPPGPIFDTQVAAMALGFGD-SISYDNLIQRVLRK 132

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           +I K+ Q +DW    LS +QL YA  DV HL    L+  ++L++ GR +        L D
Sbjct: 133 HIDKSSQFTDWMRRPLSQKQLVYALGDVTHLRDAYLKMRDELEKAGRMNWVREEMAELED 192

Query: 190 RAELD---LLGWENVDI 203
            A  D   +  W+ + +
Sbjct: 193 PATYDTDPMNAWQRLKL 209


>gi|154247067|ref|YP_001418025.1| ribonuclease D [Xanthobacter autotrophicus Py2]
 gi|154161152|gb|ABS68368.1| ribonuclease D [Xanthobacter autotrophicus Py2]
          Length = 382

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 89/189 (47%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE L       +LC+VQ++  +  V I  +A G   AP    ++ +E+  
Sbjct: 17  LARHPFVTVDTEFLRETTFWPKLCVVQVASPEEAVLIDALADGLDLAP-FYRLMANERVM 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH GR DI ++++   +   PVF T++A+ +             ++ + G  + K+ +
Sbjct: 76  KVFHAGRQDIEIIWHQARLIPHPVFDTQVAAMVLGYGD-SISYDQLVQRVTGHALDKSSR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   LS  Q+ YA +DV HL  + ++ T  L+  GR++      + L   A  +  
Sbjct: 135 FTDWSRRPLSQAQIVYAVADVTHLRDIYIKLTTDLETRGRAEWVGEEMHVLTSPATYEQH 194

Query: 197 ---GWENVD 202
               WE + 
Sbjct: 195 PDSAWERLK 203


>gi|312113633|ref|YP_004011229.1| ribonuclease D [Rhodomicrobium vannielii ATCC 17100]
 gi|311218762|gb|ADP70130.1| ribonuclease D [Rhodomicrobium vannielii ATCC 17100]
          Length = 404

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/195 (23%), Positives = 78/195 (40%), Gaps = 14/195 (7%)

Query: 10  DIPAEC-----------AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           D+P              A      + VDTE +     R +LC++Q++       +  +  
Sbjct: 24  DLPPVITSITDLKTLCDALAGQPYVTVDTEFMRQTTYRPKLCLIQMAAPGIEAVVDPLP- 82

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      ++ +    K+FH  R DI +++   GV   P+F T+IA+           
Sbjct: 83  -NLDLSPFYALMANTAVVKVFHAARQDIEIVWQEAGVIPMPLFDTQIAAMALGHGDAI-S 140

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +K+LL  N  K  Q+ DW    L  +QL+YA  DV +L  +  +  ++L++ GR  
Sbjct: 141 YGALVKKLLKKNHDKTYQAIDWCQRPLGPKQLEYALGDVTYLRDVYAKLKQRLEQTGREP 200

Query: 179 LATSCCNFLMDRAEL 193
                   L D    
Sbjct: 201 WLEEEVAVLTDPKTY 215


>gi|192291826|ref|YP_001992431.1| ribonuclease D [Rhodopseudomonas palustris TIE-1]
 gi|192285575|gb|ACF01956.1| ribonuclease D [Rhodopseudomonas palustris TIE-1]
          Length = 392

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 86/196 (43%), Gaps = 6/196 (3%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   CA       I VDTE L        LC+VQ++  +    +I   A   +      +
Sbjct: 10  LADACARLARHPVITVDTEFLRETTFYPLLCVVQMASAEE-ALVIDALADGIDLKPFFDL 68

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + +E+  K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G 
Sbjct: 69  MANEQVLKVFHAARQDIEIVWHRAGIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITGH 127

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
              K  + +DWS   L+ EQ+ YA SDV HL  +       L++ GRSD  +     L  
Sbjct: 128 RPDKTHRFTDWSRRPLTQEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTS 187

Query: 190 RAELDLL---GWENVD 202
            +  D+     WE + 
Sbjct: 188 PSTYDVHPERAWERLK 203


>gi|56697032|ref|YP_167394.1| ribonuclease D [Ruegeria pomeroyi DSS-3]
 gi|56678769|gb|AAV95435.1| ribonuclease D [Ruegeria pomeroyi DSS-3]
          Length = 385

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 84/198 (42%), Gaps = 7/198 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVD---IIRIAAGQKNAPNLVGMLVD 72
           AA     + VDTE L       +LC++QL+      D   ++   A       L  +  D
Sbjct: 16  AAASHAYVTVDTEFLRERTYYSKLCLIQLAYPGEDADSAVLVDPLAEGLELEPLYTLFRD 75

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINIS 132
               K+FH  R D+ + +   GV   P+F T++A+     +  Q G +  ++++    + 
Sbjct: 76  TSVVKVFHAARQDLEIFWVDAGVFPEPLFDTQVAAM-VCGFGEQVGYETLVRKICRQGLD 134

Query: 133 KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           K  + +DWS   LSD Q  YA +DV HL  +       L + GRS         L D A 
Sbjct: 135 KTSRFTDWSRRPLSDAQKTYALADVTHLRQIYEHLAADLAKTGRSHWVAEELRTLTDPAT 194

Query: 193 LDL---LGWENVDIFSHS 207
            D+     W  +   ++S
Sbjct: 195 YDIRPEEAWRRIKTRTNS 212


>gi|83858515|ref|ZP_00952037.1| ribonuclease D [Oceanicaulis alexandrii HTCC2633]
 gi|83853338|gb|EAP91190.1| ribonuclease D [Oceanicaulis alexandrii HTCC2633]
          Length = 384

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 6/191 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            R  + +AVDTE +       +LC++Q + GD T  +I   A   +      +L D+   
Sbjct: 17  LRQAEYVAVDTEFMRESTFWPQLCLIQ-AAGDDTEVLIDPLAEGLDLQPFYDLLTDQNVI 75

Query: 77  KIFHYGRFDIAVLFYTFG-VRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
           K+FH  R D+ + F+  G +  +P+F ++IA+             + ++ L+ +N+ K  
Sbjct: 76  KVFHACRQDLEIFFHEGGGIIPKPLFDSQIAAMAVGLGD-SISYDNLVRALVKVNLDKGS 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DWS   LSD+Q +YA +DV HL  L     EKL ++GR          L D A  ++
Sbjct: 135 RFTDWSRRPLSDKQKEYALADVTHLRDLFPILREKLAKVGREAWLAEEMKTLTDPATYEM 194

Query: 196 L---GWENVDI 203
                W+ + +
Sbjct: 195 HPEDAWKRLKL 205


>gi|90419527|ref|ZP_01227437.1| ribonuclease D [Aurantimonas manganoxydans SI85-9A1]
 gi|90336464|gb|EAS50205.1| ribonuclease D [Aurantimonas manganoxydans SI85-9A1]
          Length = 385

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 50/197 (25%), Positives = 84/197 (42%), Gaps = 4/197 (2%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           M TI      +   C+     + + VDTE +        LC++Q++  D  V +  +A G
Sbjct: 3   MHTITTTAE-LSEACSRLAAAEFVTVDTEFIRETTFWPELCLIQMASDDLAVLVDPLADG 61

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
              AP    ++ DE+  K+FH  R D+ ++     +   P+F T++A+     +      
Sbjct: 62  LDLAPFF-DLMRDERIVKVFHAARQDVEIIHKLGDIIPVPLFDTQVAAM-VCGFGESIAY 119

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +       I K  + +DW    LSD+QL YA +DV +L  +    + +L   GR+  
Sbjct: 120 DQLVARTTDGRIDKTSRFTDWRRRPLSDQQLAYALADVTYLRDVYRFLSAQLAEKGRTRW 179

Query: 180 ATSCCNFLMDRAELDLL 196
                  L D A  DL 
Sbjct: 180 VDEEMAVLTDPATYDLH 196


>gi|39936108|ref|NP_948384.1| ribonuclease D [Rhodopseudomonas palustris CGA009]
 gi|39649962|emb|CAE28486.1| ribonuclease D [Rhodopseudomonas palustris CGA009]
          Length = 392

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 86/196 (43%), Gaps = 6/196 (3%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   CA       I VDTE L        LC+VQ++  +    +I   A   +      +
Sbjct: 10  LADACARLARHPVITVDTEFLRETTFYPLLCVVQMASAEE-ALVIDALADGIDLKPFFDL 68

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + +E+  K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G 
Sbjct: 69  MANEQVLKVFHAARQDIEIVWHRAGIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITGH 127

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
              K  + +DWS   L+ EQ+ YA SDV HL  +       L++ GRSD  +     L  
Sbjct: 128 RPDKTHRFTDWSRRPLTQEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTS 187

Query: 190 RAELDLL---GWENVD 202
            +  D+     WE + 
Sbjct: 188 PSTYDVHPERAWERLK 203


>gi|254473302|ref|ZP_05086699.1| ribonuclease D [Pseudovibrio sp. JE062]
 gi|211957418|gb|EEA92621.1| ribonuclease D [Pseudovibrio sp. JE062]
          Length = 405

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 85/187 (45%), Gaps = 2/187 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  I   E    A       D + VDTE L       +LC++Q++  D    ++   A  
Sbjct: 1   MKMITTTEELAQACAKLANSDFVTVDTEFLRETTFWPKLCVIQIANPDH-AVLVDALAED 59

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +      ++ +    K+FH  R DI ++++  G    P+F +++A+     + +     
Sbjct: 60  LDLEPFFALMRNTDIVKVFHAARQDIEIIYHLGGFVPSPLFDSQVAAM-VCGFGDSVSYD 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             + ++ G  I K+ + +DWS   L+++QL YA +DV HL  + L   ++L++ GRS   
Sbjct: 119 QLVSKVTGERIDKSSRFTDWSRRPLTNKQLAYALADVTHLREVYLFLKKQLEQKGRSHWV 178

Query: 181 TSCCNFL 187
                 L
Sbjct: 179 EDEMATL 185


>gi|254562078|ref|YP_003069173.1| ribonuclease D [Methylobacterium extorquens DM4]
 gi|254269356|emb|CAX25322.1| Ribonuclease D (RNase D) [Methylobacterium extorquens DM4]
          Length = 384

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 75/168 (44%), Gaps = 1/168 (0%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
              + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+F
Sbjct: 20  QPFVTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVF 79

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H  R D+ +++   G+  +P F T++A+     Y +    +  + ++    I K+ + +D
Sbjct: 80  HSARQDLEIIWLLGGLLPQPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKARIDKSSRFTD 138

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           WS   LS+ QL YA SDV HL  +      +L    R          L
Sbjct: 139 WSRRPLSEAQLAYALSDVTHLVTIYQVLAAELLSTDRGLWLDEEMAVL 186


>gi|240139668|ref|YP_002964145.1| Ribonuclease D (RNase D) [Methylobacterium extorquens AM1]
 gi|240009642|gb|ACS40868.1| Ribonuclease D (RNase D) [Methylobacterium extorquens AM1]
          Length = 384

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 75/168 (44%), Gaps = 1/168 (0%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
              + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+F
Sbjct: 20  QPFVTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVF 79

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H  R D+ +++   G+  +P F T++A+     Y +    +  + ++    I K+ + +D
Sbjct: 80  HSARQDLEIIWLLGGLLPQPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKARIDKSSRFTD 138

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           WS   LS+ QL YA SDV HL  +      +L    R          L
Sbjct: 139 WSRRPLSEAQLAYALSDVTHLVTIYQVLAAELLSTDRGLWLDEEMAVL 186


>gi|218531091|ref|YP_002421907.1| ribonuclease D [Methylobacterium chloromethanicum CM4]
 gi|218523394|gb|ACK83979.1| ribonuclease D [Methylobacterium chloromethanicum CM4]
          Length = 384

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 75/168 (44%), Gaps = 1/168 (0%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
              + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+F
Sbjct: 20  QPFVTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVF 79

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H  R D+ +++   G+  +P F T++A+     Y +    +  + ++    I K+ + +D
Sbjct: 80  HSARQDLEIIWLLGGLLPQPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKARIDKSSRFTD 138

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           WS   LS+ QL YA SDV HL  +      +L    R          L
Sbjct: 139 WSRRPLSEAQLAYALSDVTHLVTIYQVLAAELLSTDRGLWLDEEMAVL 186


>gi|163852332|ref|YP_001640375.1| ribonuclease D [Methylobacterium extorquens PA1]
 gi|163663937|gb|ABY31304.1| ribonuclease D [Methylobacterium extorquens PA1]
          Length = 384

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 75/168 (44%), Gaps = 1/168 (0%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
              + VDTE +       +LC++Q++  DG   ++   A   +      ++ DE   K+F
Sbjct: 20  QPFVTVDTEFMRETTYYPKLCLIQMAGPDGFACLVDPLAKDLDLKPFFDLMADESTVKVF 79

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H  R D+ +++   G+  +P F T++A+     Y +    +  + ++    I K+ + +D
Sbjct: 80  HSARQDLEIIWLLGGLLPQPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKARIDKSSRFTD 138

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           WS   LS+ QL YA SDV HL  +      +L    R          L
Sbjct: 139 WSRRPLSEAQLAYALSDVTHLVTIYQVLAAELLSTDRGLWLDEEMAVL 186


>gi|162146523|ref|YP_001600982.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543478|ref|YP_002275707.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785098|emb|CAP54642.1| putative Ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531155|gb|ACI51092.1| ribonuclease D [Gluconacetobacter diazotrophicus PAl 5]
          Length = 393

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 62/185 (33%), Positives = 92/185 (49%), Gaps = 3/185 (1%)

Query: 9   GDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+       R    +++DTE +        LC+VQL+  D  V +  +A G   AP L 
Sbjct: 19  EDLTGVVERLRREPFVSIDTEFVRERTYWPELCLVQLAGQDEVVVVDTLAPGIDLAP-LG 77

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L D +  K+FH  R D+ +  Y FG     +F T++A+     + +Q G  + +  L 
Sbjct: 78  VLLDDPEVVKVFHAARQDLEIFLYLFGHLPAALFDTQVAAM-VAGFGDQVGYDNLVASLT 136

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G +I KA + SDWSA  LS+ Q+ YAA+DV HL  +     E+L+R GR D   S    L
Sbjct: 137 GAHIDKAHRFSDWSARPLSEAQIAYAAADVTHLRTVYQLLLERLEREGRLDWVASDLAVL 196

Query: 188 MDRAE 192
            D A 
Sbjct: 197 SDPAT 201


>gi|316933724|ref|YP_004108706.1| ribonuclease D [Rhodopseudomonas palustris DX-1]
 gi|315601438|gb|ADU43973.1| ribonuclease D [Rhodopseudomonas palustris DX-1]
          Length = 387

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 86/196 (43%), Gaps = 6/196 (3%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   CA       I VDTE L        LC+VQ++  +    +I   A   +      +
Sbjct: 10  LADACARLARHPVITVDTEFLRETTFYPLLCVVQMASAED-ALVIDALADGIDLKPFFDL 68

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + +E+  K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G 
Sbjct: 69  MANEQVLKVFHAARQDIEIVWHRAGIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITGH 127

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
              K  + +DWS   L+ EQ+ YA SDV HL  +       L++ GRSD  +     L  
Sbjct: 128 RPDKTHRFTDWSRRPLTQEQVHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTS 187

Query: 190 RAELDLL---GWENVD 202
            +  D+     WE + 
Sbjct: 188 PSTYDVHPERAWERLK 203


>gi|126735792|ref|ZP_01751537.1| ribonuclease D [Roseobacter sp. CCS2]
 gi|126714979|gb|EBA11845.1| ribonuclease D [Roseobacter sp. CCS2]
          Length = 385

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 56/209 (26%), Positives = 92/209 (44%), Gaps = 9/209 (4%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDG---TVDIIRI 56
           M TI   E D+ A C  A     + VDTE L       +LC+VQL+  D       ++  
Sbjct: 1   MKTITTTE-DLAAFCQEAAKRAYVTVDTEFLRERTYYSKLCLVQLAYQDDSGADAVLLDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +  D    K+FH  R D+ + +   GV   P+F T++A+     +  Q
Sbjct: 60  LVDGLSLEPLYDLFKDHGVVKVFHAARQDLEIFYVDAGVIPEPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++++   ++ K+ + +DWS   L+D Q +YA +DV HL  +    + +L + GR
Sbjct: 119 VGYETLVRKITKSDLDKSSRFTDWSRRPLTDAQAKYALADVTHLRDIYEHLSARLAKSGR 178

Query: 177 SDLATSCCNFLMDRAELDL---LGWENVD 202
           S         L D A         W+ V 
Sbjct: 179 SKWVAEEMAVLEDPATYQADPDNAWKRVK 207


>gi|58039094|ref|YP_191058.1| ribonuclease D [Gluconobacter oxydans 621H]
 gi|58001508|gb|AAW60402.1| Ribonuclease D [Gluconobacter oxydans 621H]
          Length = 396

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 52/171 (30%), Positives = 79/171 (46%), Gaps = 2/171 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    + +DTE +        LC+VQL+  +  V I  +A G   AP L  +L      
Sbjct: 27  LQNEPFVTIDTEFVRERTYWPELCLVQLAGTEDVVLIDTLAPGIDLAP-LGALLAKPDCT 85

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +  + F      VF T++A+     + +Q G    +  + G +I KA +
Sbjct: 86  KVFHAARQDLEIFLHIFDRLPASVFDTQVAAM-VAGFGDQVGYDSLVGAITGRSIDKAHR 144

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            SDWSA  LS  Q+ YAA+DV HL  +     ++L    R   A S    L
Sbjct: 145 FSDWSARPLSKAQIAYAATDVTHLRTVYDALRKQLAEQDRLHWADSEQAIL 195


>gi|90423836|ref|YP_532206.1| ribonuclease D [Rhodopseudomonas palustris BisB18]
 gi|90105850|gb|ABD87887.1| ribonuclease D [Rhodopseudomonas palustris BisB18]
          Length = 384

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                AI VDTE L        LC+VQ++  +    ++   A   +      ++ ++   
Sbjct: 17  LAKHPAITVDTEFLRETTYYPLLCVVQMASAED-AVVVDTLAPGIDLKPFFDLMANDDVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   P+F T++A+ +             ++ + G    K  +
Sbjct: 76  KVFHAARQDIEIVWHRAGIVPHPIFDTQVAAMVLGYGD-SIAYDQLVERITGHRPDKTHR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DW+   L+DEQL YA SDV HL  +       L++ GRSD  +     L      D  
Sbjct: 135 FTDWARRPLTDEQLHYAVSDVTHLRDVFAALDADLKKRGRSDWVSEEMEVLTSPKTYDFH 194

Query: 197 ---GWENVD 202
               WE + 
Sbjct: 195 PERAWERLK 203


>gi|220924978|ref|YP_002500280.1| ribonuclease D [Methylobacterium nodulans ORS 2060]
 gi|219949585|gb|ACL59977.1| ribonuclease D [Methylobacterium nodulans ORS 2060]
          Length = 389

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 83/186 (44%), Gaps = 6/186 (3%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
              + VDTE +       +LC++Q++  DG+  ++   A   +      ++ DE+  K+F
Sbjct: 20  QPFVTVDTEFMRETTYYPKLCLIQIAAPDGSTALVDPLAPAIDLTPFFALMGDERVLKVF 79

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H  R D+ +++   G+  +P F T++A+     Y +    +  + ++    I K+ + +D
Sbjct: 80  HSARQDLEIIWLQGGLLPQPFFDTQVAAM-VCGYGDSVSYEQLVNDVAKAKIDKSSRFTD 138

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD----RAELDL 195
           WS   LS+ QL YA SDV HL  +      +L    R          L      RA+ D 
Sbjct: 139 WSRRPLSEAQLSYALSDVTHLIKVYEALARQLLATDRGAWLDEEMAVLTSPETYRADPDQ 198

Query: 196 LGWENV 201
             W  +
Sbjct: 199 A-WRRL 203


>gi|124023956|ref|YP_001018263.1| ribonuclease D [Prochlorococcus marinus str. MIT 9303]
 gi|123964242|gb|ABM78998.1| putative ribonuclease D [Prochlorococcus marinus str. MIT 9303]
          Length = 212

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 80/173 (46%), Positives = 111/173 (64%), Gaps = 3/173 (1%)

Query: 6   VHEGDIPAECAARY--VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA 63
           V +GD+ ++ A RY    AIAVDTE +GL+  RDRLC+VQ+      V  +RI  GQ +A
Sbjct: 13  VFDGDLDSDWANRYLRASAIAVDTEAMGLIHGRDRLCLVQICDPADNVACVRIGLGQTSA 72

Query: 64  PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNL 123
           P L  ++     EK+FH+ RFD+A L    G+ V P+FCTK+ASRL RTY+ +HGLK+ +
Sbjct: 73  PRLQKLMEATSVEKVFHFARFDVAALASGLGISVLPIFCTKVASRLARTYSPRHGLKEVV 132

Query: 124 KELLGINISKAQQSSDWSA-DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            EL+G+ + K  QSSDW   ++LSD QL YAA+D  +L   R +    L+R G
Sbjct: 133 MELVGVELDKQAQSSDWGRVEELSDVQLAYAANDARYLLPARQRLEMMLRREG 185


>gi|329890110|ref|ZP_08268453.1| ribonuclease D [Brevundimonas diminuta ATCC 11568]
 gi|328845411|gb|EGF94975.1| ribonuclease D [Brevundimonas diminuta ATCC 11568]
          Length = 384

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 84/189 (44%), Gaps = 5/189 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 I VDTE +       +LC++Q +       II   A   +    + +L DE   
Sbjct: 17  LAKAPYITVDTEFMRETTYWPKLCLIQAAASPTDAAIIDPMAEGLDLEPFLDILRDESIL 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +      +  RP+F T++A+        Q   +  ++++L   + K  +
Sbjct: 77  KVFHAARQDVEIFNKLGAM-PRPLFDTQVAAMAAGFGD-QVSYEALVRQMLRQELDKGSR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL- 195
            +DW+   LSD QL YA  DV HL AL  +  ++LQ+ GR D   S    + D A  D  
Sbjct: 135 FTDWARRPLSDAQLTYALGDVTHLSALYPKLRDRLQKEGRLDWVMSEMGAVTDPALYDTS 194

Query: 196 --LGWENVD 202
               W+ + 
Sbjct: 195 PENAWKRLK 203


>gi|83311936|ref|YP_422200.1| ribonuclease D [Magnetospirillum magneticum AMB-1]
 gi|82946777|dbj|BAE51641.1| Ribonuclease D [Magnetospirillum magneticum AMB-1]
          Length = 397

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 88/195 (45%), Gaps = 7/195 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    + VDTE +       +LC+VQ++  D    I  +A     AP L  ++ D    
Sbjct: 17  LKSAPFVTVDTEFMREKTYWPQLCLVQVAGPDEARAIDPLAPDMDLAP-LFELMADTNVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +  +       P+F T+IA+     + +  G +    +L    I K+ +
Sbjct: 76  KVFHAARQDVEIFLHLADAIPTPIFDTQIAAM-VCGFGDSVGYETLASQLAKARIDKSMR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD----RAE 192
            +DWS   LS++Q+QYA +DV HL     +   K+++ GR +  +     L +    R +
Sbjct: 135 FTDWSIRPLSEKQIQYALADVTHLRVAYEKLVRKVEKNGRIEWLSEEMALLTEPGTYRVD 194

Query: 193 LDLLGWENVDIFSHS 207
            +   W  +   S S
Sbjct: 195 PE-NAWRRLKPRSTS 208


>gi|302383325|ref|YP_003819148.1| ribonuclease D [Brevundimonas subvibrioides ATCC 15264]
 gi|302193953|gb|ADL01525.1| ribonuclease D [Brevundimonas subvibrioides ATCC 15264]
          Length = 382

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/172 (30%), Positives = 77/172 (44%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
                  IAVDTE +       +LC++Q +       I   A G    P L  +  D   
Sbjct: 16  DVASAPFIAVDTEFMRETTYWPKLCLIQAATPTHEAIIDPQADGLDLTPFLDILR-DPAI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R D  +      +  +P+F T++A+        Q      ++++L I++ K  
Sbjct: 75  VKVFHAARQDTEIFVKLGAM-PKPMFDTQVAAMAAGFGD-QVAYDGLVRQMLKIDLDKGS 132

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           + +DWS   LSD QL YA  DV HL AL  +  ++L R GR D  TS    L
Sbjct: 133 RFTDWSRRPLSDAQLTYAIGDVTHLAALYPKLRDRLAREGRLDWVTSEMEDL 184


>gi|209964842|ref|YP_002297757.1| ribonuclease D, putative [Rhodospirillum centenum SW]
 gi|209958308|gb|ACI98944.1| ribonuclease D, putative [Rhodospirillum centenum SW]
          Length = 385

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/194 (27%), Positives = 85/194 (43%), Gaps = 4/194 (2%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           M  I     D+ A     +  + + VDTE +       +LC+VQ++  D    I  +A G
Sbjct: 1   MMLITTT-ADLAAFVTRLKGAEYVTVDTEFMREKTYWPQLCLVQVAGPDEAAAIDPLAEG 59

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
               P L  +L D    K+FH  R D+ +  +  G    P+F T+IA+     + +  G 
Sbjct: 60  MDLTP-LFELLHDPGVLKVFHAARQDVEIFVHLTGAVPAPLFDTQIAAM-VCGFGDSVGY 117

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           +  + +L    I K+ + +DWS   L++ QL YA SDV HL     +   +L + GR   
Sbjct: 118 ETLITKLTSARIDKSSRFTDWSQRPLTERQLSYALSDVTHLRPAYEKLRRRLAKTGREHW 177

Query: 180 ATSCCNFLMDRAEL 193
                  L D A  
Sbjct: 178 LDEENVILADPATY 191


>gi|323137715|ref|ZP_08072791.1| ribonuclease D [Methylocystis sp. ATCC 49242]
 gi|322397012|gb|EFX99537.1| ribonuclease D [Methylocystis sp. ATCC 49242]
          Length = 393

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 83/187 (44%), Gaps = 5/187 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
                + VDTE L       ++C++Q++  +  V I  ++ G    P    ++ +    K
Sbjct: 18  SRHPFVTVDTEFLRETTFWPKVCVIQIASPEEAVAIDALSEGIDLTPFF-SLMANADVVK 76

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           +FH  R D+ +++    +   P+F T++A+     +  Q    + +K +   N+ K+ + 
Sbjct: 77  VFHAARQDLEIIWRLARLIPAPLFDTQVAAM-VCGFGEQASYLELVKAITRANLDKSSRF 135

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL-- 195
           +DWS   LS  Q+ YA +DV HL  +     ++L+R  R +        L   A  +   
Sbjct: 136 TDWSRRPLSAAQIDYAIADVTHLRDIYTTLRQRLERSNRLEWLADEMQTLTSPATYEQHP 195

Query: 196 -LGWENV 201
              WE +
Sbjct: 196 ENAWERL 202


>gi|121601718|ref|YP_989156.1| ribonuclease D [Bartonella bacilliformis KC583]
 gi|120613895|gb|ABM44496.1| ribonuclease D [Bartonella bacilliformis KC583]
          Length = 391

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/197 (23%), Positives = 87/197 (44%), Gaps = 6/197 (3%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+    A  R  D + VDTE +       +LC++QL+  + T  I  +     +      
Sbjct: 9   DLEIAIATLRNSDFVTVDTEFIRETTFWPQLCLIQLASPNSTALIDPMVPDI-DLQPFFD 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +++D+   K+FH  R DI ++++   +   P+F T+IA      + +       +    G
Sbjct: 68  LMIDKNIVKVFHAARQDIEIIYHLGRIIPFPLFDTQIA-GAICGFGDSISYDQIVYHCTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            ++ K+ + +DWS   LS++Q+ YA +DV +L  + L   ++L+   R          L 
Sbjct: 127 QHLDKSSRFTDWSCRPLSEKQILYALADVTYLRDVYLSLKKQLEESKRFHWMDGEMAILS 186

Query: 189 DRAELDL---LGWENVD 202
                D+     W+ V 
Sbjct: 187 TPTTYDIPEDEAWKKVK 203


>gi|114569802|ref|YP_756482.1| ribonuclease D [Maricaulis maris MCS10]
 gi|114340264|gb|ABI65544.1| ribonuclease D [Maricaulis maris MCS10]
          Length = 386

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/209 (26%), Positives = 93/209 (44%), Gaps = 9/209 (4%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           MT I   E  + A C        +AVDTE +       +LC++Q + G+  V I  +A G
Sbjct: 1   MTMITTTEA-LEAACDALLQHPYVAVDTEFMRETVYWPQLCLIQAAAGETEVIIDPLAEG 59

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGV--RVRPVFCTKIASRLTRTYTNQH 117
             +      ++ DE+  K+FH  R D+ + F+  G      P+F +++A+       +  
Sbjct: 60  I-DLEPFWELMADERIIKVFHAARQDLEIFFHQGGDALIPHPMFDSQVAAMALG-LGDSI 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
                ++ LL   I K  + +DWS   LSD Q +YA +DV HL  L     E+L++ GR+
Sbjct: 118 AYDALVRTLLNRPIDKGPRFTDWSRRPLSDAQTKYAIADVTHLRDLYPMMVERLEKTGRT 177

Query: 178 DLATSCCNFLMDRAELDL---LGWENVDI 203
           +        L   +   L     W  + +
Sbjct: 178 EWLAGEMKTLTSPSTYRLDPEESWRRMKL 206


>gi|297184397|gb|ADI20513.1| ribonuclease d [uncultured alpha proteobacterium EB080_L58F04]
          Length = 387

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/190 (26%), Positives = 87/190 (45%), Gaps = 4/190 (2%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRIA 57
           M TI   +  I    AA+  D + +DTE L       +LC++QL+    GD    ++   
Sbjct: 1   MKTITKTDELIAFCEAAKAFDYVTIDTEFLRERTYYSKLCLIQLAVPGKGDDHAVLVDPL 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
           A       L  +  DE   K+FH  R D+ +     GV  +P+F T++A+     +  Q 
Sbjct: 61  AHGLKLDALYALFEDETVVKVFHAARQDLEIFCVDAGVLPKPLFDTQVAAM-VCGFGEQV 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G +  ++++   +I K+ + +DWS   L++ Q  YA +DV HL  +      K+++ GR 
Sbjct: 120 GYETLVRKITKNSIDKSSRFTDWSRRPLTEAQKSYALADVTHLRQVYEFLRAKIEKTGRG 179

Query: 178 DLATSCCNFL 187
                    L
Sbjct: 180 PWVEEELQIL 189


>gi|254448397|ref|ZP_05061858.1| ribonuclease D [gamma proteobacterium HTCC5015]
 gi|198262010|gb|EDY86294.1| ribonuclease D [gamma proteobacterium HTCC5015]
          Length = 384

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 53/199 (26%), Positives = 93/199 (46%), Gaps = 10/199 (5%)

Query: 1   MTTIRVHEGDIPAECA-----ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIR 55
           M+ I+  +    A            + + +DTE L       +LC++Q++  D    I  
Sbjct: 1   MSDIQYIQD--TASLKTLCQQLAGSEWLTLDTEFLREKTYYPQLCLIQIANHDLIACIDP 58

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           +A    +   L  +L DE   K+ H    D  +L+ +     +PVF T++A+     Y +
Sbjct: 59  LA--IDDLTPLYALLHDESIVKVLHAAVQDQEILYQSSQQPPKPVFDTQVAA-SLLGYGD 115

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G    ++++ G+ + K+Q  +DWS   L+++Q+ YAA DV HL  +      +L+RLG
Sbjct: 116 QMGYAKLVEKICGVQLDKSQSRTDWSRRPLNEKQIDYAADDVRHLREIYQHLKTELERLG 175

Query: 176 RSDLATSCCNFLMDRAELD 194
           RSD      + L +    D
Sbjct: 176 RSDWLQKDFDDLANPQRYD 194


>gi|229815608|ref|ZP_04445935.1| hypothetical protein COLINT_02659 [Collinsella intestinalis DSM
           13280]
 gi|229808838|gb|EEP44613.1| hypothetical protein COLINT_02659 [Collinsella intestinalis DSM
           13280]
          Length = 377

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 84/186 (45%), Gaps = 4/186 (2%)

Query: 9   GDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A C  AR   AIA+DTE L       +LC+VQ++  D  V I  +A    +   L 
Sbjct: 7   EDLTAFCNRARAFSAIAIDTEFLREKTYHAKLCLVQVATPDECVVIDPLA--IDDLGPLA 64

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ D    K+FH    D+ VL +  G    P+F T++A+        Q    + +    
Sbjct: 65  ELMTDVDTLKVFHACSQDMEVLCHALGSVPAPIFDTQVAAGFLG-ERAQCSYHNLVSTFC 123

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G+++ K +  +DWS   LS +Q++YA  DV +L         KL  LGR+         L
Sbjct: 124 GVSLPKTESLTDWSRRPLSPKQIEYALDDVRYLIDAYRVIESKLHSLGRTAWVRDEIRPL 183

Query: 188 MDRAEL 193
            D A  
Sbjct: 184 ADPAHY 189


>gi|126725300|ref|ZP_01741142.1| ribonuclease D [Rhodobacterales bacterium HTCC2150]
 gi|126704504|gb|EBA03595.1| ribonuclease D [Rhodobacterales bacterium HTCC2150]
          Length = 385

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 57/214 (26%), Positives = 97/214 (45%), Gaps = 9/214 (4%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRI 56
           M TI   E D+   C  A     + VDTE L       +LC+VQL+     D    ++  
Sbjct: 1   MRTITTTE-DLAEYCTQAAKFPYVTVDTEFLRERTYYAKLCLVQLAMPGDDDSNAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            A   +   L  +  DE   K+FH  R D+ + F   GV   P+F T++A+     + +Q
Sbjct: 60  LAKGLSLAPLYDLFRDENVVKVFHAARQDLEIFFVEEGVIPSPLFDTQVAAM-VCGFGDQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++++    + K+ + +DWS   LSD Q  YA +DV HL  +     ++L++  R
Sbjct: 119 VGYETLVRKIAREAVDKSSRFTDWSRRPLSDAQKTYALADVTHLRVVYEYLAKELEKSKR 178

Query: 177 SDLATSCCNFLMDRAELDL---LGWENVDIFSHS 207
           +   T     L + +   +     W+ V   ++S
Sbjct: 179 TKWVTEELGVLTEPSTYIVEPANAWKRVKTRTNS 212


>gi|296284765|ref|ZP_06862763.1| ribonuclease D [Citromicrobium bathyomarinum JL354]
          Length = 391

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 49/178 (27%), Positives = 76/178 (42%), Gaps = 2/178 (1%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   C      D + VDTE +        LC+VQ+        I  +A G    P L  +
Sbjct: 13  LADLCDRLGKGDFVCVDTEFMRENTYWPELCLVQIGDEHEAAAIDPLADGIDLKPLLDLL 72

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
             +E   KIFH G  D+ + +   G    P+F T+IA       + Q G  + ++  L  
Sbjct: 73  TENEDVLKIFHAGSQDVEIFYNLTGKTPHPIFDTQIAMMAIS-QSEQIGYANLVEHWLDK 131

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            I K  + +DWS   L+D QL+YA  DV +L  +  +  +KL +  R     +    L
Sbjct: 132 TIDKGARFTDWSRRPLTDRQLEYAIGDVTYLAKIFPRILKKLMKTDRGMWLNAEMEKL 189


>gi|254512186|ref|ZP_05124253.1| ribonuclease D [Rhodobacteraceae bacterium KLH11]
 gi|221535897|gb|EEE38885.1| ribonuclease D [Rhodobacteraceae bacterium KLH11]
          Length = 385

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/198 (25%), Positives = 88/198 (44%), Gaps = 9/198 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A     + VDTE L       +LC+VQL+    GD +  ++   A   +   L  +  +E
Sbjct: 17  AAQYPYVTVDTEFLRERTYYSKLCLVQLAVPAEGDDSAVLVDPLAEGMSLDPLYELFRNE 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + +   GV   P+F T++A+     +  Q G +  ++++    + K
Sbjct: 77  SVVKVFHAARQDLEIFWVDAGVFPTPLFDTQVAAM-VCGFGEQVGYETLVRKICKEGVDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE- 192
             + +DWS   L++ Q  YA +DV HL  +      +L++  R          L  RAE 
Sbjct: 136 TSRFTDWSRRPLTEAQKSYALADVTHLRKIYEYLAGELKKTKRDHWVAEELRIL-TRAET 194

Query: 193 LDL---LGWENVDIFSHS 207
            D+     W  V   ++S
Sbjct: 195 YDIRPEEAWRRVKTRTNS 212


>gi|319404161|emb|CBI77754.1| Ribonuclease D [Bartonella rochalimae ATCC BAA-1498]
          Length = 383

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/197 (25%), Positives = 94/197 (47%), Gaps = 6/197 (3%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+    A  R  + + VDTE +       +LC++Q++  D T+ I  +A    N      
Sbjct: 9   DLEISIAALRKSNFVTVDTEFIRKTTFWPQLCLIQVASPDITILIDPMAQDI-NLQPFFD 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +++D+K  K+FH  R DI ++++  G+   P+F T++A      + +       ++   G
Sbjct: 68  LMIDKKVVKVFHAARQDIEIIYHLGGIIPSPLFDTQVA-GSICGFGDSISYDQIVQRCTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            ++ K+ + +DWS   LS++QL YA SDV +L  + L   ++L+   R+         L+
Sbjct: 127 HHLDKSSRFTDWSCRPLSEKQLLYAVSDVTYLRDVYLALKKQLEEKKRTHWMHDEMALLL 186

Query: 189 DRAELDL---LGWENVD 202
                D+     W+ V 
Sbjct: 187 TPTTYDIPENEAWKKVK 203


>gi|319405613|emb|CBI79236.1| Ribonuclease D [Bartonella sp. AR 15-3]
          Length = 383

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 91/187 (48%), Gaps = 3/187 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+    A  R  + + VDTE +       +LC++Q++  D T+ I  +A    N      
Sbjct: 9   DLEIAIAALRKSNFVTVDTEFIRETTFWPQLCLIQVASSDVTILIDPMAQDI-NLQPFFD 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +++D+K  K+FH  R DI ++++  GV   P+F T++A      + +       ++   G
Sbjct: 68  LMIDKKIVKVFHAARQDIEIIYHLGGVIPSPLFDTQVA-GSICGFGDSISYDQIVQRCTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            ++ K+ + +DWS   LS++QL YA +DV +L  + L   ++L+   R+         L+
Sbjct: 127 HHLDKSSRFTDWSCRPLSEKQLLYALADVTYLREVYLVLKKQLEEKKRTHWMNDEMAILL 186

Query: 189 DRAELDL 195
                D+
Sbjct: 187 TPTTYDI 193


>gi|257791482|ref|YP_003182088.1| ribonuclease D [Eggerthella lenta DSM 2243]
 gi|317490632|ref|ZP_07949102.1| ribonuclease D [Eggerthella sp. 1_3_56FAA]
 gi|325831419|ref|ZP_08164673.1| ribonuclease D [Eggerthella sp. HGA1]
 gi|257475379|gb|ACV55699.1| ribonuclease D [Eggerthella lenta DSM 2243]
 gi|316910256|gb|EFV31895.1| ribonuclease D [Eggerthella sp. 1_3_56FAA]
 gi|325486673|gb|EGC89121.1| ribonuclease D [Eggerthella sp. HGA1]
          Length = 381

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 85/186 (45%), Gaps = 6/186 (3%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
              +A+DTE L       +LC++QL+  D T  +   A    +   L  +L +E   K+F
Sbjct: 19  SSVLAIDTEFLREKTYYAKLCLIQLATDDETAIVDPFAV--DDLKVLAPVLRNENVMKLF 76

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H G  D+ +L    GV   P+F T++A+     +T Q G    +    G+ + K    +D
Sbjct: 77  HAGNQDLEILLREVGVLPHPLFDTQVAA-ALLGHTQQIGYAALVHAECGVTLKKIDSFTD 135

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL---DLL 196
           WS   LSD QL+YAA DVV+L  +  +   +L  LGR          L D A     +  
Sbjct: 136 WSRRPLSDSQLEYAADDVVYLPRMYERMRAQLVELGRLSWLDRDFEDLADPARYAANERE 195

Query: 197 GWENVD 202
            ++ + 
Sbjct: 196 RYKRLK 201


>gi|86138715|ref|ZP_01057288.1| ribonuclease D [Roseobacter sp. MED193]
 gi|85824775|gb|EAQ44977.1| ribonuclease D [Roseobacter sp. MED193]
          Length = 385

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 83/180 (46%), Gaps = 4/180 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A     + VDTE L       +LC++Q++    G+    ++   +   +   L  +  DE
Sbjct: 17  AANHPYVTVDTEFLRERTYYSKLCLIQIAFSGDGENDAVLVDPLSEGLSLEPLYALFRDE 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + +    V  +P+F T++A+     + +Q G +  +++++   + K
Sbjct: 77  SVVKVFHAARQDLEIFWVDANVFPKPLFDTQVAAM-VCGFGDQVGYETLVRKIVKEGVDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
           + + +DWS   LS+ Q  YA +DV HL  +       L+R GRS         L D A  
Sbjct: 136 SSRFTDWSRRPLSEAQQAYALADVTHLRRVYEYLAADLERSGRSHWVAEELQVLTDPATY 195


>gi|254439069|ref|ZP_05052563.1| ribonuclease D [Octadecabacter antarcticus 307]
 gi|198254515|gb|EDY78829.1| ribonuclease D [Octadecabacter antarcticus 307]
          Length = 395

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 86/192 (44%), Gaps = 7/192 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A     + VDTE L       +LC++QL+    GD    ++   A   +   L  +  DE
Sbjct: 27  AAKYPYVTVDTEFLRERTYYSKLCLIQLAYMGDGDDDAVLLDPLANGLDLAPLYDLFKDE 86

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + F   G+  +P+F T++A+     +  Q G +  ++++   N+ K
Sbjct: 87  NVVKVFHAARQDLEIFFVDQGIIPKPLFDTQVAAM-VCGFGEQAGYETLVRKIAKDNVDK 145

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
           + + +DWS   LSD Q  YA +DV HL  +    + +L + GR          L D A  
Sbjct: 146 SSRFTDWSRRPLSDAQKTYALADVTHLRVIYEYLSAELDKSGRKKWVAEEMAVLNDPATY 205

Query: 194 DL---LGWENVD 202
                  W+ V 
Sbjct: 206 QADPDNAWKRVK 217


>gi|158425285|ref|YP_001526577.1| ribonuclease D [Azorhizobium caulinodans ORS 571]
 gi|158332174|dbj|BAF89659.1| ribonuclease D [Azorhizobium caulinodans ORS 571]
          Length = 383

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 2/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               D + VDTE L       +LC++Q++  D  + I  +A G   AP    ++ +EK +
Sbjct: 17  LSRHDFVTVDTEFLRETTFWPKLCVIQVASVDEAIIIDALAEGLDLAPFF-ALMGNEKVK 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH GR DI ++++   +   PVF T++A+ +             ++ + G  I K+ +
Sbjct: 76  KVFHAGRQDIEIVWHLAEIIPHPVFDTQVAAMVLGYGD-SISYDQLVQRITGHAIDKSSR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DWS   LS  QL YA +DV HL  +  +  E L+  GR+D      N L   +  
Sbjct: 135 FTDWSRRPLSQAQLTYAVADVTHLRDVYKKLMEDLESRGRADWMGEEMNILTSPSTY 191


>gi|49475730|ref|YP_033771.1| ribonuclease D [Bartonella henselae str. Houston-1]
 gi|49238537|emb|CAF27773.1| Ribonuclease D [Bartonella henselae str. Houston-1]
          Length = 406

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/196 (26%), Positives = 93/196 (47%), Gaps = 3/196 (1%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           M  +     D+    A  R  D + +DTE +       +LC++QL+  D TV I  I+  
Sbjct: 23  MMKLITQTTDLEIALATLRNSDFVTIDTEFIRETTFWPQLCLIQLASPDTTVLIDPISQD 82

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +      ++V++K  K+FH  R DI  +++  GV   P+F T+IA      + +    
Sbjct: 83  I-DLKPFFDLMVNKKIVKVFHAARQDIETIYHLGGVIPSPLFDTQIA-GSICGFGDSISY 140

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++   G  + K+ + +DWS   LS++QL YA +DV +L  + L   ++L++  R+  
Sbjct: 141 DQIVQRCTGYQLDKSSRFTDWSFRPLSEKQLLYALADVTYLRDVYLLLKKQLEKNKRTHW 200

Query: 180 ATSCCNFLMDRAELDL 195
                  L++    D+
Sbjct: 201 MDDEIAVLLEPKTYDM 216


>gi|53803525|ref|YP_114794.1| ribonuclease D [Methylococcus capsulatus str. Bath]
 gi|53757286|gb|AAU91577.1| ribonuclease D [Methylococcus capsulatus str. Bath]
          Length = 388

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 88/184 (47%), Gaps = 8/184 (4%)

Query: 10  DIPAECAA-----RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           D PAE AA          IAVDTE +       + C++Q++ G     I  +A   ++  
Sbjct: 13  DSPAELAAFCRSIGGSPWIAVDTEFMRDKTYYPKFCLLQIANGTQAACIDPLA--IEDLR 70

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            +  +L +    K+FH  R D+ + F+ F     P+F T++A+     +  Q G    + 
Sbjct: 71  EVECLLFNRAITKVFHAARQDLEIFFHRFRAVPAPIFDTQLAA-PLVGHPEQVGYASLVS 129

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            +LG+ + K    +DWS   LS  Q +YAA+DV+HL AL  +  E+L+RLGR        
Sbjct: 130 AMLGVTVDKEHTRTDWSQRPLSAAQKEYAANDVIHLAALYPRMREQLERLGRYAWLVDEF 189

Query: 185 NFLM 188
             L 
Sbjct: 190 AALE 193


>gi|328543996|ref|YP_004304105.1| ribonuclease d protein [polymorphum gilvum SL003B-26A1]
 gi|326413740|gb|ADZ70803.1| Probable ribonuclease d protein [Polymorphum gilvum SL003B-26A1]
          Length = 394

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 88/188 (46%), Gaps = 4/188 (2%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           MT I   +  +   C+     D + VDTE L       +LC++Q++  D  V +  +A G
Sbjct: 1   MTVITTTDA-LADACSRLASHDYVTVDTEFLRETTFWPKLCVIQMAGPDDAVIVDALADG 59

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
              AP L  ++ +E+  K+FH  R DI ++++  G+   P+F T++A+     + +    
Sbjct: 60  LDLAPFL-DLMRNERVTKVFHAARQDIEIVYHLGGLIPHPLFDTQVAAM-VCGFGDSISY 117

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++ + G  I K+ + +DW+   L+ +QL YA +DV +L  +       L    RS  
Sbjct: 118 DQLVQRITGARIDKSSRFTDWARRPLTQKQLDYALADVTYLRDVYRFLKANLAEQDRSHW 177

Query: 180 ATSCCNFL 187
                  L
Sbjct: 178 VEDEMEIL 185


>gi|319898851|ref|YP_004158944.1| Ribonuclease D [Bartonella clarridgeiae 73]
 gi|319402815|emb|CBI76366.1| Ribonuclease D [Bartonella clarridgeiae 73]
          Length = 385

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 47/180 (26%), Positives = 88/180 (48%), Gaps = 2/180 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A R  + + VDTE +       +LC++Q++  D T  I  +A    N      +++D+K 
Sbjct: 16  ALRNSNFVTVDTEFIRETTFWPQLCLIQVASPDITTLIDPMAQDI-NLQPFFDLMIDKKV 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI  +++  GV   P+F T++A      + +       ++   G ++ K+ 
Sbjct: 75  VKVFHAARQDIETIYHLGGVIPSPLFDTQVA-GSICGFGDSISYDQIVQRCTGHHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DWS   LS++QL YA +DV +L  + L   ++L++  R+         L+     D+
Sbjct: 134 RFTDWSCRPLSEKQLLYALADVTYLRDVYLTLKKQLEKKKRTHWMNDEMAILLAPTTYDI 193


>gi|148552971|ref|YP_001260553.1| ribonuclease D [Sphingomonas wittichii RW1]
 gi|148498161|gb|ABQ66415.1| ribonuclease D [Sphingomonas wittichii RW1]
          Length = 395

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 80/177 (45%), Gaps = 1/177 (0%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE +        LC++Q++  +    I   A      P L  ++ +E+  
Sbjct: 24  LAASPYVVVDTEFMRESTYWPDLCLIQIANSEEAAAIDPKAKDIDLTPLLDLLVENEEVL 83

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH G  D+ ++    G    P+F T++A+        Q G  + ++ +LGI + K  +
Sbjct: 84  KVFHAGGQDLEIVHNLTGKTPYPLFDTQVAAM-AMGLGEQIGYSNLVETMLGIKLDKGAR 142

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DW+   L   Q+ YA  DV HL A+  +  E+L++ GR     +    L D A  
Sbjct: 143 FTDWARRPLDKRQIDYAIGDVTHLSAIFPRMLERLRKSGRGGWLDNEMERLGDPASY 199


>gi|83951561|ref|ZP_00960293.1| ribonuclease D [Roseovarius nubinhibens ISM]
 gi|83836567|gb|EAP75864.1| ribonuclease D [Roseovarius nubinhibens ISM]
          Length = 385

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/197 (26%), Positives = 88/197 (44%), Gaps = 6/197 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGTVDIIRI 56
           M TI   +  +   C  AR    + VDTE L       +LC+VQL+     D    ++  
Sbjct: 1   MITITTTDA-LADYCQEARKHPYVTVDTEFLRERTYYSKLCLVQLAMPGEDDAGAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            A   +   L  +  DE   K+FH  R D+ + +   G+  +P+F T++A+     +  Q
Sbjct: 60  LAEGLSLEPLYELFRDENVVKVFHAARQDLEIFYVDAGLIPQPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++ +    + K+ + +DWS   LS+ Q +YA  DV HL  +      +L++ GR
Sbjct: 119 VGYETLVRRIAKEQLDKSSRFTDWSRRPLSEAQKKYALGDVTHLRRIYEYLAAELEKSGR 178

Query: 177 SDLATSCCNFLMDRAEL 193
                     LMD A  
Sbjct: 179 DAWVKEELGTLMDPATY 195


>gi|144899165|emb|CAM76029.1| Ribonuclease D [Magnetospirillum gryphiswaldense MSR-1]
          Length = 406

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 5/194 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 I VDTE +       +LC+VQL+  D    +  +A G   AP L  ++ +    
Sbjct: 24  LSSAPYITVDTEFMREKTYYPQLCLVQLAGPDEARAVDPLAPGMDLAP-LFELMANPNVL 82

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +  +  G    P+F T++A+     + +  G +    +L    I K+Q+
Sbjct: 83  KVFHAARQDVEIFLHLSGAVPAPLFDTQVAAM-VCGFGDSVGYETLASQLAKARIDKSQR 141

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL- 195
            +DW+   L+++Q+QYA +DV HL     +   KL+R GR D        L         
Sbjct: 142 FTDWALRPLTEKQVQYALADVTHLRVAYEKLVRKLERNGRLDWLVDEMAELASPDTYRTD 201

Query: 196 --LGWENVDIFSHS 207
               W+ +   S S
Sbjct: 202 PENAWKRLKPRSSS 215


>gi|319407179|emb|CBI80818.1| Ribonuclease D [Bartonella sp. 1-1C]
          Length = 383

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/197 (24%), Positives = 93/197 (47%), Gaps = 6/197 (3%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+    A  R  + + VDTE +       +LC++Q++  D T+ I  +     N      
Sbjct: 9   DLEISIAALRKSNFVTVDTEFIRETTFWPQLCLIQVASQDITILIDPMVQDI-NLQPFFD 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +++D+K  K+FH  R DI ++++  G+   P+F T++A      + +       ++   G
Sbjct: 68  LMIDKKVVKVFHAARQDIEIIYHLGGIIPSPLFDTQVA-GSICGFGDSISYDQIVQRCTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            ++ K+ + +DWS   LS++QL YA SDV +L  + L   ++L+   R+         L+
Sbjct: 127 HHLDKSSRFTDWSCRPLSEKQLLYAVSDVTYLRDVYLALKKQLEEKKRTHWMHDEMTLLL 186

Query: 189 DRAELDL---LGWENVD 202
                D+     W+ V 
Sbjct: 187 TPTTYDIPENEAWKKVK 203


>gi|85717198|ref|ZP_01048155.1| ribonuclease D [Nitrobacter sp. Nb-311A]
 gi|85695978|gb|EAQ33879.1| ribonuclease D [Nitrobacter sp. Nb-311A]
          Length = 420

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 84/187 (44%), Gaps = 5/187 (2%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
               I VDTE L        LC++Q++  D  + I  +A G  +  +   ++ +E   K+
Sbjct: 57  KHPVITVDTEFLRETTYYPLLCVIQMASPDEAIAIDALAEGI-DLNSFFTLMSNEGVLKV 115

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R DI ++++  G+   PVF T++A+ +             ++ + G    K  + +
Sbjct: 116 FHAARQDIEIIWHQAGIIPHPVFDTQVAAMVLGYGD-SIAYDALVERVTGHRPDKTHRFT 174

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL-- 196
           DWS   L+ EQL+YA +DV HL  +       L++ GRSD  +     L      D    
Sbjct: 175 DWSRRPLTAEQLEYAVADVTHLRDVFAALDVDLRKRGRSDWVSEEMEILTSPKTYDFHPE 234

Query: 197 -GWENVD 202
             WE + 
Sbjct: 235 RAWERLK 241


>gi|149202482|ref|ZP_01879454.1| ribonuclease D [Roseovarius sp. TM1035]
 gi|149143764|gb|EDM31798.1| ribonuclease D [Roseovarius sp. TM1035]
          Length = 386

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 54/198 (27%), Positives = 87/198 (43%), Gaps = 7/198 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS----PGDGTVDIIR 55
           M TI     D+ A CA AR    + +DTE L       +LC++Q++      D  V +  
Sbjct: 1   MKTITTT-DDLAAFCAMARKHPYVTLDTEFLRERTYYSKLCLLQMAVPGADDDTAVLVDP 59

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           I   + +   L  +  D    K+FH  R D+ +     GV   P+F T++A+     +  
Sbjct: 60  IDGAEMSMEPLYELFRDTSVVKVFHAARQDLEIFHVDAGVIPDPLFDTQVAAM-VCGFGE 118

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  +K +    + K+ + +DWS   L++ Q  YA +DV HL  +     +KL   G
Sbjct: 119 QVGYETLVKRIAKQTVDKSSRFTDWSRRPLTEAQKVYALADVTHLRVIYEYLAKKLASSG 178

Query: 176 RSDLATSCCNFLMDRAEL 193
           R        + L D A  
Sbjct: 179 RDKWVAEELSVLTDPATY 196


>gi|304391965|ref|ZP_07373907.1| ribonuclease D [Ahrensia sp. R2A130]
 gi|303296194|gb|EFL90552.1| ribonuclease D [Ahrensia sp. R2A130]
          Length = 383

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 84/195 (43%), Gaps = 2/195 (1%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           M  I   +    A       D + VDTE L        LC++Q++  D    +  +A G 
Sbjct: 1   MKIIETTQELATACKDFAQHDYVTVDTEFLRETTFWPILCLIQIAGPDDECIVDPMADGI 60

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +      ++ D    K+FH  R D+ ++++  G+  +P+F T++A+     Y +     
Sbjct: 61  -DLQPFFELMADTSVVKVFHAARQDVEIVYHLGGLVPKPLFDTQVAAM-VCGYGDSVAYN 118

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             +  + G  I K+ + +DW+   L+ +QL YA +DV HL  +       L++  R    
Sbjct: 119 ALVSRITGGVIDKSSRFTDWARRPLTTKQLDYALADVTHLRDVYQSLKADLEKKNRKHWV 178

Query: 181 TSCCNFLMDRAELDL 195
               + L +    DL
Sbjct: 179 DEEMDVLTNPETYDL 193


>gi|240850739|ref|YP_002972139.1| ribonuclease D [Bartonella grahamii as4aup]
 gi|240267862|gb|ACS51450.1| ribonuclease D [Bartonella grahamii as4aup]
          Length = 384

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 55/206 (26%), Positives = 97/206 (47%), Gaps = 6/206 (2%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           M  +     D+     A R  D + VDTE +       +LC++QL+  D TV I  IA  
Sbjct: 1   MMNLITQTTDLEIALNALRTSDFVTVDTEFIRETTFWPQLCLIQLASPDVTVLIDPIAPD 60

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +      +++D+K  K+FH  R DI  +++  GV   P+F T+IA      + +    
Sbjct: 61  I-DLQPFFDLMIDKKVVKVFHAARQDIETIYHLGGVIPSPLFDTQIA-GSICGFGDSISY 118

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++   G ++ K+ + +DWS   LS++QL YA +DV +L  + L   ++L++  R+  
Sbjct: 119 DQIVQRCTGHHLDKSSRFTDWSCRPLSEKQLLYALADVTYLRDVYLLLKKRLEKNQRAHW 178

Query: 180 ATSCCNFLMDRAELDL---LGWENVD 202
                  L++    D+     W+ V 
Sbjct: 179 MDDELTILLNPKTYDMPEDEAWKKVK 204


>gi|254454077|ref|ZP_05067514.1| ribonuclease D [Octadecabacter antarcticus 238]
 gi|198268483|gb|EDY92753.1| ribonuclease D [Octadecabacter antarcticus 238]
          Length = 395

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 7/192 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A     + VDTE L       +LC++QL+    G     ++   A   +   L  +  DE
Sbjct: 27  AAKYPYVTVDTEFLRERTYYSKLCLIQLAYMGEGGDDAVLVDPLAEGLDLAPLYELFKDE 86

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + F   G+  +P+F T++A+     +  Q G +  ++++   N+ K
Sbjct: 87  NVVKVFHAARQDLEIFFVDQGIIPKPLFDTQVAAM-VCGFGEQAGYETLVRKIAKDNVDK 145

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
           + + +DWS   L+D Q  YA +DV HL  +    + +L++ GR          L D A  
Sbjct: 146 SSRFTDWSRRPLTDAQKTYALADVTHLRVIYENLSAELEKSGRKKWVAEEMAVLNDPATY 205

Query: 194 DL---LGWENVD 202
                  W+ V 
Sbjct: 206 QADPDNAWKRVK 217


>gi|210632651|ref|ZP_03297493.1| hypothetical protein COLSTE_01396 [Collinsella stercoris DSM 13279]
 gi|210159428|gb|EEA90399.1| hypothetical protein COLSTE_01396 [Collinsella stercoris DSM 13279]
          Length = 377

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 85/186 (45%), Gaps = 4/186 (2%)

Query: 9   GDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            D+ A C  AR   AIA+DTE L       +LC+VQ++  D  V I  +     +   L 
Sbjct: 7   DDLSAFCGRARCHVAIAIDTEFLRERTYHAKLCLVQVATPDECVVIDPLT--IDDLSPLA 64

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++ D    K+FH    D+ VL +T GV   P+F T++A+        Q    + +    
Sbjct: 65  ELMADVDTLKVFHACSQDMEVLVHTLGVCPAPIFDTQVAAGFLGERA-QCSYHNLVHSFC 123

Query: 128 GINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           G+++ K +  +DWS   LS +Q++YA  DV +L         KL  LGR+         L
Sbjct: 124 GVSLPKTESLTDWSRRPLSPQQIEYAVDDVRYLIDAYRVIESKLHSLGRTAWVRDEIRPL 183

Query: 188 MDRAEL 193
            D A  
Sbjct: 184 ADPAHY 189


>gi|319408646|emb|CBI82301.1| Ribonuclease D [Bartonella schoenbuchensis R1]
          Length = 383

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 88/180 (48%), Gaps = 2/180 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A    D + VDTE +       +LC++QL+  + T+ I  +     +  +   ++VDEK 
Sbjct: 16  ALSNSDFVTVDTEFIRETTFWPQLCLIQLASPNVTMLIDPMVPDI-DLQSFFDLMVDEKI 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R DI  +++  G+   P+F T+IA      + +       ++   G ++ K+ 
Sbjct: 75  VKVFHAARQDIETIYHLGGIIPYPLFDTQIA-GSICGFGDSISYDQIVQRCTGHHLDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DWS   LS++QL YA +DV +L  + L   +KL++  R+         L+     D+
Sbjct: 134 RFTDWSHRPLSEKQLLYALADVTYLRDVYLSLKKKLEKNKRTHWMDDELEILLTPTTYDI 193


>gi|182678372|ref|YP_001832518.1| ribonuclease D [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634255|gb|ACB95029.1| ribonuclease D [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 388

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 83/180 (46%), Gaps = 2/180 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE L       +LC+VQL+  +  V +  +A G  +   L  ++ +E   
Sbjct: 17  LARQPFVTVDTEFLRETTFWPKLCVVQLASTEEAVAVDALAEG-LDLSPLFELMANEATV 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ +++    +   P+F T++A+     + +Q    D ++ +  +++ K+ +
Sbjct: 76  KVFHAARQDLEIIWNLAKLIPTPLFDTQVAAM-VCGFGDQISYGDLVQTVTRVSLDKSSR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   LS  Q+ YA +DV +L  + L    KL+   R    +     L   +  +  
Sbjct: 135 FTDWSRRPLSPAQVDYAIADVTYLRDIYLYLRRKLETSSRLAWLSDEMALLSSPSTYEQA 194


>gi|27379246|ref|NP_770775.1| ribonuclease D [Bradyrhizobium japonicum USDA 110]
 gi|27352397|dbj|BAC49400.1| ribonuclease D [Bradyrhizobium japonicum USDA 110]
          Length = 382

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 49/197 (24%), Positives = 84/197 (42%), Gaps = 6/197 (3%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C+       I VDTE L        LC+VQ++  +    +I   A   +      
Sbjct: 9   DLAAACSRLAKHPVITVDTEFLRETTYYPLLCVVQMASPEE-AIVIDTLAVGIDLKPFFE 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ +E   K+FH  R DI ++++   +   PVF T++A+ +             ++++ G
Sbjct: 68  LMGNEAVLKVFHAARQDIEIIWHQANIIPHPVFDTQVAAMVLGYGD-SIAYDQLVEKVTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
               K  + +DWS   L+ EQ+ YA SDV HL  +       L++  RS+  +     L 
Sbjct: 127 HRPDKTHRFTDWSRRPLTKEQMHYAVSDVTHLRDVFAALDADLKKRRRSEWVSIEMEVLT 186

Query: 189 DRAELDLL---GWENVD 202
                D      WE + 
Sbjct: 187 SPRTYDFHPERAWERLK 203


>gi|329114834|ref|ZP_08243590.1| Ribonuclease D [Acetobacter pomorum DM001]
 gi|326695731|gb|EGE47416.1| Ribonuclease D [Acetobacter pomorum DM001]
          Length = 406

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 51/174 (29%), Positives = 77/174 (44%), Gaps = 2/174 (1%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
               + VDTE +        LC+VQ+      V I  +A G    P L  +  D    K+
Sbjct: 34  NESFVTVDTEFMREQTYWPELCLVQIGATHDIVLIDALAEGIDLTP-LKNLFADTAVLKV 92

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ +  + F     P+F T++A+     + +Q G    +  L G  I K+ + +
Sbjct: 93  FHAARQDLEIFLHLFDALPTPLFDTQVAAM-VAGFGDQVGYDSLVGSLTGHMIDKSHRFT 151

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           DWS   LS  QL YAA DV  L  +  +  +KL++  R D   +    L D A 
Sbjct: 152 DWSVRPLSPAQLTYAAGDVTWLRLVYERLVKKLEQEQRLDWVAAEMAELEDPAT 205


>gi|110679520|ref|YP_682527.1| ribonuclease D [Roseobacter denitrificans OCh 114]
 gi|109455636|gb|ABG31841.1| ribonuclease D [Roseobacter denitrificans OCh 114]
          Length = 387

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 58/216 (26%), Positives = 93/216 (43%), Gaps = 13/216 (6%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGTVDIIRI 56
           M TI   +  +   C  A   D + VDTE L       +LC++QL+     D T  I+  
Sbjct: 1   MKTITTTQA-LAEFCTQAAQFDYVTVDTEFLRERTYYSKLCLIQLAMPGEDDSTGCIVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            A   +   L  +  D    K+FH  R D+ + +    V   P+F T++A+     +  Q
Sbjct: 60  LAPGLSLEPLYALFRDTSVVKVFHAARQDLEIFYVDAEVFPEPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++ +    + K  + +DWS   L+D Q++YA +DV HL  +     EKL+  GR
Sbjct: 119 VGYETLVRRIAKKPLDKTSRFTDWSRRPLTDAQMKYALADVTHLREVYEFLAEKLEETGR 178

Query: 177 SDLATSCCNFLM-----DRAELDLLGWENVDIFSHS 207
           S         L        A +D   W  V   ++S
Sbjct: 179 SRWVREELTVLTSPETYIIAPMD--AWRRVKTRTNS 212


>gi|315500006|ref|YP_004088809.1| ribonuclease d [Asticcacaulis excentricus CB 48]
 gi|315418018|gb|ADU14658.1| ribonuclease D [Asticcacaulis excentricus CB 48]
          Length = 382

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 4/178 (2%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   CA       I VDTE +       +LC++Q +  +    I  ++      P L  +
Sbjct: 10  LTDFCAKIASAPFITVDTEFMRETTYWPKLCLIQAASEEHAGIIDPLSPDLDLKPFL-DL 68

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           L D    K+FH  R D+ +      +   PVF T++A+        Q      +++++ +
Sbjct: 69  LTDPAILKVFHACRQDVEIFNNLGAM-PAPVFDTQVAAMAAGFGD-QVAYDSLVRQVIKV 126

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +I K  + +DWS   LS++QLQYA  DV HL  L  +  EKL+   R +   +    L
Sbjct: 127 DIDKGSRFTDWSRRPLSEQQLQYALGDVTHLARLYPKLVEKLKAQNRYEWVAAEMADL 184


>gi|258541225|ref|YP_003186658.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256632303|dbj|BAH98278.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01]
 gi|256635360|dbj|BAI01329.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-03]
 gi|256638415|dbj|BAI04377.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-07]
 gi|256641469|dbj|BAI07424.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-22]
 gi|256644524|dbj|BAI10472.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-26]
 gi|256647579|dbj|BAI13520.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-32]
 gi|256650632|dbj|BAI16566.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653623|dbj|BAI19550.1| ribonuclease D [Acetobacter pasteurianus IFO 3283-12]
          Length = 402

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 50/174 (28%), Positives = 77/174 (44%), Gaps = 2/174 (1%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
               + VDTE +        LC+VQ+      V +I   A   +   L  + VD    K+
Sbjct: 30  NESFVTVDTEFMREQTYWPELCLVQIG-ATNDVVLIDALADGIDLTPLKNLFVDTAVLKV 88

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH  R D+ +  + F     P+F T++A+     + +Q G    +  L G  I K+ + +
Sbjct: 89  FHAARQDLEIFLHLFDALPTPLFDTQVAAM-VAGFGDQVGYDSLVGSLTGHMIDKSHRFT 147

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
           DWS   LS  QL YAA DV  L  +  +  +KL++  R D   +    L D A 
Sbjct: 148 DWSVRPLSPAQLTYAAGDVTWLRLVYERLVKKLEQEQRLDWVAAEMAELEDPAT 201


>gi|83953718|ref|ZP_00962439.1| ribonuclease D [Sulfitobacter sp. NAS-14.1]
 gi|83841663|gb|EAP80832.1| ribonuclease D [Sulfitobacter sp. NAS-14.1]
          Length = 385

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 79/180 (43%), Gaps = 4/180 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A   D + VDTE L       +LC++QL+     D    ++   +   +   L  +  D 
Sbjct: 17  AAKHDYVTVDTEFLRERTYYSKLCLIQLAMPGTDDSNAVLVDPLSEGLSLDPLYTLFRDT 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + +   GV   P+F T++A+     +  Q G +  ++++    + K
Sbjct: 77  SVVKVFHAARQDLEIFYVDAGVFPEPLFDTQVAAM-VCGFGEQVGYETLVRKIAHQPLDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
             + +DWS   LSD Q +YA +DV HL  +      KL++ GR+         L      
Sbjct: 136 TSRFTDWSRRPLSDAQAKYALADVTHLRQIYEFLARKLEQTGRARWVQEELEILTSPDTY 195


>gi|83942499|ref|ZP_00954960.1| ribonuclease D [Sulfitobacter sp. EE-36]
 gi|83846592|gb|EAP84468.1| ribonuclease D [Sulfitobacter sp. EE-36]
          Length = 385

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 79/180 (43%), Gaps = 4/180 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A   D + VDTE L       +LC++QL+     D    ++   +   +   L  +  D 
Sbjct: 17  AAKHDYVTVDTEFLRERTYYSKLCLIQLAMPGTDDSNAVLVDPLSEGLSLDPLYTLFRDT 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + +   GV   P+F T++A+     +  Q G +  ++++    + K
Sbjct: 77  SVVKVFHAARQDLEIFYVDAGVFPEPLFDTQVAAM-VCGFGEQVGYETLVRKIAHQPLDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
             + +DWS   LSD Q +YA +DV HL  +      KL++ GR+         L      
Sbjct: 136 TSRFTDWSRRPLSDAQAKYALADVTHLRQIYEFLARKLEQTGRARWVQEELEILTSPDTY 195


>gi|49474343|ref|YP_032385.1| ribonuclease D [Bartonella quintana str. Toulouse]
 gi|49239847|emb|CAF26240.1| Ribonuclease D [Bartonella quintana str. Toulouse]
          Length = 404

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 53/187 (28%), Positives = 90/187 (48%), Gaps = 3/187 (1%)

Query: 10  DIP-AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+  A  A R  D + VDTE +       +LC++QL+  D T+ I  +A    +      
Sbjct: 30  DLEIALAALRPSDFVTVDTEFIRETTFWPQLCLIQLASPDVTMLIDPMAQD-MDLKPFFD 88

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++VDEK  K+FH  R DI ++++  GV   P+F T+IA      + +       ++   G
Sbjct: 89  LMVDEKIVKVFHAARQDIEIIYHLGGVIPYPLFDTQIA-GSICGFGDSISYDQIVQRCTG 147

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             + K+ + +DWS   LS++QL YA +DV +L  + L   ++L++  R          L 
Sbjct: 148 HQLDKSSRFTDWSCRPLSEKQLLYALADVTYLRDVYLLLKKQLEKNKRMHWMDDEITTLS 207

Query: 189 DRAELDL 195
                D+
Sbjct: 208 TPKTYDI 214


>gi|163868507|ref|YP_001609716.1| hypothetical protein Btr_1359 [Bartonella tribocorum CIP 105476]
 gi|161018163|emb|CAK01721.1| Ribonuclease D [Bartonella tribocorum CIP 105476]
          Length = 384

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 54/196 (27%), Positives = 94/196 (47%), Gaps = 3/196 (1%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           M  +     D+     A R  D + VDTE +       +LC++QL+  D TV I  IA  
Sbjct: 1   MMNLITQTTDLEIALNALRNSDFVTVDTEFIRETTFWPQLCLIQLASPDVTVLIDPIAPD 60

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +      +++D+K  K+FH  R DI  ++Y  GV   P+F T+IA      + +    
Sbjct: 61  I-DLQPFFDLMIDKKIVKVFHSARQDIETIYYLGGVIPSPLFDTQIA-GSICGFGDSISY 118

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++   G ++ K+ + +DWS   LS++QL YA +DV +L  + L   ++L++  R+  
Sbjct: 119 DQIVQHCTGHHLDKSSRFTDWSCRPLSEKQLLYALADVTYLRDVYLLLKKRLEKNQRTHW 178

Query: 180 ATSCCNFLMDRAELDL 195
                  L++    D+
Sbjct: 179 MDDEVTILLNPKTYDM 194


>gi|84517066|ref|ZP_01004422.1| ribonuclease D [Loktanella vestfoldensis SKA53]
 gi|84508961|gb|EAQ05422.1| ribonuclease D [Loktanella vestfoldensis SKA53]
          Length = 385

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 84/196 (42%), Gaps = 5/196 (2%)

Query: 2   TTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD---GTVDIIRIA 57
             I     D+ A C  A     + VDTE L       +LC+VQ++  D       ++   
Sbjct: 1   MKIISTTADLAAFCTQAAKRAYVTVDTEFLRERTYYSKLCLVQMAYRDAAGEDAVLVDPL 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
           A   +   L  +  D    K+FH  R D+ +     GV   P+F T++A+     +  Q 
Sbjct: 61  AEGISLDPLYDLFRDPGVVKVFHAARQDLEIFHVDAGVIPAPLFDTQVAAM-VCGFGEQA 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G +  ++++    + K+ + +DWS   L+D Q +YA +DV HL  +      +L + GR+
Sbjct: 120 GYETLVRKIAKAEVDKSSRFTDWSRRPLTDAQAEYALADVTHLRDVYEYLANRLAKSGRT 179

Query: 178 DLATSCCNFLMDRAEL 193
                    L D A  
Sbjct: 180 KWVAEEMAVLNDPATY 195


>gi|114704849|ref|ZP_01437757.1| probable ribonuclease d protein [Fulvimarina pelagi HTCC2506]
 gi|114539634|gb|EAU42754.1| probable ribonuclease d protein [Fulvimarina pelagi HTCC2506]
          Length = 383

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 77/181 (42%), Gaps = 2/181 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A      + VDTE +        LC++Q++  D  V +  +A G  +      ++ DE  
Sbjct: 16  ALSRSPYVTVDTEFIRETTFWPELCLIQMASDDTEVLVDPLAKG-LSLDPFFALMADESV 74

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R D+ +++    V  +P+F T+IA+     +         +  L    I K+ 
Sbjct: 75  VKVFHAARQDLEIVYKLGAVIPKPLFDTQIAAM-VCGFGESIAYDQLVARLTDGRIDKSS 133

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           + +DW    LSD+QL YA +DV HL  +      +L+   R          L D    DL
Sbjct: 134 RFTDWRHRPLSDKQLTYALADVTHLRDVYKALKAQLEETSRHSWLDEEMAILADPQTYDL 193

Query: 196 L 196
            
Sbjct: 194 H 194


>gi|260576346|ref|ZP_05844337.1| ribonuclease D [Rhodobacter sp. SW2]
 gi|259021417|gb|EEW24722.1| ribonuclease D [Rhodobacter sp. SW2]
          Length = 385

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 51/197 (25%), Positives = 86/197 (43%), Gaps = 6/197 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRI 56
           M TI     D+   C AA+    + +DTE L       +LC++Q++    T   V +  I
Sbjct: 1   MQTITTTT-DLADFCEAAKREPYVTIDTEFLRERTYWSKLCLIQMALPGKTGRAVLVDPI 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
              + +   L  +   +   K+FH  R D+ + F        P+F T++A+     Y  Q
Sbjct: 60  EGPEMSLEPLYDLFRHQATVKVFHAARQDLEIFFVEGNSFPEPLFDTQVAAM-VCGYGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K++   N+ K  + +DWS   LS+ Q  YA +DV HL  +      ++ + GR
Sbjct: 119 VGYETLVKKIAKENLDKTSRFTDWSRRPLSEAQSDYALADVTHLRVVYESLAAQIAKSGR 178

Query: 177 SDLATSCCNFLMDRAEL 193
                   + L D A  
Sbjct: 179 QKWVEEELSILTDPATY 195


>gi|85702967|ref|ZP_01034071.1| ribonuclease D [Roseovarius sp. 217]
 gi|85671895|gb|EAQ26752.1| ribonuclease D [Roseovarius sp. 217]
          Length = 386

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 57/198 (28%), Positives = 87/198 (43%), Gaps = 7/198 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPG----DGTVDIIR 55
           M TI   E D+   CA AR    + VDTE L       +LC++QL+      D  V +  
Sbjct: 1   MKTITTTE-DLAEFCAMARTHSYVTVDTEFLRERTYYSKLCLLQLAVPGKGDDSAVLVDP 59

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           I     +   L  +  D    K+FH  R D+ + +   GV   P+F T++A+     +  
Sbjct: 60  IEGEDMSMEPLYELFRDTSVVKVFHAARQDLEIFYVDAGVIPDPMFDTQVAAM-VCGFGE 118

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  +K +    + K+ + +DWS   L+D Q  YA +DV HL  +     +KL   G
Sbjct: 119 QVGYETLVKRIAKQTVDKSSRFTDWSRRPLTDAQKTYALADVTHLRVVYEFLAKKLASSG 178

Query: 176 RSDLATSCCNFLMDRAEL 193
           R        + L D A  
Sbjct: 179 RDKWVAEELSVLTDPATY 196


>gi|260426693|ref|ZP_05780672.1| ribonuclease D [Citreicella sp. SE45]
 gi|260421185|gb|EEX14436.1| ribonuclease D [Citreicella sp. SE45]
          Length = 385

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 84/190 (44%), Gaps = 4/190 (2%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRIA 57
           M TI   E       AA     + VDTE L       +LC++QL+    GD    ++   
Sbjct: 1   MKTITTTEDLAAFCQAAAKAPYVTVDTEFLRERTYYSKLCLIQLAFPGKGDENAVLVDPL 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               +   L+ +  +    K+FH  R D+ + F   GV   P+F T++A+     +  Q 
Sbjct: 61  VDGLDLEPLLELFRNTAVVKVFHAARQDLEIFFIDHGVIPDPLFDTQVAAM-VCGFGEQV 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G +  +K +    + K+ + +DWS   L++ Q +YA +DV HL  +      +L+R GR+
Sbjct: 120 GYETLVKRIAKQALDKSSRFTDWSRRPLTEAQKKYALADVTHLRVIYEYLAAELERTGRA 179

Query: 178 DLATSCCNFL 187
                    L
Sbjct: 180 RWVAEELAVL 189


>gi|224370825|ref|YP_002604989.1| Rnd [Desulfobacterium autotrophicum HRM2]
 gi|223693542|gb|ACN16825.1| Rnd [Desulfobacterium autotrophicum HRM2]
          Length = 377

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 85/200 (42%), Gaps = 8/200 (4%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M    + E D  + A C   +    +A D E   +   ++++C+VQ++  + +  +  ++
Sbjct: 1   MIEYTLIENDEDLAARCDLLKTEKRLAFDLEADSMHHFKEKVCLVQMADPNDSFVVDPLS 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               +   L  +  D    K+FH   FDI  L   F + V  +F T+IA R         
Sbjct: 61  --IDDLSVLKPVFEDPAITKVFHGSDFDIRSLDRDFDIHVNNLFDTEIACRFLGIQKRS- 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
            L   L++   + + K  Q +DWS   LS E + Y+ +DV +L  L     ++L+  GR 
Sbjct: 118 -LAALLEKHFDLTLDKRFQKTDWSRRPLSKEMIAYSVNDVAYLLELSDILKKRLEDEGRL 176

Query: 178 DLATSCCNFLMDRAELDLLG 197
             A      L  R   D  G
Sbjct: 177 AWAEEEFE-LQTRVRHDNNG 195


>gi|254502050|ref|ZP_05114201.1| ribonuclease D [Labrenzia alexandrii DFL-11]
 gi|222438121|gb|EEE44800.1| ribonuclease D [Labrenzia alexandrii DFL-11]
          Length = 392

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 8/199 (4%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D + VDTE L       +LC++Q++ G     I+   A   +      
Sbjct: 9   DLAAACQRLATNDYVTVDTEFLRETTFWPKLCVIQMA-GTEMAFIVDALAEGLDLEPFFD 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D+   K+FH  R DI ++++  G+   P+F T++A+     + +       + ++ G
Sbjct: 68  LMRDDSVTKVFHAARQDIEIIYHLGGLIPAPLFDTQVAAM-VCGFGDSISYDQLVYKVTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             I K+ + +DW+   L+ +QL YA +DV HL          L    R+         L 
Sbjct: 127 ARIDKSSRFTDWARRPLTAKQLDYALADVTHLRDAFQFLKANLAEQNRTHWVQDEMTVLT 186

Query: 189 D----RAELDLLGWENVDI 203
                RA+ D   W+ + +
Sbjct: 187 SVATYRADPDQA-WKRLKL 204


>gi|154253761|ref|YP_001414585.1| ribonuclease D [Parvibaculum lavamentivorans DS-1]
 gi|154157711|gb|ABS64928.1| ribonuclease D [Parvibaculum lavamentivorans DS-1]
          Length = 427

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/205 (23%), Positives = 86/205 (41%), Gaps = 6/205 (2%)

Query: 2   TTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
             I      + A C        + VDTE +        LC++QL+ G     I+   A  
Sbjct: 44  MEIITTNEALRAACDRLSTAGFVTVDTEFMRDATFWPILCLIQLA-GPSDELIVDPLAPD 102

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
            +      ++ +    K+FH  R DI +  +       P+F T++A+     + +  G +
Sbjct: 103 LDLAPFYALMKNRNVVKVFHAARQDIEIFCHEGKAIPDPLFDTQVAAM-VCGFGDSVGYE 161

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             +++L G ++ K+ + +DWS   LSD+QLQYA +DV +L  +     ++L    R+   
Sbjct: 162 TLVRKLAGGSVDKSSRFTDWSRRPLSDKQLQYAMADVTYLRTIYEVLAKRLTHTKRAHWV 221

Query: 181 TSCCNFLMDRAELDL---LGWENVD 202
                 L D     +     W+ V 
Sbjct: 222 AEEMAVLQDPETYAMRPENAWKRVK 246


>gi|89054329|ref|YP_509780.1| ribonuclease D [Jannaschia sp. CCS1]
 gi|88863878|gb|ABD54755.1| ribonuclease D [Jannaschia sp. CCS1]
          Length = 386

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/198 (24%), Positives = 88/198 (44%), Gaps = 9/198 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           A     + VDTE L       +LC+VQ++     D    +I   A   +   L  +  + 
Sbjct: 18  AATQPYVTVDTEFLRERTYFAQLCLVQVAMPGTDDTDAVLIDPLAEGLSLEPLYELFRNV 77

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + F   G+   P+F T++A+     + +Q G +  ++ +   N+ K
Sbjct: 78  NVVKVFHAARQDLEIFFVEGGLVPTPLFDTQVAAM-VCGFGDQVGYETLVRRIAKANLDK 136

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD---- 189
           + + +DWS   LSD Q  YA +DV +L  +    + +L R  R+         L +    
Sbjct: 137 SSRFTDWSRRPLSDAQKVYALADVTYLREIYEYLSAELARTDRTHWLEEELAQLTNADAY 196

Query: 190 RAELDLLGWENVDIFSHS 207
             + +   W+ + + S+S
Sbjct: 197 VVDPE-NAWKRLKLRSNS 213


>gi|126731278|ref|ZP_01747085.1| ribonuclease D [Sagittula stellata E-37]
 gi|126708189|gb|EBA07248.1| ribonuclease D [Sagittula stellata E-37]
          Length = 385

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 59/214 (27%), Positives = 94/214 (43%), Gaps = 9/214 (4%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRI 56
           M T+   E  +   CA A+    I VDTE L       +LC++QL+    GD    ++  
Sbjct: 1   MQTLTTTEE-LSDFCARAKGQPYITVDTEFLRERTYYSKLCLIQLALPGKGDEDAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L+ +  DE   K+FH  R D+ + F   GV  +P+F T++A+     +  Q
Sbjct: 60  MVDGLSLDPLLELFRDESIVKVFHAARQDLEIFFIDHGVIPQPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K +    + K+ + +DWS   L+D Q  YA +DV HL  +      KL+  GR
Sbjct: 119 VGYETLVKRIAKQQLDKSSRFTDWSRRPLTDAQKSYALADVTHLREIYEFLAAKLEESGR 178

Query: 177 SDLATSCCNFLMDRAEL---DLLGWENVDIFSHS 207
           S         L D           W+ V   S++
Sbjct: 179 SRWVAEELGVLTDPETYITRPREAWKRVKTRSNA 212


>gi|58698273|ref|ZP_00373191.1| ribonuclease D [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630014|ref|YP_002726805.1| Ribonuclease D [Wolbachia sp. wRi]
 gi|225677056|ref|ZP_03788062.1| Ribonuclease D [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|58535197|gb|EAL59278.1| ribonuclease D [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225590902|gb|EEH12123.1| Ribonuclease D [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225591995|gb|ACN95014.1| Ribonuclease D [Wolbachia sp. wRi]
          Length = 392

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 3/181 (1%)

Query: 9   GDIPAECAARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            DI     A+    IAVDTE +        +L ++Q+S G+ +  I+     + +   + 
Sbjct: 10  EDICEGLIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKS-FIVDALVPEIDLSFIK 68

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +++++   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  
Sbjct: 69  KIMLNQGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQ 128

Query: 128 GINISK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
           GI + K   ++SDW    LS++QL YA +DVVHL+ L      KL+   R          
Sbjct: 129 GIALDKIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNRMGWFQEEMES 188

Query: 187 L 187
           +
Sbjct: 189 I 189


>gi|254492081|ref|ZP_05105256.1| ribonuclease D [Methylophaga thiooxidans DMS010]
 gi|224462633|gb|EEF78907.1| ribonuclease D [Methylophaga thiooxydans DMS010]
          Length = 379

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 82/191 (42%), Gaps = 10/191 (5%)

Query: 2   TTIRVHEG-----DIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI 56
            TI+  +      D+  + A      +A+DTE         +LC++Q++  D    +  +
Sbjct: 1   MTIQFIDSSAGLKDLCEQLA--ESTWLAIDTEFHREKTYYPQLCLIQVANDDVIACVDPL 58

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L+ +        +FH  R D+ +LF       + VF T++A+ +      Q
Sbjct: 59  --KIDDLSPLMDVFYRTDMTLVFHAARQDLELLFLLRDALPQQVFDTQLAATVLGYGD-Q 115

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G  + +K+ L +++ KA   +DW    LS EQ+ YAA DV +L  L  Q   KL   GR
Sbjct: 116 IGYGNLVKQCLNVDLDKAHARTDWRQRPLSPEQIDYAADDVRYLRELYHQLEAKLVDTGR 175

Query: 177 SDLATSCCNFL 187
            +        L
Sbjct: 176 INWLKEDFATL 186


>gi|254486025|ref|ZP_05099230.1| ribonuclease D [Roseobacter sp. GAI101]
 gi|214042894|gb|EEB83532.1| ribonuclease D [Roseobacter sp. GAI101]
          Length = 385

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/199 (24%), Positives = 85/199 (42%), Gaps = 7/199 (3%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLV 71
             A   D + +DTE L       +LC++Q++     D    ++   AG  +   L  +  
Sbjct: 15  LEAATHDYVTIDTEFLRERTYYSKLCLIQMAMPGTDDSGAVLVDPLAGDMSLEPLYALFR 74

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           D    K+FH  R D+ + F   GV   P+F T++A+     +  Q G +  ++++    +
Sbjct: 75  DTSVVKVFHAARQDLEIFFVDAGVFPEPLFDTQVAAM-VCGFGEQVGYETLVRKIAHQAV 133

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
            K  + +DWS   L+D Q +YA +DV HL  +      KL+  GR+         L    
Sbjct: 134 DKTSRFTDWSRRPLTDAQAKYALADVTHLRQVYEFLARKLEETGRARWVAEELEILTSPD 193

Query: 192 EL---DLLGWENVDIFSHS 207
                    W+ V   ++S
Sbjct: 194 TYITQPRDAWKRVKTRTNS 212


>gi|328955332|ref|YP_004372665.1| ribonuclease D [Coriobacterium glomerans PW2]
 gi|328455656|gb|AEB06850.1| ribonuclease D [Coriobacterium glomerans PW2]
          Length = 377

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 82/187 (43%), Gaps = 5/187 (2%)

Query: 2   TTIRVHEGDIPAECAARYV-DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
             I  HE  + A C A      +A+DTE L       RLC+VQ++  + +  +  +    
Sbjct: 1   MYISTHEQ-LAALCDAARSFSIVAIDTEFLRERTYHPRLCLVQVATPEVSALVDPLE--I 57

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           ++   L  ++ DE   KIFH    D+ VL     V   P+F T++A+        Q    
Sbjct: 58  EDLSPLAALMADEGTRKIFHACSQDMEVLLNALDVLPNPIFDTQVAAAFLGERV-QMSYD 116

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             +K   G+++ K    +DWS   L+ EQ+ YA  DV +L        E+L++ GR   A
Sbjct: 117 GLVKAFCGVSLPKTASLTDWSHRPLTAEQMDYAEDDVRYLICAYEVMAERLEQRGRMSWA 176

Query: 181 TSCCNFL 187
                 L
Sbjct: 177 LDEMRPL 183


>gi|310815760|ref|YP_003963724.1| ribonuclease D [Ketogulonicigenium vulgare Y25]
 gi|308754495|gb|ADO42424.1| ribonuclease D [Ketogulonicigenium vulgare Y25]
          Length = 388

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 84/191 (43%), Gaps = 5/191 (2%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSP--GDGTVDIIRIA 57
           M TI   E  + + CA A     + VDTE L       +LC+VQL+    D    ++   
Sbjct: 1   MKTITTTEA-LASFCAEAAKHPYVTVDTEFLRERTYYAKLCLVQLAFSGPDADAALVDPL 59

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
           A   +   L  + ++    K+FH  R D+ +      V   P+F T++A+     Y  Q 
Sbjct: 60  ADGIDLKPLYDLFLNPAVVKVFHAARQDLEIFSVGQNVIPAPLFDTQVAAM-VCGYGEQV 118

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
             +   +++   +I K  + +DWS   LS+ Q +YA +DV HL  +    + ++ + GR+
Sbjct: 119 SYETLARKIAKADIDKTSRFTDWSRRPLSEAQKEYALADVTHLRQIYENLSAQIAKSGRA 178

Query: 178 DLATSCCNFLM 188
                    L 
Sbjct: 179 AWVAEEMGVLN 189


>gi|127513115|ref|YP_001094312.1| ribonuclease D [Shewanella loihica PV-4]
 gi|126638410|gb|ABO24053.1| ribonuclease D [Shewanella loihica PV-4]
          Length = 368

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 77/185 (41%), Gaps = 6/185 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
            T +  E D  +       R    + +DTE +       +L ++Q+  G+    I  +A 
Sbjct: 1   MTFQYVEDDASLTELVDKYRQAKVLMLDTEFVRTRTYYAKLGLIQVYDGETLALIDPVAV 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L  +    + H    D+ VL      + + +F ++IA+           
Sbjct: 61  --SDLSAFWALLERDDMISVLHSCSEDLEVLARYGRCQPKVLFDSQIAAAFCGWGHGMGY 118

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            K  ++  LG+ + K +  +DW    LSD QLQYAA+DV +L+ L  Q  EKLQ  GR  
Sbjct: 119 AK-LVEHCLGVQLDKGESRTDWMKRPLSDAQLQYAANDVDYLYRLYPQLLEKLQESGRMP 177

Query: 179 LATSC 183
                
Sbjct: 178 WLLEE 182


>gi|163746426|ref|ZP_02153784.1| ribonuclease D [Oceanibulbus indolifex HEL-45]
 gi|161380311|gb|EDQ04722.1| ribonuclease D [Oceanibulbus indolifex HEL-45]
          Length = 385

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 89/214 (41%), Gaps = 9/214 (4%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRI 56
           M TI     D+   C  A   D + VDTE L       +LC+VQL+     D    ++  
Sbjct: 1   MKTITTT-ADLAQFCEEAARYDYVTVDTEFLRERTYYSKLCLVQLAMPGTDDSNAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            A   +   L  +  D    K+FH  R D+ + F    V   P+F T++A+     +  Q
Sbjct: 60  LAEGISLEPLYTLFRDTSVVKVFHAARQDLEIFFVDAEVFPEPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++++    + K  + +DWS   L+D Q  YA +DV HL  +      KL+  GR
Sbjct: 119 VGYETLVRKIAHQALDKTSRFTDWSRRPLTDAQKTYALADVTHLRQIYEFLARKLEETGR 178

Query: 177 SDLATSCCNFLMDRAEL---DLLGWENVDIFSHS 207
           +         L+            W+ V   ++S
Sbjct: 179 ARWVAEELETLLSPDTYVTQPQDAWKRVKTRTNS 212


>gi|222825102|dbj|BAH22259.1| putative ribonuclease D [Wolbachia endosymbiont of Cadra cautella]
          Length = 394

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
            E   +    IA+DTE +        +L ++Q+S G+ +  I+     + +   +  M++
Sbjct: 14  KELMEKDPKFIAIDTEFIRNNLTYYPKLSLIQISYGEKS-FIVDALVPEIDLSFIKKMML 72

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           ++   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  GI +
Sbjct: 73  NQGIIKVFHSCRQDIESLLTVFKCVPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGIAL 132

Query: 132 SK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            K   ++SDW    LS++QL YA +DVV+L+ L      KL+   R          L
Sbjct: 133 DKIKAKNSDWLRRPLSEDQLDYAINDVVYLYDLYQILCNKLEESNRMSWFQEEMELL 189


>gi|332557401|ref|ZP_08411723.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
 gi|332275113|gb|EGJ20428.1| ribonuclease D [Rhodobacter sphaeroides WS8N]
          Length = 385

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 84/191 (43%), Gaps = 6/191 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRI 56
           M TI   E  + A C AA+    + +DTE L       +LC++Q++    T   V +  I
Sbjct: 1   MQTITTTEA-LAAFCEAAKAEPYVTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPI 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +   E   K+FH  R D+ + F        P+F T++A+     +  Q
Sbjct: 60  EGPDMSLEPLYDLFRHEATVKVFHAARQDLEIFFVEGRAFPVPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K++    + K  + +DWS   LSD Q  YA +DV HL  +    + ++++ GR
Sbjct: 119 VGYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGR 178

Query: 177 SDLATSCCNFL 187
                     L
Sbjct: 179 QKWVEEELAIL 189


>gi|221638369|ref|YP_002524631.1| Ribonuclease D [Rhodobacter sphaeroides KD131]
 gi|221159150|gb|ACM00130.1| Ribonuclease D [Rhodobacter sphaeroides KD131]
          Length = 385

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 84/191 (43%), Gaps = 6/191 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRI 56
           M TI   E  + A C AA+    + +DTE L       +LC++Q++    T   V +  I
Sbjct: 1   MQTITTTEA-LAAFCEAAKAEPYVTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPI 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +   E   K+FH  R D+ + F        P+F T++A+     +  Q
Sbjct: 60  EGPDMSLEPLYDLFRHEATVKVFHAARQDLEIFFVEGRAFPVPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K++    + K  + +DWS   LSD Q  YA +DV HL  +    + ++++ GR
Sbjct: 119 VGYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGR 178

Query: 177 SDLATSCCNFL 187
                     L
Sbjct: 179 QKWVEEELAIL 189


>gi|77462516|ref|YP_352020.1| ribonuclease D [Rhodobacter sphaeroides 2.4.1]
 gi|126461450|ref|YP_001042564.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17029]
 gi|77386934|gb|ABA78119.1| Ribonuclease D [Rhodobacter sphaeroides 2.4.1]
 gi|126103114|gb|ABN75792.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17029]
          Length = 385

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 84/191 (43%), Gaps = 6/191 (3%)

Query: 1   MTTIRVHEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRI 56
           M TI   E  + A C AA+    + +DTE L       +LC++Q++    T   V +  I
Sbjct: 1   MQTITTTEA-LAAFCEAAKAEPYVTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPI 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +   E   K+FH  R D+ + F        P+F T++A+     +  Q
Sbjct: 60  EGPDMSLEPLYDLFRHEATVKVFHAARQDLEIFFVEGRAFPVPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K++    + K  + +DWS   LSD Q  YA +DV HL  +    + ++++ GR
Sbjct: 119 VGYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGR 178

Query: 177 SDLATSCCNFL 187
                     L
Sbjct: 179 QKWVEEELAIL 189


>gi|118590153|ref|ZP_01547556.1| probable ribonuclease d protein [Stappia aggregata IAM 12614]
 gi|118437125|gb|EAV43763.1| probable ribonuclease d protein [Stappia aggregata IAM 12614]
          Length = 394

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 83/199 (41%), Gaps = 8/199 (4%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D + VDTE L       +LC++Q++  D    I+   +   +      
Sbjct: 9   DLAAACQRLAAHDYVTVDTEFLRETTFWPKLCVIQMAGPD-MAFIVDALSEGLDLEPFFE 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D    K+FH  R DI ++++   +   P+F T++A+     + +       + ++ G
Sbjct: 68  LMRDGSVTKVFHAARQDIEIIYHLGELIPAPLFDTQVAAM-VCGFGDSISYDQLVYKVTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             I K+ + +DW+   L+ +QL YA +DV HL          L    R          L 
Sbjct: 127 ARIDKSSRFTDWARRPLTAKQLDYALADVTHLRDAYQFLKANLAEQDRIHWVQDEMQVLT 186

Query: 189 D----RAELDLLGWENVDI 203
                R + +   W+ + +
Sbjct: 187 SVNTYRTDPEQA-WKRLKL 204


>gi|209885458|ref|YP_002289314.1| ribonuclease D [Oligotropha carboxidovorans OM5]
 gi|209873654|gb|ACI93450.1| ribonuclease D [Oligotropha carboxidovorans OM5]
          Length = 386

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/177 (25%), Positives = 76/177 (42%), Gaps = 2/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE L        LC+VQL+  D    ++   A   +      ++ +EK  
Sbjct: 17  LAQHPFVTVDTEFLRETTYYPLLCVVQLASTDE-AVVVDALAEGIDLKPFFDLMANEKVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++   +   PVF T++A+ +             +  + G  + K  +
Sbjct: 76  KVFHAARQDIEIVWHLANIVPHPVFDTQVAAMVLGYGD-SIAYDQLVGRITGHKLDKTHR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DWS   L+ EQ  YA +DV HL  + L     L++  R+D  +     L   A  
Sbjct: 135 FTDWSRRPLTQEQTTYALADVTHLRDVFLVLDADLKKRNRADWVSEEMQILTSPATY 191


>gi|221194797|ref|ZP_03567854.1| ribonuclease D [Atopobium rimae ATCC 49626]
 gi|221185701|gb|EEE18091.1| ribonuclease D [Atopobium rimae ATCC 49626]
          Length = 376

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/171 (28%), Positives = 77/171 (45%), Gaps = 3/171 (1%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEK 74
             A +V  +AVDTE L       +LC+VQ+S G+    I  ++    +   LV +  D+K
Sbjct: 14  LRAAHVPVLAVDTEFLREKTYYPKLCLVQVSTGEEIAAIDPLS--IDDLSPLVRLFEDQK 71

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+ H    D+ VL Y       PVF T++A+        Q      ++  +G+++ K 
Sbjct: 72  IVKVIHACSQDLEVLLYGMHCACAPVFDTQLAAAFLG-MRQQASYASVVEHYMGVHLPKT 130

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +  +DWS   L  EQL YA  DV +L  +     E+L +  R        N
Sbjct: 131 ESLTDWSRRPLDPEQLVYAEDDVRYLPDIYRCMYERLMKTNRLGWLMPEMN 181


>gi|269215504|ref|ZP_06159358.1| ribonuclease D [Slackia exigua ATCC 700122]
 gi|269130991|gb|EEZ62066.1| ribonuclease D [Slackia exigua ATCC 700122]
          Length = 399

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 86/180 (47%), Gaps = 5/180 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D +A+DTE L       +LC++QL   + +V +  +     +   L  ++VD    
Sbjct: 18  ARTCDVVAIDTEFLRERCYWAKLCLIQLGTDERSVVVDPL--KVHDLSPLRDLMVDTSVV 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH    D+ +LF+   V   P+F T++A+      T Q G    +    G+ + KA  
Sbjct: 76  KVFHAATQDLDILFHELDVMPDPIFDTQVAA-ALLGQTVQVGYGTLVLNECGVRLKKADS 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL--MDRAELD 194
            +DW+   LS  Q+ YA  DVV+L  +  Q TE+L+ LGR+         L    R  +D
Sbjct: 135 FTDWARRPLSSSQINYALEDVVYLPRIYRQLTERLEALGRASWLEHDFAELVDPSRYRVD 194


>gi|257063921|ref|YP_003143593.1| ribonuclease D [Slackia heliotrinireducens DSM 20476]
 gi|256791574|gb|ACV22244.1| ribonuclease D [Slackia heliotrinireducens DSM 20476]
          Length = 392

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 86/178 (48%), Gaps = 3/178 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +LC++QL+  +  V +  +     +   L  +  DE   
Sbjct: 15  ARAHKVLAIDTEFMREKTYWPKLCLIQLATPERAVAVDPLRL--HDLSALNVLFQDENIL 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R D+ ++    G    P+F T+IA+     +T Q G    +   LG+++ KA  
Sbjct: 73  KLFHASRQDLEIINIEMGCLPAPIFDTQIAA-ALLGHTTQIGYGPLVMNELGVHLKKADS 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
            +DWS   L+  QLQYA  DV++L  L    + KL++L R D   S    L D +  +
Sbjct: 132 YTDWSRRPLTKSQLQYALDDVIYLPKLYDSMSRKLKKLNRMDWLASDFRDLSDPSNYE 189


>gi|114767452|ref|ZP_01446239.1| ribonuclease D [Pelagibaca bermudensis HTCC2601]
 gi|114540462|gb|EAU43543.1| ribonuclease D [Roseovarius sp. HTCC2601]
          Length = 385

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 91/191 (47%), Gaps = 6/191 (3%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSP---GDGTVDIIRI 56
           M TI   E D+ A C+ A     + VDTE L       +LC++QL+    GD    ++  
Sbjct: 1   MKTITSTE-DLAAFCSEAATAPYVTVDTEFLRERTYYSKLCLIQLAYPGQGDENAVLVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
            AG+ +   L+ +  +    K+FH  R D+ + F   GV   P+F T++A+     +  Q
Sbjct: 60  LAGELSLEPLLELFRNTNVVKVFHAARQDLEIFFIDHGVIPDPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  +K +    + K+ + +DWS   L+D Q +YA +DV HL  +      +L+R GR
Sbjct: 119 VGYETLVKRIAKQGLDKSSRFTDWSRRPLTDAQKKYALADVTHLRVIYEYLAAELERTGR 178

Query: 177 SDLATSCCNFL 187
           +         L
Sbjct: 179 ARWVAEELGVL 189


>gi|294677027|ref|YP_003577642.1| ribonuclease D [Rhodobacter capsulatus SB 1003]
 gi|294475847|gb|ADE85235.1| ribonuclease D-2 [Rhodobacter capsulatus SB 1003]
          Length = 384

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 5/190 (2%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPG--DGTVDIIRIA 57
           M TI   +  +   C  A+    + VDTE L       +LC+VQ++    +G   ++   
Sbjct: 1   MQTITTTDA-LEQFCTRAKAAPYVTVDTEFLRERTYWSKLCLVQMALPGKEGEAVLVDPL 59

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               +   L  +   +   K+FH  R D+ + F   GV   P+F T++A+     +  Q 
Sbjct: 60  VEGLSLEPLYDLFRHQATVKVFHAARQDLEIFFTEAGVFPLPLFDTQVAAM-VCGFGEQV 118

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G +  +K++   ++ K  + +DWS   L+D Q  YA +DV HL  +    +++L++ GR 
Sbjct: 119 GYETLVKKIAKQSLDKTSRFTDWSRRPLTDAQKAYALADVTHLRVIYEFLSKELRKSGRE 178

Query: 178 DLATSCCNFL 187
                    L
Sbjct: 179 KWVEEEEAIL 188


>gi|168698136|ref|ZP_02730413.1| ribonuclease D [Gemmata obscuriglobus UQM 2246]
          Length = 435

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 79/189 (41%), Gaps = 6/189 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +  DTE +G    R  LC+VQ+S  +    I     G  +      +L+D KR 
Sbjct: 29  LAKAPLVGFDTEFVGEDAYRPELCLVQVSTAEQLFVIDPFECGSLD--GFWDLLLDRKRT 86

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
            + H GR D+ + ++  G     VF  +IA+ L        G    + +LL   + K + 
Sbjct: 87  VVVHAGREDVRMCYFQAGSAPPNVFDVQIAAGLVGLTYPI-GYAGLVHDLLRQRMQKGET 145

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD-- 194
            +DW    L+  Q++YA  DV +L     + TE+L++  R   A       + RA  D  
Sbjct: 146 LTDWRQRPLTPAQVRYAYDDVRYLLPAHRKLTERLKKYRRLPWAEEEFAAAVKRAVADDA 205

Query: 195 -LLGWENVD 202
            +  W  + 
Sbjct: 206 TIERWRKIK 214


>gi|56551610|ref|YP_162449.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761264|ref|ZP_04759352.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752797|ref|YP_003225690.1| ribonuclease D [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56543184|gb|AAV89338.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374171|gb|EER63668.1| ribonuclease D [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552160|gb|ACV75106.1| ribonuclease D [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 390

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 78/177 (44%), Gaps = 1/177 (0%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               D IA+DTE +        LC++Q++       I  +A G    P    ++ +E   
Sbjct: 20  LSRADFIAIDTEFIRENSYWPELCLIQIADDKEAAAIDPLAPGLDMTPLTDLLVNNEDIL 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH G  D+ ++ +  G    P+F T+IA+        Q G  + ++  L I + K  +
Sbjct: 80  KVFHAGGQDLEIILHHTGKMPFPLFDTQIAAMALG-VGEQVGYSNLVERYLSIKLDKGAR 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DWS   L   QL YA +DV HL  L     ++L+  GR          L D ++ 
Sbjct: 139 FTDWSHRPLDRRQLDYAIADVTHLATLFPMLLKELRDKGRGAWLDQEMERLADPSQY 195


>gi|163735131|ref|ZP_02142567.1| ribonuclease D [Roseobacter litoralis Och 149]
 gi|161391589|gb|EDQ15922.1| ribonuclease D [Roseobacter litoralis Och 149]
          Length = 387

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 91/216 (42%), Gaps = 13/216 (6%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGTVDIIRI 56
           M TI   +  +   C  A   D + VDTE L       +LC++QL+     D T  I+  
Sbjct: 1   MKTITTTQA-LEEFCTQAAQFDYVTVDTEFLRERTYYSKLCLIQLAMPGEDDSTGCIVDP 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                +   L  +  D    K+FH  R D+ + +    V   P+F T++A+     +  Q
Sbjct: 60  LVPGLSLEPLYALFRDTSVVKVFHAARQDLEIFYVDAEVFPEPLFDTQVAAM-VCGFGEQ 118

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G +  ++ +    + K  + +DWS   L+D Q++YA +DV HL  +     EKL+  GR
Sbjct: 119 VGYETLVRRIAKQPLDKTSRFTDWSRRPLTDAQMKYALADVTHLRDVYEFLAEKLEETGR 178

Query: 177 SDLATSCCNFLMDRAE-----LDLLGWENVDIFSHS 207
           S         L          +D   W  V   ++S
Sbjct: 179 SRWVREELTVLTSPETYIIPPMD--AWRRVKTRTNS 212


>gi|158523201|ref|YP_001531071.1| 3'-5' exonuclease [Desulfococcus oleovorans Hxd3]
 gi|158512027|gb|ABW68994.1| 3'-5' exonuclease [Desulfococcus oleovorans Hxd3]
          Length = 382

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 79/177 (44%), Gaps = 5/177 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
              V  +AVD E   L    +++C++Q+        I  +A    +  +L     D    
Sbjct: 25  LERVPVVAVDLEADSLHHFTEKVCLIQIGVNGDAFLIDPLAL--SDLSSLKPFFADPGVI 82

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H   +D+  L+  FG+ +  +F ++IASR         GL D +    G+ + K  +
Sbjct: 83  KVLHGADYDVRSLYRDFGITITGLFDSEIASRFLGVQ--STGLNDVVNRRFGVTMDKGCR 140

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
             DW+   L ++ L YAA DV +L  L  Q   +LQ++GR++     C  L  R   
Sbjct: 141 KQDWTQRPLPEKMLSYAALDVRYLVDLYHQLQNELQQMGRAEWVAEECELL-SRVRY 196


>gi|326404838|ref|YP_004284920.1| ribonuclease D [Acidiphilium multivorum AIU301]
 gi|325051700|dbj|BAJ82038.1| ribonuclease D [Acidiphilium multivorum AIU301]
          Length = 392

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 56/177 (31%), Positives = 76/177 (42%), Gaps = 2/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE +        LC+VQL   +    I   A G   AP L  +  +    
Sbjct: 26  LAAEPFVTVDTEFMREKTYFPELCVVQLGGANDVAVIDAQAEGLDLAP-LGALFANPAVT 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI +    FG    P+F T++A+     + +Q G    +  L G  I KA +
Sbjct: 85  KVFHACRQDIEIFLLKFGAVPTPLFDTQVAAM-VAGFGDQVGYDTLVSSLAGGRIDKAHR 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            SDWSA  LS  Q+ YAA+DV  L  +      +L R GR D        L D A  
Sbjct: 144 FSDWSARPLSRAQIAYAAADVTWLRPVYEGLRARLTREGRLDWVAEEAAVLADPATY 200


>gi|304321318|ref|YP_003854961.1| ribonuclease D [Parvularcula bermudensis HTCC2503]
 gi|303300220|gb|ADM09819.1| ribonuclease D [Parvularcula bermudensis HTCC2503]
          Length = 383

 Score =  117 bits (294), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 85/180 (47%), Gaps = 3/180 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D + VDTE +       +LC++Q++  +    I  +AA    AP L  
Sbjct: 9   DLTALCGRLAKHDFVTVDTEFMRERTYYPKLCLIQVASTEEAAIIDPLAAALDLAPFL-E 67

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +L D    K+FH  R D+ + +   G    P+F T+IA+     + +Q G +  ++E+ G
Sbjct: 68  LLADPSVLKVFHAARQDLEIFYKLMGKVPAPLFDTQIAAM-ACGHGDQVGYEALIREVTG 126

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
             + K  + +DW+   LSD+QL YA  DV HL         +L+  GR +   +    L 
Sbjct: 127 AQVDKGSRFTDWAKRPLSDKQLTYALGDVTHLVDAYQALITELEEKGRLEWIHAEMTQLN 186


>gi|42520085|ref|NP_966000.1| ribonuclease D, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409822|gb|AAS13934.1| ribonuclease D, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 392

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
            E  A+    IAVDTE +        +L ++Q+S G+ +  I+     + +   +  +++
Sbjct: 14  EELIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKS-FIVDALVPEIDLSFIKKIML 72

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           ++   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  GI +
Sbjct: 73  NQGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGIAL 132

Query: 132 SK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            K   ++SDW    LS++QL YA +DVVHL+ L      KL+   R          +
Sbjct: 133 DKIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNRMGWFQEEMESI 189


>gi|148261351|ref|YP_001235478.1| ribonuclease D [Acidiphilium cryptum JF-5]
 gi|146403032|gb|ABQ31559.1| ribonuclease D [Acidiphilium cryptum JF-5]
          Length = 392

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 56/177 (31%), Positives = 76/177 (42%), Gaps = 2/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE +        LC+VQL   +    I   A G   AP L  +  +    
Sbjct: 26  LAAEPFVTVDTEFMREKTYFPELCVVQLGGANDVAVIDAQAEGLDLAP-LGALFANPAVT 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI +    FG    P+F T++A+     + +Q G    +  L G  I KA +
Sbjct: 85  KVFHACRQDIEIFLLKFGAVPAPLFDTQVAAM-VAGFGDQVGYDTLVSSLAGGRIDKAHR 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            SDWSA  LS  Q+ YAA+DV  L  +      +L R GR D        L D A  
Sbjct: 144 FSDWSARPLSRAQIAYAAADVTWLRPVYEGLRARLTREGRLDWVAEEAAVLADPATY 200


>gi|291617685|ref|YP_003520427.1| Rnd [Pantoea ananatis LMG 20103]
 gi|291152715|gb|ADD77299.1| Rnd [Pantoea ananatis LMG 20103]
          Length = 373

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 88/196 (44%), Gaps = 7/196 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               + + D  +   C  AR   A+A+DTE +       +L ++QL  G+  V I  +  
Sbjct: 1   MNYSLIDNDDRLAEVCNKARQHTAVALDTEFVRTRTYYPQLGLIQLFDGEQLVLIDPLPV 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++    + +L D +  K  H G  D+ V  + F V  +P+  T+I +          G
Sbjct: 61  --RDWSPFIELLTDTRVTKFLHAGGEDLEVFLHRFAVLPQPMIDTQILAAF-SGQPLSWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +     + + K++  +DW A  L++ Q QYAA+DV +L  +  Q  +++++ G   
Sbjct: 118 FASMVAHFTQVELDKSEARTDWLARPLTERQCQYAAADVHYLLPIAHQLMQQVEQAGNMA 177

Query: 179 LATSCCNFLMDRAELD 194
            A S C  L  R  LD
Sbjct: 178 AALSECENLCQR-RLD 192


>gi|99034557|ref|ZP_01314528.1| hypothetical protein Wendoof_01000660 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 409

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
            E  A+    IAVDTE +        +L ++Q+S G+ +  I+     + +   +  +++
Sbjct: 31  EELIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKS-FIVDTLVPEIDLSFIKKIML 89

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           ++   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  GI +
Sbjct: 90  NQGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGIAL 149

Query: 132 SK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            K   ++SDW    LS++QL YA +DVVHL+ L      KL+   R          +
Sbjct: 150 DKIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNRMGWFQEEMESI 206


>gi|58697529|ref|ZP_00372780.1| ribonuclease D [Wolbachia endosymbiont of Drosophila simulans]
 gi|58535998|gb|EAL59702.1| ribonuclease D [Wolbachia endosymbiont of Drosophila simulans]
          Length = 284

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 3/181 (1%)

Query: 9   GDIPAECAARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            DI     A+    IAVDTE +        +L ++Q+S G+ +  I+     + +   + 
Sbjct: 10  EDICEGLIAKKPKFIAVDTEFIRNNLIYYPKLSLIQISYGEKS-FIVDALVPEIDLSFIK 68

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +++++   K+FH  R DI  L   F     P+F T++A+     Y +  G    +++  
Sbjct: 69  KIMLNQGITKVFHSCRQDIESLLTVFKCIPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQ 128

Query: 128 GINISK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
           GI + K   ++SDW    LS++QL YA +DVVHL+ L      KL+   R          
Sbjct: 129 GIALDKIKAKNSDWLRRPLSEDQLDYAVNDVVHLYDLYQILCNKLEENNRMGWFQEEMES 188

Query: 187 L 187
           +
Sbjct: 189 I 189


>gi|251792786|ref|YP_003007512.1| ribonuclease D [Aggregatibacter aphrophilus NJ8700]
 gi|247534179|gb|ACS97425.1| ribonuclease D [Aggregatibacter aphrophilus NJ8700]
          Length = 385

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 82/194 (42%), Gaps = 7/194 (3%)

Query: 4   IRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            ++   D  +   CA      A+A+DTE +       +L ++QL  GD    I       
Sbjct: 14  FKLITEDESLAEVCALAGQQSAVALDTEFVRTRTFYPKLGLIQLYAGDEVALIDPTT--I 71

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           ++    + +L DE+  K+ H    D+ V  + F    +P+  T++ +          G  
Sbjct: 72  QDFSPFIALLADERVTKVLHASGEDLEVFQHYFQQLPQPMCDTQVVANFLGFAN-SPGFA 130

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             +K    I I K    +DW A  LSD QLQYAA+DV +L  L  Q   +L +       
Sbjct: 131 TLVKHYFQIEIDKGASCTDWLARPLSDTQLQYAAADVWYLLPLYQQMKAQLAQTEWQSAV 190

Query: 181 TSCCNF-LMDRAEL 193
            + C F L  RA+ 
Sbjct: 191 ENECEFLLNKRAQY 204


>gi|257784443|ref|YP_003179660.1| ribonuclease D [Atopobium parvulum DSM 20469]
 gi|257472950|gb|ACV51069.1| ribonuclease D [Atopobium parvulum DSM 20469]
          Length = 379

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/169 (28%), Positives = 74/169 (43%), Gaps = 3/169 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+    +AVDTE L       +LC+VQ+S G     I  +     +   L  +L + +  
Sbjct: 19  AKTSHILAVDTEFLREKTYFPKLCLVQVSTGSEIAAIDPLL--IDDLTPLKELLENPEIV 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    D+ VL         PVF T++A+        Q      ++    + ++KA+ 
Sbjct: 77  KILHACSQDLEVLLEKMDCACAPVFDTQVAAAFLGMRQ-QVSYAGLVENFANVKLAKAES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
            +DWS   L  EQL YA  DV +L A+  Q  EKL +L R        +
Sbjct: 136 LTDWSKRPLDKEQLVYAEDDVRYLPAIYNQMVEKLIKLDRLSWLKPEMD 184


>gi|157962268|ref|YP_001502302.1| ribonuclease D [Shewanella pealeana ATCC 700345]
 gi|157847268|gb|ABV87767.1| ribonuclease D [Shewanella pealeana ATCC 700345]
          Length = 369

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 76/186 (40%), Gaps = 6/186 (3%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M   +  E D  + A     +  D + +DTE +       RL ++Q   G     I  +A
Sbjct: 1   MLAFQYIEDDASLAALVEQYQDADLLVLDTEFVRTRTYYARLGLIQAYDGKTLALIDPLA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                      +L  E   K+ H    D+ V       +   +F ++IA+       +  
Sbjct: 61  VSNLEL--FWQLLSKESSVKLLHSCSEDLEVFARYGNCQPTNLFDSQIAA-GLAGMGHGL 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    +++ L +++ K +  +DW    L++ QL YAA+DV +L+ L  Q  + L+  GR 
Sbjct: 118 GYAKLVEQTLEVSLDKGESRTDWLKRPLTEAQLNYAANDVYYLYKLYPQLVKLLEEQGRL 177

Query: 178 DLATSC 183
           D     
Sbjct: 178 DWVYEE 183


>gi|308234516|ref|ZP_07665253.1| ribonuclease D [Atopobium vaginae DSM 15829]
 gi|328944110|ref|ZP_08241575.1| ribonuclease D [Atopobium vaginae DSM 15829]
 gi|327492079|gb|EGF23853.1| ribonuclease D [Atopobium vaginae DSM 15829]
          Length = 376

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 80/166 (48%), Gaps = 3/166 (1%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
             D +A+DTE +       +LC++QL+     V +  ++    +  +L  + +D+K  KI
Sbjct: 18  KSDVLAIDTEFMREKTFYPKLCLIQLATRSEIVLVDPLS--IPDLTDLCKLFLDKKITKI 75

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
           FH    D+ +++  F    +PVF T++A+        Q G    +  L  +++ KA+  +
Sbjct: 76  FHACSQDLELIYDIFSCLPKPVFDTQVAAAFLGHRF-QIGYGPLVDALCHVHLPKAESLT 134

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
           DW+   L++EQL+YAA DV +L  +      +L+   R        
Sbjct: 135 DWTRRPLAEEQLEYAADDVRYLPRMYDTLLHELKEKERYAWFLEEM 180


>gi|190570587|ref|YP_001974945.1| Putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190356859|emb|CAQ54230.1| Putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 394

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 82/177 (46%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
            E  A+    IAVDTE +        RL ++Q+S G+ +  I+ +     +   +  +++
Sbjct: 14  EELMAKDPKFIAVDTEFIRNNLTYYPRLSLIQISYGEKS-FIVDVLVPGIDLSLIKKIML 72

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           + +  K+FH  R DI  L         P+F T++A+     Y +  G    +++  G+ +
Sbjct: 73  NREITKVFHSCRQDIESLLTVLKCVPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGVAL 132

Query: 132 SK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            K   ++SDW    LS++QL YA +DV+HL+ L      KL+   R          +
Sbjct: 133 DKIKAKNSDWLKRPLSEDQLDYAVNDVIHLYDLHQILCNKLEENNRMGWFQEEMESI 189


>gi|299133731|ref|ZP_07026925.1| ribonuclease D [Afipia sp. 1NLS2]
 gi|298591567|gb|EFI51768.1| ribonuclease D [Afipia sp. 1NLS2]
          Length = 382

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/177 (25%), Positives = 77/177 (43%), Gaps = 2/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 + VDTE L        LC+VQL+  D    ++   A   +      ++ DEK  
Sbjct: 17  LARHPFVTVDTEFLRETTYYPLLCVVQLASSDE-AVVVDALAEGIDLKPFFDLMADEKVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH  R DI ++++  G+   PVF T++A+ +             +  + G  + K  +
Sbjct: 76  KVFHAARQDIEIVWHLAGIVPHPVFDTQVAAMVLGYGD-SIAYDQLVGRITGHKLDKTHR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DWS   L+ EQ  YA +DV HL  +       L++  R+D  +   + L   +  
Sbjct: 135 FTDWSRRPLTKEQSAYALADVTHLRDVFTALDADLKKRKRADWVSEEMDVLTSPSTY 191


>gi|261868337|ref|YP_003256259.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413669|gb|ACX83040.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 385

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 78/172 (45%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AAR   A+A+DTE + +     +L ++Q+  GD    I  +    ++    + +L D   
Sbjct: 29  AARQQSAVALDTEFVRVRTLYPKLGLIQMYFGDRVALIDPLP--IQDFSPFIKLLADTNL 86

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V  + F    RP+  T++ +          G    ++    I I K  
Sbjct: 87  VKILHACSEDLDVFQHYFQQLPRPMCDTQVMAHFLGFAG-STGFATLVQHYFQIEIDKGA 145

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             +DW A  LSD QLQYAA+DV +L  L  Q  ++L +     +  + C FL
Sbjct: 146 SRTDWLARPLSDTQLQYAAADVWYLLPLYEQMQQQLTQTEWQSVVENECEFL 197


>gi|298291118|ref|YP_003693057.1| ribonuclease D [Starkeya novella DSM 506]
 gi|296927629|gb|ADH88438.1| ribonuclease D [Starkeya novella DSM 506]
          Length = 385

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 2/180 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 I VDTE L       +LC+VQL+  +  + +  +A G   AP    ++ DEK  
Sbjct: 17  LARHPFITVDTEFLRETTFWPKLCVVQLASVEEAIVVDAVADGIDLAPFF-ALMSDEKVL 75

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH GR DI ++++  G+   PVF T++A+ +             ++ + G  + K+ +
Sbjct: 76  KVFHAGRQDIEIVWHLAGIIPHPVFDTQVAAMVLGHGD-SISYDQLVQRITGEVLDKSLR 134

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   LS  Q+ YA +DV HL  + L+    L++ GR+D        L         
Sbjct: 135 FTDWSRRPLSAAQIAYAEADVTHLRDVFLKLDADLKKRGRADWVGEEMAVLTSPDTYRQE 194


>gi|58584516|ref|YP_198089.1| ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418832|gb|AAW70847.1| Ribonuclease D [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 399

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 52/179 (29%), Positives = 86/179 (48%), Gaps = 3/179 (1%)

Query: 9   GDIPAECAARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLV 67
            DI  E  A+    IA DTE +        RL ++Q+S G+ +  I+   A + +   + 
Sbjct: 10  EDICEELIAKKPKFIAADTEFIRNHLTYYPRLSLIQISYGEKS-FIVDALAPEVDLSFIK 68

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            ++++ +  K+FH  R DI  LF  F     P+F T++A+     Y +  G    +++  
Sbjct: 69  KIMLNREITKVFHSCRQDIESLFTVFKCIPAPIFDTQVAAMFCHYYHDFIGYSKVVEQYQ 128

Query: 128 GINISK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           G+ + K   ++SDW    LS +QL YA SDVVHL+ L     ++L+  GR         
Sbjct: 129 GVVLDKIKAKNSDWLRRPLSKDQLDYAISDVVHLYDLHQILCDRLEESGRMGWFHEEME 187


>gi|84687040|ref|ZP_01014923.1| ribonuclease D [Maritimibacter alkaliphilus HTCC2654]
 gi|84665014|gb|EAQ11495.1| ribonuclease D [Rhodobacterales bacterium HTCC2654]
          Length = 387

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 53/215 (24%), Positives = 94/215 (43%), Gaps = 10/215 (4%)

Query: 1   MTTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLS----PGDGTVDIIR 55
           M TI   E  +   C  A     + VDTE L       +LC+VQL+      +    ++ 
Sbjct: 1   MKTITTTEA-LADYCRRAATFPYVTVDTEFLRERTYYSKLCLVQLAVMGDDDEVDAVLVD 59

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
             A   +   L  +  DE   K+FH  R D+ + +   G+   P+F T++A+     + +
Sbjct: 60  PLADGLSLEPLYELFRDEGVVKVFHAARQDLEIFYVDAGLIPSPLFDTQVAAM-VCGFGD 118

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q G +  ++++    + K+ + +DWS   L+D Q +YA  DV HL  +      +L+  G
Sbjct: 119 QAGYETLVRKIAKAQLDKSSRFTDWSRRPLTDAQKKYAIGDVTHLRVIYEFLKAQLEETG 178

Query: 176 RSDLATSCCNFLMDRAELDL---LGWENVDIFSHS 207
           R+       + L D     +     W+ V   ++S
Sbjct: 179 RAKWVKEELSVLTDPDTYTVDPDEAWKRVKTRTNS 213


>gi|139437245|ref|ZP_01771405.1| Hypothetical protein COLAER_00384 [Collinsella aerofaciens ATCC
           25986]
 gi|133776892|gb|EBA40712.1| Hypothetical protein COLAER_00384 [Collinsella aerofaciens ATCC
           25986]
          Length = 377

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/186 (29%), Positives = 89/186 (47%), Gaps = 3/186 (1%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
             I  H+  +     AR  DAIAVDTE L       RLC+VQ++    +V +  +     
Sbjct: 1   MYISTHQALLDFCQRAREFDAIAVDTEFLRERTFHPRLCLVQIATPAESVAVDPLV--ID 58

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +   L  ++ DE   K+FH    D+ V+ +T GV  RP+F T++A+        Q     
Sbjct: 59  DLSPLAELMADESVTKVFHACSQDMEVMLHTVGVLPRPIFDTQVAAAFLG-ERQQISYGA 117

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            ++   G+++ K +  +DWS   L+D+Q++YA  DV +L     +   +L+ LGR D   
Sbjct: 118 LVQTFCGVSLPKTESLTDWSRRPLTDKQIEYAIDDVKYLIVAYTEMMSRLRELGRVDWVL 177

Query: 182 SCCNFL 187
                L
Sbjct: 178 DELRPL 183


>gi|149915004|ref|ZP_01903533.1| ribonuclease D [Roseobacter sp. AzwK-3b]
 gi|149811192|gb|EDM71029.1| ribonuclease D [Roseobacter sp. AzwK-3b]
          Length = 385

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 7/192 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLS---PGDGTVDIIRIAAGQKNAPNLVGMLVDE 73
           AR  D + VDTE L       +LC+VQL+    G     ++   AG  +   L  +  DE
Sbjct: 17  ARQFDYVTVDTEFLRERTYYSKLCLVQLAVPGTGAEDAVLVDPLAGDLSMAPLYDLFRDE 76

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              K+FH  R D+ + F   GV   P+F T++ +     +  Q G +  ++++    + K
Sbjct: 77  SVVKVFHAARQDLEIFFVDAGVIPAPLFDTQVTAM-VCGFGEQVGYETLVRKIAKEQLDK 135

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
             + +DWS   L+D Q +YA +DV HL  +      KL +  R    T     L      
Sbjct: 136 TSRFTDWSRRPLTDAQKKYALADVTHLRDIYEFLARKLAQSDRQKWVTEELQVLTAPETY 195

Query: 194 DL---LGWENVD 202
            +     W+ V 
Sbjct: 196 RVSPDEAWKRVK 207


>gi|292488477|ref|YP_003531361.1| ribonuclease D [Erwinia amylovora CFBP1430]
 gi|291553908|emb|CBA20953.1| Ribonuclease D [Erwinia amylovora CFBP1430]
          Length = 369

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 82/174 (47%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+    I  +     +      +L+D++  
Sbjct: 15  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGETICLIDPLP--ITDWTPFRDLLLDQQVI 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +          G    ++   GI + K++ 
Sbjct: 73  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAF-SGRPLSCGFATIVESFTGIVLDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 132 RTDWLARPLSEKQCRYAAADVFYLLPIAEKLVAETEAAGQMAAALDECRLLCQR 185


>gi|218780589|ref|YP_002431907.1| DNA polymerase I [Desulfatibacillum alkenivorans AK-01]
 gi|218761973|gb|ACL04439.1| DNA polymerase I [Desulfatibacillum alkenivorans AK-01]
          Length = 889

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/210 (19%), Positives = 72/210 (34%), Gaps = 18/210 (8%)

Query: 8   EGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN- 65
           E D+ A           A+DTET GL P +  L  +  S          +      AP+ 
Sbjct: 297 EEDLEALAENLEKAGVFALDTETTGLDPMQASLVGMSFSYEADRAFYAPLTHDYLGAPDQ 356

Query: 66  ---------LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                    L  +L + + +KI    ++D  VL           F T +AS L       
Sbjct: 357 VGVEKALEILGPVLSNPEIKKIGQNIKYDWIVLARHGADLQGVAFDTMVASYLLNPSHRS 416

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLS------DEQLQYAASDVVHLHALRLQFTEK 170
           HGL     ELL   +   ++     A  ++      ++ + YA  D      +      K
Sbjct: 417 HGLDQIAMELLEHRMISYEEVCGKGAKAITFNQVPLEKAVPYACEDADVTFQIYGLLQPK 476

Query: 171 LQRLGRSDLATS-CCNFLMDRAELDLLGWE 199
           L++    +L  +     +    ++++ G  
Sbjct: 477 LEKNQLLELFKTVEMPLVRVLVKMEMEGIT 506


>gi|292899665|ref|YP_003539034.1| ribonuclease D [Erwinia amylovora ATCC 49946]
 gi|291199513|emb|CBJ46630.1| ribonuclease D [Erwinia amylovora ATCC 49946]
          Length = 373

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 82/174 (47%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+    I  +     +      +L+D++  
Sbjct: 19  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGETICLIDPLP--ITDWTPFRDLLLDQQVI 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +          G    ++   GI + K++ 
Sbjct: 77  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAF-SGRPLSCGFATIVESFTGIVLDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 136 RTDWLARPLSEKQCRYAAADVFYLLPIAEKLVAETEAAGQMAAALDECRLLCQR 189


>gi|167623763|ref|YP_001674057.1| ribonuclease D [Shewanella halifaxensis HAW-EB4]
 gi|167353785|gb|ABZ76398.1| ribonuclease D [Shewanella halifaxensis HAW-EB4]
          Length = 369

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 77/186 (41%), Gaps = 6/186 (3%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M   +  E D  + A     +  D + +DTE +       RL ++Q   G     I  +A
Sbjct: 1   MLVFQYIEDDASLAALVEQYQEADLLVLDTEFVRTRTYYARLGLIQAYDGKTLALIDPLA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                      +L  E   K+ H    D+ V       +   +F ++IA+       +  
Sbjct: 61  VSNLEL--FWQLLNKESSVKLLHSCSEDLEVFARYGQCQPTNLFDSQIAA-GLAGMGHGL 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    +++ L +++ K +  +DW    L++ QL YAA+DV +L+ L  Q  +KL+  GR 
Sbjct: 118 GYAKLVEQTLEVSLDKGESRTDWLKRPLTEAQLNYAANDVYYLYKLYPQLVDKLKEQGRL 177

Query: 178 DLATSC 183
           D     
Sbjct: 178 DWVYEE 183


>gi|312172621|emb|CBX80877.1| Ribonuclease D [Erwinia amylovora ATCC BAA-2158]
          Length = 369

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 82/174 (47%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+    I  +     +      +L+D++  
Sbjct: 15  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGETICLIDPLP--ITDWTPFRDLLLDQQVI 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +          G    ++   GI + K++ 
Sbjct: 73  KYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAF-SGRPLSCGFATIVESFTGIVLDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q +YAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 132 RTDWLARPLSEKQCRYAAADVFYLLPIAEKLVAETEAAGQMAAALDECRLLCQR 185


>gi|218515424|ref|ZP_03512264.1| ribonuclease III protein [Rhizobium etli 8C-3]
          Length = 177

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 84/171 (49%), Gaps = 3/171 (1%)

Query: 10  DIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ A C      D I +DTE L        LC++Q++     V +  +A G   AP    
Sbjct: 7   DLAAACKELAKSDFITIDTEFLRETTFWPELCLIQMASPTLEVLVDPLAKGIDLAPFF-E 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ D K  K+FH  R DI ++F    +   P+F T++A+     + +       +  +  
Sbjct: 66  LMADTKVLKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAM-VCGFGDSVSYDQLVSRIKN 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
           ++I K+ + +DWS   LSD+QL+YA +DV HL  + L    +L R GR+  
Sbjct: 125 VHIDKSSRFTDWSRRPLSDKQLEYALADVTHLRDVYLSLKAELDREGRTSW 175


>gi|146279098|ref|YP_001169257.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17025]
 gi|145557339|gb|ABP71952.1| ribonuclease D [Rhodobacter sphaeroides ATCC 17025]
          Length = 385

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 83/190 (43%), Gaps = 4/190 (2%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGT---VDIIRIA 57
           M TI   E       AA+    + +DTE L       +LC++Q++    T   V +  + 
Sbjct: 1   MKTITTTEALAAFCEAAKAAPYVTIDTEFLRERTYWSKLCLIQMALPGKTGEAVLVDPVE 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
           A   +   L  +   E   K+FH  R D+ + F    V   P+F T++A+     +  Q 
Sbjct: 61  APDMSLEPLYDLFRHEPTVKVFHAARQDLEIFFVEGRVFPTPLFDTQVAAM-VCGFGEQV 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G +  +K++    + K  + +DWS   LSD Q  YA +DV HL  +    + ++++ GR 
Sbjct: 120 GYETLVKKIAREQLDKTSRFTDWSRRPLSDAQKTYAIADVTHLRVIYEWLSAQIEKNGRQ 179

Query: 178 DLATSCCNFL 187
                    L
Sbjct: 180 RWVEEELAIL 189


>gi|260776343|ref|ZP_05885238.1| ribonuclease D [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607566|gb|EEX33831.1| ribonuclease D [Vibrio coralliilyticus ATCC BAA-450]
          Length = 371

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 89/208 (42%), Gaps = 15/208 (7%)

Query: 2   TTIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++      +   CA AR  D + +DTE +       +L ++QL  G+    I     
Sbjct: 1   MNYQIITRPDQLEKVCAQARNADVVMLDTEFVRTRTYYPQLGLIQLFDGETLSLIDPTV- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    V +L D    K+ H    D+ V   +FG    P+  T++ +          G
Sbjct: 60  -IDDMTAFVHLLKDTSVLKVLHACGEDLEVFNNSFGCLPYPMVDTQLMAAFLGHGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++  LG+ + K++  +DW A  L+D+QL YAA+DV +L  L  +  E++ + G  +
Sbjct: 118 FASLVESYLGVELDKSESRTDWLARPLTDKQLDYAAADVHYLLPLYEKLLEEITQAGWWE 177

Query: 179 LATSCCNFL---------MDRAELDLLG 197
            A    + L          ++A LD+ G
Sbjct: 178 AAQQESDLLATKRIKSLDPEKAYLDVKG 205


>gi|311279296|ref|YP_003941527.1| ribonuclease D [Enterobacter cloacae SCF1]
 gi|308748491|gb|ADO48243.1| ribonuclease D [Enterobacter cloacae SCF1]
          Length = 386

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 85/191 (44%), Gaps = 6/191 (3%)

Query: 3   TIR-VHEGD-IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             + + + D + A C A R   AIA+DTE +       +L ++Q+  GD  V I  ++  
Sbjct: 11  NYQMITQDDALKAACDAARGAPAIALDTEFVRTRTYYPQLGLIQMYDGDSVVLIDPLS-- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +      +L+D    K  H G  D+ V   TFGV   P+  T+I +          G 
Sbjct: 69  ITDWTPFRDLLLDGAVTKYLHAGSEDLEVFLNTFGVLPEPLIDTQILAAFCGRPM-SWGF 127

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E  GI + K++  +DW A  L++ Q  YAA+DV +L  +  +   + +  G    
Sbjct: 128 AAMVEEYTGIALDKSESRTDWLARPLTERQCDYAAADVWYLLPIAHKLMAETEASGWLPA 187

Query: 180 ATSCCNFLMDR 190
           A   C  +  R
Sbjct: 188 ALDECRLMQQR 198


>gi|332307210|ref|YP_004435061.1| ribonuclease D [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174539|gb|AEE23793.1| ribonuclease D [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 391

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 79/177 (44%), Gaps = 4/177 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               +AIAVDTE +       +L ++Q+  G     I  +     +A  L  +L DE   
Sbjct: 19  LAKAEAIAVDTEFVRTRTLYPKLGLIQIYDGQQIALIDPLEISDFSA--LKAILTDENIV 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI        +  +P+F ++ A+ +        G    ++ +L I + K + 
Sbjct: 77  KVLHSCSEDIETFICALDIVPKPIFDSQFAAAIVGMGA-SLGYAKLVEVMLDIQVDKGES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DW A  LS EQ +YAA DV++L+ L     +K +  GR     +  + L  R +L
Sbjct: 136 RTDWLARPLSPEQCRYAAYDVLYLYQLYPTLRDKARAQGRQAWVFAEMDNL-SRKKL 191


>gi|332992448|gb|AEF02503.1| ribonuclease D [Alteromonas sp. SN2]
          Length = 385

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 79/186 (42%), Gaps = 6/186 (3%)

Query: 11  IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           + + C   +   A+A+DTE +        L ++QL  G   V I  +A    +    + +
Sbjct: 12  LDSVCNLAQQQKAVALDTEFVRTRTLSPHLGLIQLYDGHQLVLIDPLA--IDDLSPFIAL 69

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           + + +  K+ H    D+      F     PVF ++ A+ +        G    ++ L  +
Sbjct: 70  MENTRVVKVLHSCSEDLETFLTAFNTVPTPVFDSQFAASILGLGA-SLGYAKLVELLCDV 128

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-- 187
           ++ K +  +DW A  L + QL YAA+DV++L        EK+   G+ +        L  
Sbjct: 129 SLDKGESRTDWIARPLREAQLSYAANDVLYLLPCYEHLVEKINEAGKLEWVYQEIAQLAD 188

Query: 188 MDRAEL 193
             R+++
Sbjct: 189 KKRSQM 194


>gi|78048167|ref|YP_364342.1| ribonuclease D [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|78036597|emb|CAJ24288.1| ribonuclease D [Xanthomonas campestris pv. vesicatoria str. 85-10]
          Length = 363

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 80/189 (42%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +H  ++     A     I +DTE +       +L +VQ++ GD  + I  +  G   A  
Sbjct: 6   IHPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGDEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       G   RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTAPDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+    T +L   GR +       
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDALTRRLAEQGRLEWLAEDAE 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|325928069|ref|ZP_08189282.1| ribonuclease D [Xanthomonas perforans 91-118]
 gi|325541567|gb|EGD13096.1| ribonuclease D [Xanthomonas perforans 91-118]
          Length = 363

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 80/189 (42%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +H  ++     A     I +DTE +       +L +VQ++ GD  + I  +  G   A  
Sbjct: 6   IHPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGDEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       G   RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+    T +L   GR +       
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDALTRRLAEQGRLEWLAEDAE 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|220933694|ref|YP_002512593.1| ribonuclease D [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995004|gb|ACL71606.1| ribonuclease D [Thioalkalivibrio sp. HL-EbGR7]
          Length = 396

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 74/165 (44%), Gaps = 3/165 (1%)

Query: 23  IAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYG 82
           IA+DTE +       RLC+VQ++  D    I  IA    +   L  +L D    K+ H  
Sbjct: 36  IALDTEFVREKTYYPRLCLVQVATPDALACIDPIAL--PDLGPLAALLHDPAVTKVVHAA 93

Query: 83  RFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSA 142
             D+ +L  + G    PVF T++A      + +Q G    ++  L + + K    +DWS 
Sbjct: 94  HQDMEILLQSTGRVPTPVFDTQVA-VSLLGHGDQIGYARMVQIYLDLELDKGHTRTDWSQ 152

Query: 143 DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             L   QL+YAA DV HL  +     + L+  GR D  +     +
Sbjct: 153 RPLETAQLRYAADDVRHLARVYPMILKDLEEKGRLDWLSEDFAAI 197


>gi|88607542|ref|YP_504762.1| putative ribonuclease D [Anaplasma phagocytophilum HZ]
 gi|88598605|gb|ABD44075.1| putative ribonuclease D [Anaplasma phagocytophilum HZ]
          Length = 381

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 86/184 (46%), Gaps = 6/184 (3%)

Query: 9   GDIPA---ECAARYVDAIAVDTETLG-LMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
            D+     E      +++A+DTE L        +LC++Q++  +    I  +A G    P
Sbjct: 7   NDLSRFCTELLRDNPESVAIDTEFLRSFNDYYPKLCLLQIAYENKQCVIDALAEGIDLTP 66

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +  + +  K+FH  R D+  L   F    RP+F T+IA+ L   + N  G    ++
Sbjct: 67  -LQEIFDNTQIFKVFHDCRQDLDALSLLFESLPRPIFDTQIAAMLCEYHENSVGYSKLVE 125

Query: 125 ELLGINISKA-QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           + LG+ ++K   +  DWS   L++ +++YA  DV++L+ L     + L   GR       
Sbjct: 126 QFLGVKLNKMPFKRVDWSKRPLTESEVRYALDDVIYLYKLYGILRDILTSKGRLSWYMEE 185

Query: 184 CNFL 187
            + +
Sbjct: 186 MDCI 189


>gi|118340523|gb|ABK80573.1| putative ribonuclease D [uncultured marine Nitrospinaceae
           bacterium]
          Length = 386

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 86/190 (45%), Gaps = 14/190 (7%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
             +  D + VDTE +       R  ++Q+  G+    I  IA    +   L+ +L D  +
Sbjct: 15  NIQSADVLVVDTEFVRERTYFHRTGLIQVGGGEHFAAIDPIAL--PDMTPLLELLKDPTK 72

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH  R D+ +L    G  + P+F T+IA+     +  Q      + + LG  I K++
Sbjct: 73  VKVFHAARQDLEILVRFCGQVIPPIFDTQIAA-ALVGWGTQISFAKIVYKALGKKIHKSE 131

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
             +DW    LSD Q++YA  DV +L  +  +  E+L+++GR D                +
Sbjct: 132 TYTDWCRRPLSDSQIEYAIDDVRYLMPVYNKLIERLKKMGRLDWVQGE-----------V 180

Query: 196 LGWENVDIFS 205
             WE+   F+
Sbjct: 181 NAWEDPKTFA 190


>gi|213019164|ref|ZP_03334971.1| putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995273|gb|EEB55914.1| putative ribonuclease D [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 378

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 81/173 (46%), Gaps = 3/173 (1%)

Query: 17  ARYVDAIAVDTETLGLM-PRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           A+    IAVDTE +        RL ++Q+S G+ +  I+ +     +   +  ++++ + 
Sbjct: 2   AKDPKFIAVDTEFIRNNLTYYPRLSLIQISYGEKS-FIVDVLVPGIDLSLIKKIMLNREI 60

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK-A 134
            K+FH  R DI  L         P+F T++A+     Y +  G    +++  G+ + K  
Sbjct: 61  TKVFHSCRQDIESLLTVLKCVPTPIFDTQVAAMFCHYYHDFIGYSKVVEQYQGVALDKIK 120

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            ++SDW    LS++QL YA +DV+HL+ L      KL+   R          +
Sbjct: 121 AKNSDWLKRPLSEDQLDYAVNDVIHLYDLHQILCNKLEENNRMGWFQEEMESI 173


>gi|271500522|ref|YP_003333547.1| ribonuclease D [Dickeya dadantii Ech586]
 gi|270344077|gb|ACZ76842.1| ribonuclease D [Dickeya dadantii Ech586]
          Length = 373

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 80/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAARYV-DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + A CA       +A+DTE +       +L ++QL  GD    I  +A 
Sbjct: 1   MNYQLITTDEGLSAVCALACAVSEVALDTEFVRTRTYYPQLGLIQLYDGDNLSLIDPLAI 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                     +L + +  K  H G  D+ V    FG    P   T+I +   R     +G
Sbjct: 61  SN--WEPFRALLQNPQVTKYLHAGSEDLEVFLNAFGCLPSPFIDTQILAAF-RGKPLSYG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + +   I + K++  +DW A  LS++Q QYAA+DV +L  +     E+ +  G  +
Sbjct: 118 FAALVADYRQIVLDKSESRTDWLARPLSEKQCQYAAADVFYLLPVARVLVEETRLAGWME 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AALDECQLLCQR 189


>gi|198244835|ref|YP_002215323.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|197939351|gb|ACH76684.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
          Length = 375

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FAAMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|194445618|ref|YP_002041074.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|200390008|ref|ZP_03216619.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|194404281|gb|ACF64503.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|199602453|gb|EDZ00999.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
          Length = 375

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|62180380|ref|YP_216797.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194734944|ref|YP_002114851.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197248423|ref|YP_002146207.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197301010|ref|ZP_02662940.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|205360221|ref|ZP_02681919.2| ribonuclease D [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|62128013|gb|AAX65716.1| RNase D, processes tRNA precursor [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194710446|gb|ACF89667.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197212126|gb|ACH49523.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197289302|gb|EDY28669.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|205350690|gb|EDZ37321.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|322714855|gb|EFZ06426.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 375

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FAAMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|205357371|ref|ZP_02347252.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205322073|gb|EDZ09912.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 375

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FAAMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|205352517|ref|YP_002226318.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205359829|ref|ZP_02832566.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|207856676|ref|YP_002243327.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|205272298|emb|CAR37177.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205342684|gb|EDZ29448.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|206708479|emb|CAR32800.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326627575|gb|EGE33918.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 375

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FAAMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|194468559|ref|ZP_03074543.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205358811|ref|ZP_02659348.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|194454923|gb|EDX43762.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205331760|gb|EDZ18524.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
          Length = 375

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D +  K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTEITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FAAMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|289207511|ref|YP_003459577.1| ribonuclease D [Thioalkalivibrio sp. K90mix]
 gi|288943142|gb|ADC70841.1| ribonuclease D [Thioalkalivibrio sp. K90mix]
          Length = 392

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/185 (28%), Positives = 81/185 (43%), Gaps = 5/185 (2%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           + A        D IA+DTE L       +LC+VQ +  D    I      + +   L  +
Sbjct: 13  LQAFLDSIAGTDWIALDTEFLREKTYYPQLCLVQAATLDQLACIDP---LRLDIQQLAPL 69

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
             D    K+FH    D+ +L+   G    PVF T+IA+ +      Q G  + +K +L  
Sbjct: 70  FRDPGITKVFHAASQDMELLYRELGFVPSPVFDTQIAASMLGYGE-QVGYANLVKTVLER 128

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
           ++ K+Q  +DWS   LS EQ++YAA DV HL  L  +   +L    R          L +
Sbjct: 129 DLDKSQTRTDWSRRPLSAEQIRYAADDVRHLATLFNRLLHELDTHDRMHWLRPEMEALSN 188

Query: 190 RAELD 194
            A  +
Sbjct: 189 PALYE 193


>gi|119775068|ref|YP_927808.1| ribonuclease D [Shewanella amazonensis SB2B]
 gi|119767568|gb|ABM00139.1| ribonuclease D [Shewanella amazonensis SB2B]
          Length = 371

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 80/186 (43%), Gaps = 6/186 (3%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M      + D  + A          + +DTE +       +L ++Q+  G+    I  + 
Sbjct: 1   MLEFHYVKDDEALTALVDQYSQSRLLVLDTEFVRTRTYYAKLGLIQVYDGNTLALIDPL- 59

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
              ++      +L +    K+ H    D+ V      V+  P+F ++IA+       +  
Sbjct: 60  -DIQDLSGFWALLTNPNILKLVHSCSEDLEVFARYGKVQPTPLFDSQIAA-ALSGMGHGL 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    ++E LG  + K +  +DW    L+D QLQYAA+DV +L+ L  Q  +KL+ LGR 
Sbjct: 118 GYAKLVEECLGQTLDKGESRTDWIKRPLTDAQLQYAANDVFYLYQLYPQLEQKLKTLGRF 177

Query: 178 DLATSC 183
           D     
Sbjct: 178 DWVLEE 183


>gi|163803649|ref|ZP_02197513.1| cell division topological specificity factor MinE [Vibrio sp. AND4]
 gi|159172559|gb|EDP57420.1| cell division topological specificity factor MinE [Vibrio sp. AND4]
          Length = 372

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 6/189 (3%)

Query: 2   TTIRVHEG--DIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ +   D+   CA  R  D + +DTE + +     +L ++QL  G     I     
Sbjct: 1   MNYQIIKKNKDLEEVCALAREADVVMLDTEFVRIRTFYPQLGLIQLFDGKQLSLIDPTEL 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +  + V +L D    K+ H    D+ V    FG    P+  T++ +          G
Sbjct: 61  --TDMTSFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G  +
Sbjct: 118 FATLVEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLMPLYEKLLDKVNQAGWWE 177

Query: 179 LATSCCNFL 187
                 + L
Sbjct: 178 AVQQESDLL 186


>gi|293392299|ref|ZP_06636633.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952833|gb|EFE02952.1| ribonuclease D [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 385

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 76/172 (44%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AAR   A+A+DTE + +     +L ++Q+  GD    I  +    ++    + +L D   
Sbjct: 29  AARQQSAVALDTEFVRVRTLYPKLGLIQMYFGDQVALIDPLP--IQDFSPFIELLADTNL 86

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T++ +          G    ++    I I K  
Sbjct: 87  VKILHACSEDLDVFQRYFQQLPRPMCDTQVMAHFLGFAG-STGFATLVQHYFQIEIDKGA 145

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             +DW A  LSD QLQYAA+DV +L  L  Q  ++L +        + C FL
Sbjct: 146 SRTDWLARPLSDTQLQYAAADVWYLLPLYGQMQQQLTQTEWQSAVENECEFL 197


>gi|195873245|ref|ZP_02696622.2| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195634367|gb|EDX52719.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 375

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FAAMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|319426180|gb|ADV54254.1| ribonuclease D [Shewanella putrefaciens 200]
          Length = 369

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +   L  +L +    K
Sbjct: 21  QQSKILVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLAKLWALLANPNIIK 78

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 79  LVHSCSEDLEVFAHYGQCQPVPLFDSQIAA-SLCGMGHGVGYAKLVETCLGEVIDKGESR 137

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++LH L  Q   KL   GR +     
Sbjct: 138 TDWIRRPLTEAQLAYAANDVLYLHQLYPQLEAKLVAQGRLNWLYEE 183


>gi|16760707|ref|NP_456324.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29141535|ref|NP_804877.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|25289178|pir||AB0725 ribonuclease D [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503004|emb|CAD05500.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29137162|gb|AAO68726.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 375

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|16765158|ref|NP_460773.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|194448143|ref|YP_002045863.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197262566|ref|ZP_03162640.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205358997|ref|ZP_02666341.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|16420349|gb|AAL20732.1| RNase D [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|194406447|gb|ACF66666.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|197240821|gb|EDY23441.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205339484|gb|EDZ26248.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|261247002|emb|CBG24819.1| Ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267993774|gb|ACY88659.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158341|emb|CBW17840.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|332988704|gb|AEF07687.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 375

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G
Sbjct: 59  GISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|21243147|ref|NP_642729.1| ribonuclease D [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108668|gb|AAM37265.1| ribonuclease D [Xanthomonas axonopodis pv. citri str. 306]
          Length = 363

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 3/188 (1%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  L
Sbjct: 7   HPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA--L 64

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L+     K+ H    D+       G   RP+F T+IA+ L          K  ++E+
Sbjct: 65  KEWLIATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 123

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L   GR +      + 
Sbjct: 124 TGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELTRRLAEQGRLEWLAEDADR 183

Query: 187 LMDRAELD 194
           L+   E D
Sbjct: 184 LLATVEHD 191


>gi|269960729|ref|ZP_06175101.1| ribonuclease D [Vibrio harveyi 1DA3]
 gi|269834806|gb|EEZ88893.1| ribonuclease D [Vibrio harveyi 1DA3]
          Length = 372

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 6/189 (3%)

Query: 2   TTIRVH--EGDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++     D+   CA  R  D + +DTE + +     +L ++QL  G     I     
Sbjct: 1   MNYQIITKNKDLEEVCALAREADVVMLDTEFVRIRTYYPQLGLIQLFDGKQLSLIDPTEL 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +  + V +L D    K+ H    D+ V    FG    P+  T++ +          G
Sbjct: 61  --TDMTSFVELLKDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  +
Sbjct: 118 FATLVEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLMPLYEKLLDKVNEAGWWE 177

Query: 179 LATSCCNFL 187
                 + L
Sbjct: 178 AVQQESDLL 186


>gi|219667033|ref|YP_002457468.1| DNA-directed DNA polymerase [Desulfitobacterium hafniense DCB-2]
 gi|219537293|gb|ACL19032.1| DNA-directed DNA polymerase [Desulfitobacterium hafniense DCB-2]
          Length = 583

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/202 (26%), Positives = 88/202 (43%), Gaps = 7/202 (3%)

Query: 2   TTIR--VHEGDI-PAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
             I+  +H  D+ P          IAVDTET GL P   +L ++QL+  D  V +I   +
Sbjct: 6   MDIKRILHPADLVPYMEKLTAAKVIAVDTETTGLDPHTCQLRLIQLAAEDLPVLVIDCFS 65

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY--TNQ 116
                  L+  ++     K+F   +FD+  L     +    +F T +AS+L R      Q
Sbjct: 66  FLPEGRELINAILSTSGVKVFQNAKFDLQFLM-ALDIFPPTLFDTMLASQLLRGSGGPVQ 124

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LK   +  L  ++ K +Q+S+W  + L++ Q+ YAA D   L  LR     ++     
Sbjct: 125 SNLKALAQHYLNEDLDKEEQTSNWQGE-LTESQILYAARDAEILLRLRKVMIPQILENHL 183

Query: 177 SDLATSCCNFLMDRAELDLLGW 198
           + +A      +   A L+  G 
Sbjct: 184 TQIAEIEFRCVKAMAHLEYRGI 205


>gi|302335597|ref|YP_003800804.1| ribonuclease D [Olsenella uli DSM 7084]
 gi|301319437|gb|ADK67924.1| ribonuclease D [Olsenella uli DSM 7084]
          Length = 376

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 3/172 (1%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIF 79
              +A+DTE L       RLC++Q +  D +  I  I     +   L  +L DE   K+F
Sbjct: 19  SRVLAIDTEFLRERTYFPRLCLIQAATPDESAAIDPIL--IDDLSPLARLLTDESITKVF 76

Query: 80  HYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSD 139
           H    D+ V++        P+F T++A+     +  Q G    +    G+ + KA+  +D
Sbjct: 77  HACSQDLEVIYDALHCVPGPIFDTQLAAAFLG-HRQQIGYGALVDACCGVRLPKAESLTD 135

Query: 140 WSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           WS   L  EQL YA  DV +L  +  Q   +L    R          L+  A
Sbjct: 136 WSRRPLDAEQLAYAEDDVRYLPGIYDQMMAELIMRDRLPWLAPEMAELVSPA 187


>gi|109899113|ref|YP_662368.1| ribonuclease D [Pseudoalteromonas atlantica T6c]
 gi|109701394|gb|ABG41314.1| ribonuclease D [Pseudoalteromonas atlantica T6c]
          Length = 400

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 73/177 (41%), Gaps = 4/177 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                AIAVDTE +       +L ++Q+  G     I  +     +   L  +L DE   
Sbjct: 29  LAKAQAIAVDTEFVRTRTLYPQLGLIQIYDGQQIALIDPLE--ISDFTALKAILTDENIV 86

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI        +  RP+F ++ A+          G    ++ +L I + K + 
Sbjct: 87  KVLHSCSEDIETFICALDIVPRPIFDSQFAA-AITGMGPSLGYAKLVEVMLDIQVDKGES 145

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DW A  LS +Q QYAA DV++L  L     +K    GR     +    L  R +L
Sbjct: 146 RTDWLARPLSPKQCQYAAYDVLYLFQLYPTLCDKTLAQGRQAWVFAEMENL-TRKKL 201


>gi|58582365|ref|YP_201381.1| ribonuclease D [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58426959|gb|AAW75996.1| ribonuclease D [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 416

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/188 (27%), Positives = 79/188 (42%), Gaps = 3/188 (1%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  L
Sbjct: 60  HPSELTDRLQAARPARIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA--L 117

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E+
Sbjct: 118 KEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 176

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L    R          
Sbjct: 177 TGTLLTKGETRSDWMRRPLSPSQLEYAADDVRYLFAIHDELTRRLTEQNRLGWLAEDAER 236

Query: 187 LMDRAELD 194
           L+   E D
Sbjct: 237 LLATVEHD 244


>gi|325497053|gb|EGC94912.1| ribonuclease D [Escherichia fergusonii ECD227]
          Length = 375

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLT- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++   L  +L D    K  H G  D+ V    FG   +P+  T++ +          G
Sbjct: 60  -IRDWSPLKSVLRDPAITKFLHAGSEDLEVFLNKFGEMPQPLIDTQVLAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVILDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMAETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|300717019|ref|YP_003741822.1| ribonuclease D [Erwinia billingiae Eb661]
 gi|299062855|emb|CAX59975.1| Ribonuclease D [Erwinia billingiae Eb661]
          Length = 373

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/179 (25%), Positives = 82/179 (45%), Gaps = 3/179 (1%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEK 74
             AR   A+A+DTE +        L ++Q+  G+    I  +            +L+DEK
Sbjct: 17  LTARQFPALALDTEFVRTRTYYPGLGLIQMYDGENIALIDPLP--ITEWAPFRDLLLDEK 74

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K  H G  D+ V  + + V   P+  T+I +          G    ++   GI + K+
Sbjct: 75  VIKFLHAGSEDLEVFLHEYDVLPVPMIDTQILAAF-TGRPLSCGFATIVESFTGIALDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
           +  +DW A  L+++Q QYAA+DV +L  +  +   + +  GR + A + C+ L  R ++
Sbjct: 134 ESRTDWLARPLTEKQCQYAAADVFYLLPIAHKLLAEAEESGRINAALNECSLLCQRRQM 192


>gi|254372648|ref|ZP_04988137.1| ribonuclease III [Francisella tularensis subsp. novicida GA99-3549]
 gi|151570375|gb|EDN36029.1| ribonuclease III [Francisella novicida GA99-3549]
          Length = 364

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDII 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|126663071|ref|ZP_01734069.1| DNA polymerase I [Flavobacteria bacterium BAL38]
 gi|126624729|gb|EAZ95419.1| DNA polymerase I [Flavobacteria bacterium BAL38]
          Length = 950

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/210 (18%), Positives = 70/210 (33%), Gaps = 14/210 (6%)

Query: 4   IRVHEGDIPAECA---ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            ++ +GD+P +          ++  DTET G+      L  +  S   G    +     Q
Sbjct: 356 YQIIQGDLPVKLLMQNLLNQTSVCFDTETTGIDALNAELVGMSFSFEKGKGFYVPFPEDQ 415

Query: 61  KNAPNL----VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN- 115
           + A  L         +E  EKI    ++D+ +L          +F T IA  L       
Sbjct: 416 EEAQTLIEKFRPFFENENIEKIGQNMKYDLKILSNYNMQVKGKLFDTMIAHYLINPDMRH 475

Query: 116 -----QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEK 170
                         + +   I K  ++     D   ++  +YA  D      L+  F   
Sbjct: 476 NMDVLSETYLKYAPKSIETLIGKKGKNQLSMRDVPLEDIKEYATEDADITFQLKEHFQPI 535

Query: 171 LQRLGRSDLATS-CCNFLMDRAELDLLGWE 199
           L+++G   L        +   A+++  G  
Sbjct: 536 LEKVGTKKLFDEIEIPLVPVLADMEKEGIR 565


>gi|120599067|ref|YP_963641.1| ribonuclease D [Shewanella sp. W3-18-1]
 gi|120559160|gb|ABM25087.1| ribonuclease D [Shewanella sp. W3-18-1]
          Length = 367

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 70/166 (42%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L +    K
Sbjct: 19  QQSKILVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLAKFWALLANPNIIK 76

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 77  LVHSCSEDLEVFAHYGQCQPVPLFDSQIAA-SLCGMGHGVGYAKLVETCLGEVIDKGESR 135

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++LH L  Q   KL   GR +     
Sbjct: 136 TDWIRRPLTEAQLAYAANDVLYLHQLYPQLEAKLVAQGRLNWLYEE 181


>gi|188533676|ref|YP_001907473.1| ribonuclease D [Erwinia tasmaniensis Et1/99]
 gi|188028718|emb|CAO96580.1| Ribonuclease D [Erwinia tasmaniensis Et1/99]
          Length = 373

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/174 (28%), Positives = 81/174 (46%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+A+DTE +       RL ++QL  G+    I  +     +      +L D+K  
Sbjct: 19  ARQVPALALDTEFVRTRTYYPRLGLIQLYDGETISLIDPLP--ITDWTPFSELLQDQKVI 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V  + FGV  +P+  T+I +          G    ++   GI + K++ 
Sbjct: 77  KYLHAGSEDLEVFCHEFGVLPQPMIDTQILAAF-SGRPLSCGFATVVESFTGIALDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q QYAA+DV +L  +  +   + +  G+   A   C  L  R
Sbjct: 136 RTDWLARPLSEKQCQYAAADVFYLLPIAGKLVAEAESAGQMAAALDECRLLCQR 189


>gi|123442616|ref|YP_001006593.1| ribonuclease D [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122089577|emb|CAL12426.1| ribonuclease D [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 373

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  AR    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDSALQQVCEQARTHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                     +L D    K  H G  D+ V    F +   P+  T++ +      +   G
Sbjct: 60  -ITQWQPFRELLQDLNVVKYLHAGSEDLEVFLNAFELMPTPMIDTQVLAAF-SGRSLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E  G+ + K++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D
Sbjct: 118 FAMLVNEFEGVELDKSESRTDWIARPLSEKQCDYAAADVFYLLPLATKLVEATEAAGRMD 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AAKDECELLCRR 189


>gi|134302344|ref|YP_001122313.1| putative ribonuclease D [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134050121|gb|ABO47192.1| putative ribonuclease D [Francisella tularensis subsp. tularensis
           WY96-3418]
          Length = 364

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|320194484|gb|EFW69115.1| Ribonuclease D [Escherichia coli WV_060327]
          Length = 375

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|77917938|ref|YP_355753.1| RNase D [Pelobacter carbinolicus DSM 2380]
 gi|77544021|gb|ABA87583.1| RNase D [Pelobacter carbinolicus DSM 2380]
          Length = 375

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 83/181 (45%), Gaps = 4/181 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            R    IAVD E   L   ++++C++Q+S    TV +  +A   ++   L  +L D    
Sbjct: 20  LRDEAVIAVDLEADSLHSYQEKVCLLQISTSTRTVLVDPLAV--EDLAALAPVLADPTIR 77

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KIFH   +DI  LF  F + V+ +F T IA ++      + GL D L + L + + K  Q
Sbjct: 78  KIFHAADYDIRCLFRDFRIEVQGLFDTMIACQMLGEK--RVGLADVLAKYLDVELDKRYQ 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DWS   L +  + YA  D  HLH L      +L+ +GR   A      L      +  
Sbjct: 136 RADWSKRPLEEGMILYAMEDTCHLHRLTEILEGRLRDMGRLSWAEEEFALLQKVRHSENN 195

Query: 197 G 197
           G
Sbjct: 196 G 196


>gi|146292862|ref|YP_001183286.1| ribonuclease D [Shewanella putrefaciens CN-32]
 gi|145564552|gb|ABP75487.1| ribonuclease D [Shewanella putrefaciens CN-32]
          Length = 367

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 70/166 (42%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L +    K
Sbjct: 19  QQSKILVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLAKFWALLANPNIIK 76

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 77  LVHSCSEDLEVFAHYGQCQPVPLFDSQIAA-SLCGMGHGVGYAKLVETCLGEVIDKGESR 135

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++LH L  Q   KL   GR +     
Sbjct: 136 TDWIRRPLTEAQLAYAANDVLYLHQLYPQLEAKLVAQGRLNWLYEE 181


>gi|187931952|ref|YP_001891937.1| ribonuclease D [Francisella tularensis subsp. mediasiatica FSC147]
 gi|187712861|gb|ACD31158.1| ribonuclease D [Francisella tularensis subsp. mediasiatica FSC147]
          Length = 364

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|156502902|ref|YP_001428967.1| ribonuclease D [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|290953633|ref|ZP_06558254.1| ribonuclease D [Francisella tularensis subsp. holarctica URFT1]
 gi|295313032|ref|ZP_06803730.1| ribonuclease D [Francisella tularensis subsp. holarctica URFT1]
 gi|156253505|gb|ABU62011.1| ribonuclease D [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 363

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|254374109|ref|ZP_04989591.1| ribonuclease D [Francisella novicida GA99-3548]
 gi|151571829|gb|EDN37483.1| ribonuclease D [Francisella novicida GA99-3548]
          Length = 364

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDII 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|114768885|ref|ZP_01446511.1| ribonuclease D [alpha proteobacterium HTCC2255]
 gi|114549802|gb|EAU52683.1| ribonuclease D [alpha proteobacterium HTCC2255]
          Length = 386

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/190 (21%), Positives = 80/190 (42%), Gaps = 4/190 (2%)

Query: 1   MTTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPG---DGTVDIIRIA 57
           M  I   +  I         + + +DTE L       +LC+VQ++     + +  +I   
Sbjct: 1   MIIITKTQELIDFCKKCSAYEYVTLDTEFLRERTYYSKLCLVQMAHPGNTEDSAVLIDPL 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
           +   +   L  +  +    K+FH  R D+ + F    +   P F T++A+     +  Q 
Sbjct: 61  SPDLSLDPLYELFKNPNVVKVFHAARQDLEIFFIDKKIIPFPFFDTQVAAM-VCGFGEQV 119

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G +  ++ +    + K+ + +DWSA  LS++Q+ YA  DV +L  +    + K++   R 
Sbjct: 120 GYEKLVRSICNEGLDKSSRFTDWSARPLSNKQMHYAIGDVTYLREIYEFLSNKIKNNKRQ 179

Query: 178 DLATSCCNFL 187
                    L
Sbjct: 180 AWVEEELKIL 189


>gi|218548642|ref|YP_002382433.1| ribonuclease D [Escherichia fergusonii ATCC 35469]
 gi|218356183|emb|CAQ88800.1| ribonuclease D [Escherichia fergusonii ATCC 35469]
 gi|324113537|gb|EGC07512.1| ribonuclease D [Escherichia fergusonii B253]
          Length = 375

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLT- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++   L  +L D    K  H G  D+ V    FG   +P+  T++ +          G
Sbjct: 60  -IRDWSPLKSVLRDPAITKFLHAGSEDLEVFLNKFGEMPQPLIDTQVLAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVILDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMAETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|89256742|ref|YP_514104.1| ribonuclease D [Francisella tularensis subsp. holarctica LVS]
 gi|115315142|ref|YP_763865.1| ribonuclease III [Francisella tularensis subsp. holarctica OSU18]
 gi|167009819|ref|ZP_02274750.1| ribonuclease III [Francisella tularensis subsp. holarctica FSC200]
 gi|254368041|ref|ZP_04984061.1| ribonuclease D [Francisella tularensis subsp. holarctica 257]
 gi|89144573|emb|CAJ79888.1| Ribonuclease D [Francisella tularensis subsp. holarctica LVS]
 gi|115130041|gb|ABI83228.1| ribonuclease III [Francisella tularensis subsp. holarctica OSU18]
 gi|134253851|gb|EBA52945.1| ribonuclease D [Francisella tularensis subsp. holarctica 257]
          Length = 364

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|294626013|ref|ZP_06704623.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292599683|gb|EFF43810.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 363

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 3/188 (1%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  L
Sbjct: 7   HPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA--L 64

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L+     K+ H    D+       G   RP+F T+IA+ L          K  ++E+
Sbjct: 65  KEWLIATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 123

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L   GR +      + 
Sbjct: 124 TGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELTRRLTEQGRLEWLAEDADR 183

Query: 187 LMDRAELD 194
           L+   E D
Sbjct: 184 LLATVEHD 191


>gi|238762951|ref|ZP_04623918.1| Ribonuclease D [Yersinia kristensenii ATCC 33638]
 gi|238698709|gb|EEP91459.1| Ribonuclease D [Yersinia kristensenii ATCC 33638]
          Length = 373

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  AR    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDSALQQVCEQARTYAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                     +L D    K  H G  D+ V    F +   P+  T++ +      T   G
Sbjct: 60  -ITQWQPFRELLQDLNVVKYLHAGSEDLEVFLNAFDIMPTPMIDTQVLAAF-SGRTLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E  G+ + K++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D
Sbjct: 118 FAMLVNEFEGVELDKSESRTDWIARPLSEKQCDYAAADVFYLLPLATKLVEATEAAGRMD 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AAKDECELLCRR 189


>gi|118497275|ref|YP_898325.1| ribonuclease D [Francisella tularensis subsp. novicida U112]
 gi|194323578|ref|ZP_03057355.1| ribonuclease D [Francisella tularensis subsp. novicida FTE]
 gi|208779068|ref|ZP_03246414.1| ribonuclease D [Francisella novicida FTG]
 gi|118423181|gb|ABK89571.1| ribonuclease D [Francisella novicida U112]
 gi|194322433|gb|EDX19914.1| ribonuclease D [Francisella tularensis subsp. novicida FTE]
 gi|208744868|gb|EDZ91166.1| ribonuclease D [Francisella novicida FTG]
          Length = 364

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLEDLEFKKLKEIFEDKDII 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|212635098|ref|YP_002311623.1| ribonuclease D [Shewanella piezotolerans WP3]
 gi|212556582|gb|ACJ29036.1| Ribonuclease D [Shewanella piezotolerans WP3]
          Length = 369

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 76/186 (40%), Gaps = 6/186 (3%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M   +  + D  + A  A  R    + +DTE +       RL ++Q   G     I  +A
Sbjct: 1   MLAFQYIDDDTSLAALVAQYREAKLLVIDTEFVRTRTYYARLGLIQAYDGKTLALIDPLA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               +      +L D    K+ H    D+ V       +   +F ++IA+          
Sbjct: 61  VTNLSL--FWALLTDSSIIKLLHSCSEDLEVFAKNGACQPNKLFDSQIAA-GLCGMGYGL 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    +++ L I + K +  +DW    LS+ QL YAA+DV +L+ L  Q  +KL+  GR 
Sbjct: 118 GYAKLVEQTLDITLDKGESRTDWLKRPLSEAQLNYAANDVYYLYELYPQLVDKLESQGRL 177

Query: 178 DLATSC 183
           D     
Sbjct: 178 DWVYED 183


>gi|159044436|ref|YP_001533230.1| putative ribonuclease D [Dinoroseobacter shibae DFL 12]
 gi|157912196|gb|ABV93629.1| putative ribonuclease D [Dinoroseobacter shibae DFL 12]
          Length = 385

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 82/182 (45%), Gaps = 7/182 (3%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSP----GDGTVDIIRIAAGQKNAPN 65
           +   CA A   D + VDTE L       +LC+VQL+      +  V +  +A G   AP 
Sbjct: 10  LADFCARAAEHDYVTVDTEFLRERTYYAKLCLVQLAYPGEGEETAVLVDPLAEGMSLAPM 69

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +  +    K+FH  R D+ + F   GV   P+F T++A+     +  Q G +  +++
Sbjct: 70  L-DLFRNPDVVKVFHAARQDLEIFFVEHGVFPEPLFDTQVAAM-VCGFGEQVGYETLVRK 127

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           +   ++ K  + +DWS   LS  Q +YA +DV HL  +       + + GR         
Sbjct: 128 IARESLDKTSRFTDWSHRPLSKAQKKYALADVTHLRVIYEYLAAAIDKTGRRAWVEEELQ 187

Query: 186 FL 187
            L
Sbjct: 188 GL 189


>gi|56707887|ref|YP_169783.1| ribonuclease D [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110670358|ref|YP_666915.1| ribonuclease D [Francisella tularensis subsp. tularensis FSC198]
 gi|224456967|ref|ZP_03665440.1| ribonuclease D [Francisella tularensis subsp. tularensis MA00-2987]
 gi|254370381|ref|ZP_04986386.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874700|ref|ZP_05247410.1| ribonuclease D [Francisella tularensis subsp. tularensis MA00-2987]
 gi|56604379|emb|CAG45409.1| Ribonuclease D [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110320691|emb|CAL08792.1| Ribonuclease D [Francisella tularensis subsp. tularensis FSC198]
 gi|151568624|gb|EDN34278.1| hypothetical protein FTBG_00144 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840699|gb|EET19135.1| ribonuclease D [Francisella tularensis subsp. tularensis MA00-2987]
 gi|282159071|gb|ADA78462.1| Ribonuclease D [Francisella tularensis subsp. tularensis NE061598]
          Length = 364

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|328676764|gb|AEB27634.1| Ribonuclease D [Francisella cf. novicida Fx1]
          Length = 364

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLVKSEYQDFFEQEL 180


>gi|332161539|ref|YP_004298116.1| ribonuclease D [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318605521|emb|CBY27019.1| ribonuclease D [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325665769|gb|ADZ42413.1| ribonuclease D [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 373

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 80/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  AR    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDSALQQVCEQARTHAHVALDTEFVRTRTYYPQLGLIQLYDGEKLSLIDPLP- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                     +L D    K  H G  D+ V    F +   P+  T++ +      +   G
Sbjct: 60  -ITQWQPFRELLQDVSVVKYLHAGSEDLEVFLNAFELMPTPMIDTQVLAAF-SGRSLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + EL G+ + K++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D
Sbjct: 118 FAMLVNELEGVELDKSESRTDWIARPLSEKQCDYAAADVFYLLPLASKLVEATEAAGRMD 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AAKDECELLCRR 189


>gi|283785541|ref|YP_003365406.1| ribonuclease D [Citrobacter rodentium ICC168]
 gi|282948995|emb|CBG88598.1| ribonuclease D [Citrobacter rodentium ICC168]
          Length = 377

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 81/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C A R   AIA+DTE +       +L ++QL  G+    I     
Sbjct: 1   MNYQMITTDDALATLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGERVALIDP--H 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GISDWSPLKAILRDTAITKYLHAGSEDLEVFLNAFGELPQPLIDTQILAAFCGRPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYTGVALDKSESRTDWLARPLTERQCEYAAADVWYLLPIAGKLMAETEAAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQQR 189


>gi|170770112|ref|ZP_02904565.1| ribonuclease D [Escherichia albertii TW07627]
 gi|170121069|gb|EDS90000.1| ribonuclease D [Escherichia albertii TW07627]
          Length = 375

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVRYLLPITTKLMAETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQIR 189


>gi|307825065|ref|ZP_07655286.1| ribonuclease D [Methylobacter tundripaludum SV96]
 gi|307733813|gb|EFO04669.1| ribonuclease D [Methylobacter tundripaludum SV96]
          Length = 389

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 82/191 (42%), Gaps = 10/191 (5%)

Query: 2   TTIRVHEGDIPAEC-----AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI 56
             I+      P +        +    +A+DTE L       + C++Q++  +    I  I
Sbjct: 3   NNIQYIN--TPDQLVKLCEQIKKEPWLALDTEFLREKTYYPKFCLLQIATPEWVACIDPI 60

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
           A    +   L   +      K+FH  R D+ + +   G    P+F T+IA+ L       
Sbjct: 61  ALPSLD--ILFEAIYSPSIVKVFHSCRQDLEIFYQLTGKLPEPLFDTQIAAPLLGFQE-N 117

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
            G    +  LL +N++KA   +DWS   L D ++QYAA DV++L  +     +KL  LGR
Sbjct: 118 PGYAMLVSSLLNVNLNKAHTRADWSKRPLIDAEIQYAADDVIYLCKIYQMMLQKLAELGR 177

Query: 177 SDLATSCCNFL 187
           ++        L
Sbjct: 178 AEWLERDFAEL 188


>gi|251789601|ref|YP_003004322.1| ribonuclease D [Dickeya zeae Ech1591]
 gi|247538222|gb|ACT06843.1| ribonuclease D [Dickeya zeae Ech1591]
          Length = 373

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + A CA A  V  +A+DTE +       +L ++QL  GD    I  +A 
Sbjct: 1   MNYQLITTDEGLSAVCAQACAVSEVALDTEFVRTRTYYPQLGLIQLYDGDNLSLIDPLA- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++      +L + +  K  H G  D+ V    FG    P   ++I +         +G
Sbjct: 60  -IRDWAPFRALLQNPQITKFLHAGSEDLEVFLNAFGCLPSPFIDSQILAAFLGKPL-SYG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + +   + + K++  +DW A  LS++Q QYAA+DV +L  +      + +  G  D
Sbjct: 118 FAALVADYRQVALDKSESRTDWLARPLSEKQCQYAAADVFYLLPVARTLVAETRAAGWLD 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AALDECRLLCQR 189


>gi|329296338|ref|ZP_08253674.1| ribonuclease D [Plautia stali symbiont]
          Length = 373

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 53/207 (25%), Positives = 87/207 (42%), Gaps = 11/207 (5%)

Query: 2   TTIRV--HEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               +  H   + A C  AR   A+A+DTE +       +L ++QL  G+  V I  +  
Sbjct: 1   MNYTLIDHNDQLAAVCQQARQHRAVALDTEFVRTRTYYPQLGLIQLFDGEQLVLIDPLT- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    + +L D +  K  H G  D+ V  + FG    P+  T+I +          G
Sbjct: 60  -ISDWAPFIALLQDRQLTKFLHAGGEDLEVFLHRFGCLPEPMIDTQILAAFAGQPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +     I + K++  +DW A  L++ Q QYAA+DV +L  +  Q   + +  G   
Sbjct: 118 FAAMVNHFNQIELDKSEARTDWLARPLTERQCQYAAADVAYLLPIAHQLVAQTEAAGNMA 177

Query: 179 LATSCCNFLMDRAELDL----LGWENV 201
            A S C  L  R  LD+      W ++
Sbjct: 178 AALSECATLCQR-RLDVLQPEEAWRDI 203


>gi|260598272|ref|YP_003210843.1| ribonuclease D [Cronobacter turicensis z3032]
 gi|260217449|emb|CBA31565.1| Ribonuclease D [Cronobacter turicensis z3032]
          Length = 409

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 75/174 (43%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE +       +L ++QL  G+    I  +            +L D+   
Sbjct: 55  ARTQRALALDTEFVRTRTYYPQLGLIQLYDGENVALIDPLT--ITEWAPFQALLQDQNIT 112

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    FG+   P   T++ +          G    ++   G+ + K++ 
Sbjct: 113 KFLHAGSEDLEVFQNAFGMMPDPFIDTQVLASFVGHPL-SCGFATLVEHHTGVALDKSES 171

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  L++ Q  YAA+DV +L  +  +  E+++  G    A + C  +  R
Sbjct: 172 RTDWLARPLTERQCDYAAADVWYLLPIAHKLMEQVREAGWLTAAINECRLMTQR 225


>gi|84624243|ref|YP_451615.1| ribonuclease D [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188576150|ref|YP_001913079.1| ribonuclease D [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84368183|dbj|BAE69341.1| ribonuclease D [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188520602|gb|ACD58547.1| ribonuclease D [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 363

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 51/189 (26%), Positives = 80/189 (42%), Gaps = 3/189 (1%)

Query: 6   VHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           +H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  
Sbjct: 6   IHPSELTDRLQAARPARIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA-- 63

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L   L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E
Sbjct: 64  LKEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQE 122

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L    R         
Sbjct: 123 VTGTLLTKGETRSDWMRRPLSPSQLEYAADDVRYLFAIHDELTRRLTEQNRLGWLAEDAE 182

Query: 186 FLMDRAELD 194
            L+   E D
Sbjct: 183 RLLATVEHD 191


>gi|254994696|ref|ZP_05276886.1| ribonuclease D (rnd) [Anaplasma marginale str. Mississippi]
          Length = 386

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLG-LMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
           A+      +++A+DTE +        RLC++Q++   G   ++ +   + +   L  +  
Sbjct: 18  AQILRDRPESLAIDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFD 76

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           DE   K+FH  R D+  L   F    RP+F T+ AS L   + N  G    +++ LG+ +
Sbjct: 77  DEGIYKVFHDCRQDLDALSQRFTRLPRPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKL 136

Query: 132 SKA-QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +K   +  DWS   LS+ +++YA  DV +LH L       L   GR          +
Sbjct: 137 NKLLFKRVDWSHRPLSEGKVRYALDDVTYLHELYEVLLGILTAKGRLTWFLEEMENI 193


>gi|153000417|ref|YP_001366098.1| ribonuclease D [Shewanella baltica OS185]
 gi|160875014|ref|YP_001554330.1| ribonuclease D [Shewanella baltica OS195]
 gi|217973594|ref|YP_002358345.1| ribonuclease D [Shewanella baltica OS223]
 gi|151365035|gb|ABS08035.1| ribonuclease D [Shewanella baltica OS185]
 gi|160860536|gb|ABX49070.1| ribonuclease D [Shewanella baltica OS195]
 gi|217498729|gb|ACK46922.1| ribonuclease D [Shewanella baltica OS223]
 gi|315267246|gb|ADT94099.1| ribonuclease D [Shewanella baltica OS678]
          Length = 369

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L D    K
Sbjct: 21  KQSKILVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLAQFWALLSDPNIIK 78

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 79  LVHSCSEDLEVFAHYGKCQPTPLFDSQIAA-SLCGMGHGVGYAKLVETCLGEVIDKGESR 137

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++L+ L  Q   KL   GR       
Sbjct: 138 TDWIRRPLTEAQLSYAANDVLYLYQLYPQLEAKLSAQGRLAWLYEE 183


>gi|126174091|ref|YP_001050240.1| ribonuclease D [Shewanella baltica OS155]
 gi|125997296|gb|ABN61371.1| ribonuclease D [Shewanella baltica OS155]
          Length = 369

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L D    K
Sbjct: 21  KQSKILVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLAQFWALLSDPNIVK 78

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 79  LVHSCSEDLEVFAHYGKCQPTPLFDSQIAA-SLCGMGHGVGYAKLVETCLGEVIDKGESR 137

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++L+ L  Q   KL   GR       
Sbjct: 138 TDWIRRPLTEAQLSYAANDVLYLYQLYPQLEAKLSAQGRLAWLYEE 183


>gi|219815966|gb|ACL37085.1| DNA polymerase I [uncultured bacterium]
          Length = 927

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 75/205 (36%), Gaps = 19/205 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +     AVDTET  L  R  R+  V  +   G    I I      AP           L
Sbjct: 345 LKAAPRFAVDTETTSLDYRLARIVGVSFALQAGEAFYIPIGHDYMGAPEQLDAQFVLDIL 404

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L +    KI  + ++D  V            F T +AS +      +HG+ D  +  
Sbjct: 405 KPILENPAIGKIGQHMKYDAHVFNNHGISLAGWAFDTMLASYVLNPTATRHGMDDLAQYY 464

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSD-- 178
           L    +  +Q +   A  L+  Q++      YAA D      L   F+++L ++ R +  
Sbjct: 465 LNYTTTTFEQIAGKGAKQLTFNQIELEKAAPYAAEDADITWRLYEHFSKELAKIPRLERL 524

Query: 179 LATSCCNFLMDRAELDLLGWENVDI 203
           L  +         E++  G   +DI
Sbjct: 525 LLDAEMPAAQVLYEMENNGI-RLDI 548


>gi|300863439|ref|ZP_07108394.1| putative DNA polymerase I [Oscillatoria sp. PCC 6506]
 gi|300338502|emb|CBN53536.1| putative DNA polymerase I [Oscillatoria sp. PCC 6506]
          Length = 597

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 87/183 (47%), Gaps = 4/183 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG-QKNAPNLVGMLVDEKR 75
                 I +DTET GL P  +R+ ++Q++     V I+ +AA        L  +L     
Sbjct: 31  LMKARVIGIDTETTGLDPLTERIRLIQIAAPQHPVIIVDLAALADSELSPLKALLNS-SA 89

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ-HGLKDNLKELLGINISKA 134
            K+F  G+FD  VL         P F   +AS++ R+   + H L+    E LGI + K+
Sbjct: 90  LKVFQNGKFDWQVLEMAGLRPSGPFFDVMLASQVLRSGLKKDHDLQSLTFEFLGIKLDKS 149

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELD 194
            QSS+++   LS  QL+YAA D   L  LR +   KL+  G  + A      +   A+++
Sbjct: 150 LQSSNFAGK-LSASQLEYAALDAAVLLKLRARLHSKLRSAGLLETAKIEFAAMPAVAQME 208

Query: 195 LLG 197
           L G
Sbjct: 209 LNG 211


>gi|256827062|ref|YP_003151021.1| ribonuclease D [Cryptobacterium curtum DSM 15641]
 gi|256583205|gb|ACU94339.1| ribonuclease D [Cryptobacterium curtum DSM 15641]
          Length = 399

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 83/173 (47%), Gaps = 3/173 (1%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
               +A+DTE L       RLC++Q+   D T+ +   A    +   L  +       KI
Sbjct: 36  DSSVLAIDTEFLREKTYYARLCLLQMQTDDETIIVDPFAV--SDLGVLAPLFQSSSIMKI 93

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
            H GR D+ +L    G+  +P+F T++A+     +T Q G    +  + G+ ++K    +
Sbjct: 94  VHSGRQDLEILNREVGLLPQPLFDTQVAA-ALLGHTQQIGYGSLVSAVCGVQLAKMDSFT 152

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
           DWS   LS  Q+ YAA DV++L  L    T++L+RLGR          L+D A
Sbjct: 153 DWSRRPLSASQISYAADDVIYLPQLYHTMTDELERLGRIHWLDPDFAALIDPA 205


>gi|238796317|ref|ZP_04639826.1| Ribonuclease D [Yersinia mollaretii ATCC 43969]
 gi|238719762|gb|EEQ11569.1| Ribonuclease D [Yersinia mollaretii ATCC 43969]
          Length = 395

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +L ++QL  G+    I  +            +L D    
Sbjct: 41  ARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP--ITEWQPFRELLQDLNVV 98

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F     P+  T++ +      +   G    + E  G+ + K++ 
Sbjct: 99  KYLHAGSEDLEVFLNAFDRMPTPMIDTQVLAAF-SGRSLSCGFAMLVNEFEGVELDKSES 157

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 158 RTDWIARPLSEKQCDYAAADVFYLLPLATKLVEATEAAGRMDAAKDECELLCRR 211


>gi|310767817|gb|ADP12767.1| ribonuclease D [Erwinia sp. Ejp617]
          Length = 369

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/181 (27%), Positives = 85/181 (46%), Gaps = 4/181 (2%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   C  AR V A+A+DTE +       RL ++QL  G+    I  +     +      +
Sbjct: 8   LSDVCLRARRVPALALDTEFVRTRTYYPRLGLIQLYDGETISLIDPLP--ITDWTPFRDL 65

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           L+D++  K  H G  D+ V  + FGV  +P+  T+I +          G    ++   GI
Sbjct: 66  LLDQQVIKYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAF-SGRPLSCGFATIVESFTGI 124

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            + K++  +DW A  LS++Q +YAA+DV +L  +  +  ++ +  G+   A   C  L  
Sbjct: 125 ALDKSESRTDWLARPLSEKQCRYAAADVFYLLPIASKLVDETEAAGQMAAALDECRLLCQ 184

Query: 190 R 190
           R
Sbjct: 185 R 185


>gi|261209844|ref|ZP_05924146.1| ribonuclease D [Vibrio sp. RC341]
 gi|260841142|gb|EEX67662.1| ribonuclease D [Vibrio sp. RC341]
          Length = 398

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 27  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVM- 85

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 86  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 143

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  + 
Sbjct: 144 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWEA 203

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 204 ALQESELQVAKRTKVSNPELAYLDIKG 230


>gi|259908266|ref|YP_002648622.1| ribonuclease D [Erwinia pyrifoliae Ep1/96]
 gi|224963888|emb|CAX55391.1| Ribonuclease D [Erwinia pyrifoliae Ep1/96]
 gi|283478197|emb|CAY74113.1| rnd [Erwinia pyrifoliae DSM 12163]
          Length = 369

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/181 (27%), Positives = 85/181 (46%), Gaps = 4/181 (2%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   C  AR V A+A+DTE +       RL ++QL  G+    I  +     +      +
Sbjct: 8   LSDVCLRARRVPALALDTEFVRTRTYYPRLGLIQLYDGETISLIDPLP--ITDWTPFRDL 65

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           L+D++  K  H G  D+ V  + FGV  +P+  T+I +          G    ++   GI
Sbjct: 66  LLDQQVIKYLHAGSEDLEVFQHEFGVLPQPMIDTQILAAF-SGRPLSCGFATIVESFTGI 124

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            + K++  +DW A  LS++Q +YAA+DV +L  +  +  ++ +  G+   A   C  L  
Sbjct: 125 ALDKSESRTDWLARPLSEKQCRYAAADVFYLLPIASKLVDETEAAGQMAAALDECRLLCQ 184

Query: 190 R 190
           R
Sbjct: 185 R 185


>gi|253698875|ref|YP_003020064.1| 3'-5' exonuclease [Geobacter sp. M21]
 gi|251773725|gb|ACT16306.1| 3'-5' exonuclease [Geobacter sp. M21]
          Length = 377

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 72/171 (42%), Gaps = 4/171 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A D E   L    +++C++Q+S       I  +A    +   L  +  +   +
Sbjct: 29  LSRESVLAFDLEADSLHHYTEKVCLIQVSSASEDRLIDPLAPI--DVKVLAPIFANPAIK 86

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KIFH   +D+  L+  FG+ V  +F T IAS+         GL   LK+  G+ + K  Q
Sbjct: 87  KIFHGADYDMRSLYRDFGIEVVNLFDTMIASQFLGESEF--GLAALLKKRFGVELDKRYQ 144

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DWS    S E L YA  D   L  L  Q   +L++ GR          +
Sbjct: 145 KADWSKRPFSQEMLDYAMKDTSLLIELYRQLEAELKQKGRLAWVEEESELV 195


>gi|315180685|gb|ADT87599.1| ribonuclease D [Vibrio furnissii NCTC 11218]
          Length = 371

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/208 (24%), Positives = 86/208 (41%), Gaps = 15/208 (7%)

Query: 2   TTIRVHE--GDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++ +   D+   C+  R  D + +DTE +       +L ++QL  G+    I  +A 
Sbjct: 1   MNYQIIDQLNDLERVCSLARDADVVMLDTEFVRTRTFYPQLGLIQLFDGENLSLIDPLAM 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                   V +L D    K+ H    DI V   +FG    P+  T+I +          G
Sbjct: 61  --DEMTPFVELLQDTSVLKVLHACGEDIEVFKTSFGCVPFPMVDTQIMAAFLGYGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
                 +LL + + K++  +DW A  LS +QL+YAA+DV +L  +  Q  EK+ + G  +
Sbjct: 118 FAALAHDLLNVELDKSESRTDWLARPLSQKQLEYAAADVFYLMPMYEQLLEKVTQAGWWE 177

Query: 179 LATSCCNFL---------MDRAELDLLG 197
            A                 +   LD+ G
Sbjct: 178 AAQQESELQVEKRTRTTDPEMVYLDIKG 205


>gi|226329911|ref|ZP_03805429.1| hypothetical protein PROPEN_03824 [Proteus penneri ATCC 35198]
 gi|225200706|gb|EEG83060.1| hypothetical protein PROPEN_03824 [Proteus penneri ATCC 35198]
          Length = 372

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C AA     IA+DTE + +      L ++Q+  G     I  +A 
Sbjct: 1   MNYQLITTDTALDTACKAASEASQIALDTEFVRIRTYYPHLGLIQMYDGKQISLIDPLA- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             K+    V +L ++   K  H G  D+ V  + FG    P+  T++ +          G
Sbjct: 60  -IKDWTPFVELLTNQGIMKFLHAGSEDLEVFSHQFGCVPTPMIDTQVVAAFLGHPI-SCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +++   + + K++  +DW A  L+++Q QYA+ DV +L  L  +  ++ +  G  D
Sbjct: 118 FATLVEKYENVALDKSESRTDWLARPLTEKQCQYASGDVFYLLPLAEKLIKEAEEAGYMD 177

Query: 179 LATSCCNFLMDR 190
                C  + +R
Sbjct: 178 AIADECEMIAER 189


>gi|121729927|ref|ZP_01682350.1| ribonuclease D [Vibrio cholerae V52]
 gi|121628334|gb|EAX60840.1| ribonuclease D [Vibrio cholerae V52]
          Length = 350

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 86/208 (41%), Gaps = 15/208 (7%)

Query: 2   TTIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I     
Sbjct: 1   MNYQIISQVGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                   V +L D    K+ H    D+ V    FG    P+  T+I +          G
Sbjct: 61  --DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D
Sbjct: 118 FAALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWD 177

Query: 179 LATSCCNFL---------MDRAELDLLG 197
            A                 + A LD+ G
Sbjct: 178 AALQESELQVAKRTKVSNPELAYLDIKG 205


>gi|114562909|ref|YP_750422.1| ribonuclease D [Shewanella frigidimarina NCIMB 400]
 gi|114334202|gb|ABI71584.1| ribonuclease D [Shewanella frigidimarina NCIMB 400]
          Length = 370

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 74/187 (39%), Gaps = 8/187 (4%)

Query: 1   MTTIRVHEGDIPAECAA----RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRI 56
           M T      D  +  +     +    + +DTE +       +L ++Q   G     I  +
Sbjct: 1   MLTFEYISDD-ASLLSLVEQYQQSTLLVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPV 59

Query: 57  AAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
           A    +      +L D+   K+ H    D+ V  +    +  P+F ++IA+         
Sbjct: 60  A--ITDLSPFWQLLTDQNIVKLVHSCSEDLEVFAHYGECQPSPLFDSQIAASFAGLGHGL 117

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
              K  +   L + I K +  +DW    LSD QLQYAA+DV +L+ L  Q  +KL    R
Sbjct: 118 GYAK-LVDACLQVEIDKGESRTDWMNRPLSDAQLQYAANDVFYLYQLYPQLQQKLAADNR 176

Query: 177 SDLATSC 183
            +     
Sbjct: 177 VEWLFEE 183


>gi|156973677|ref|YP_001444584.1| ribonuclease D [Vibrio harveyi ATCC BAA-1116]
 gi|156525271|gb|ABU70357.1| hypothetical protein VIBHAR_01380 [Vibrio harveyi ATCC BAA-1116]
          Length = 382

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 80/188 (42%), Gaps = 6/188 (3%)

Query: 3   TIRVH--EGDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   CA  R  D + +DTE + +     +L ++QL  G     I      
Sbjct: 12  NYQIITKNKDLEEVCALAREADVVMLDTEFVRIRTYYPQLGLIQLFDGKQLSLIDPTEL- 70

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  + V +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 71  -TDMTSFVELLKDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 128

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  + 
Sbjct: 129 ATLVEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLMPLYEKLLDKVNEAGWWEA 188

Query: 180 ATSCCNFL 187
                + L
Sbjct: 189 VQQESDLL 196


>gi|255745267|ref|ZP_05419216.1| ribonuclease D [Vibrio cholera CIRS 101]
 gi|262155992|ref|ZP_06029112.1| ribonuclease D [Vibrio cholerae INDRE 91/1]
 gi|255737097|gb|EET92493.1| ribonuclease D [Vibrio cholera CIRS 101]
 gi|262030170|gb|EEY48814.1| ribonuclease D [Vibrio cholerae INDRE 91/1]
          Length = 373

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 86/208 (41%), Gaps = 15/208 (7%)

Query: 2   TTIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I     
Sbjct: 1   MNYQIISQVGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                   V +L D    K+ H    D+ V    FG    P+  T+I +          G
Sbjct: 61  --DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D
Sbjct: 118 FAALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWD 177

Query: 179 LATSCCNFL---------MDRAELDLLG 197
            A                 + A LD+ G
Sbjct: 178 AALQESELQVAKRTKVSNPELAYLDIKG 205


>gi|148266297|ref|YP_001233003.1| 3'-5' exonuclease [Geobacter uraniireducens Rf4]
 gi|146399797|gb|ABQ28430.1| 3'-5' exonuclease [Geobacter uraniireducens Rf4]
          Length = 409

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 77/176 (43%), Gaps = 5/176 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A D E   L    +++C++Q+S    T  I  +A    +   L  +L +    
Sbjct: 52  LNTETTLAFDLEADSLHHYTEKVCLIQVSTNSETALIDPLAP--LDLSPLAPILANPAVR 109

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH   +D+  L+  FG  VR +F T IAS+         GL   LK+  G+ + K  Q
Sbjct: 110 KVFHGADYDMRSLYRDFGFEVRNLFDTMIASQFLGEKEV--GLAAALKKRFGVELDKKYQ 167

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-MDRA 191
            +DWS    S + ++YA  D   L  L LQ  ++L+  GR          +   RA
Sbjct: 168 KADWSKRPFSPQMIEYAMKDTSLLIKLYLQLEDELRAKGRLAWVEEESEIVSCVRA 223


>gi|187733914|ref|YP_001880596.1| ribonuclease D [Shigella boydii CDC 3083-94]
 gi|187430906|gb|ACD10180.1| ribonuclease D [Shigella boydii CDC 3083-94]
          Length = 375

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I S          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|170726464|ref|YP_001760490.1| ribonuclease D [Shewanella woodyi ATCC 51908]
 gi|169811811|gb|ACA86395.1| ribonuclease D [Shewanella woodyi ATCC 51908]
          Length = 369

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/186 (22%), Positives = 74/186 (39%), Gaps = 6/186 (3%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M   +  + D  +    +  R    + +DTE +       RL ++Q   G     I  +A
Sbjct: 1   MLAFQYIDDDASLAKLVSQYRESQLLVLDTEFVRTRTFYARLGLIQAYDGKTLALIDPVA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               +      +L +     I H    D+ V       +   +F ++IA+     + +  
Sbjct: 61  V--SDLSGFWSLLTEPSITTILHSCSEDLEVFARNGQCQPVKLFDSQIAA-ALCGFGHGL 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    +++ L I + K +  +DW    LS+ QL YAA+DV +L+ L  Q  EKL+   R 
Sbjct: 118 GYAKLVEQTLNIPLDKGESRTDWMKRPLSEAQLNYAANDVYYLYQLYPQLVEKLEEQNRL 177

Query: 178 DLATSC 183
                 
Sbjct: 178 GWVFEE 183


>gi|317048442|ref|YP_004116090.1| ribonuclease D [Pantoea sp. At-9b]
 gi|316950059|gb|ADU69534.1| ribonuclease D [Pantoea sp. At-9b]
          Length = 373

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/196 (26%), Positives = 84/196 (42%), Gaps = 7/196 (3%)

Query: 2   TTIRVH-EGD-IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               +  + D + A C  AR   A+A+DTE +       +L ++QL  G+  V I  +  
Sbjct: 1   MNYSLIDQNDQLAAVCDKARQHSAVALDTEFVRTRTYYPQLGLIQLFDGEQLVLIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    V +L D +  K  H G  D+ V  + FG    P+  T+I +          G
Sbjct: 59  NISDWAPFVALLRDTQVTKFLHAGGEDLEVFLHRFGCLPDPMVDTQILAAFAGQPL-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +     I + K++  +DW A  L+  Q +YAA+DV +L  +  Q   + +  G   
Sbjct: 118 FAAMVMHFNQIELDKSEARTDWLARPLTARQCEYAAADVAYLLPIAHQLVAQTEAAGHMA 177

Query: 179 LATSCCNFLMDRAELD 194
            A S C+ L  R  LD
Sbjct: 178 AALSECDILCQR-RLD 192


>gi|294666468|ref|ZP_06731711.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292603774|gb|EFF47182.1| ribonuclease D [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 363

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 85/200 (42%), Gaps = 4/200 (2%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  L
Sbjct: 7   HPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA--L 64

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L+     K+ H    D+       G   RP+F T+IA+ L          K  ++E+
Sbjct: 65  KEWLIATDIVKVMHSASEDLVTFKCACGALPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 123

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL-ATSCCN 185
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L   GR +  A     
Sbjct: 124 TGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELTRRLTEQGRLEWQAEDAER 183

Query: 186 FLMDRAELDLLGWENVDIFS 205
            L      D   W +V + +
Sbjct: 184 LLATVEHDDGERWPHVSLRA 203


>gi|82543793|ref|YP_407740.1| ribonuclease D [Shigella boydii Sb227]
 gi|81245204|gb|ABB65912.1| RNase D [Shigella boydii Sb227]
          Length = 375

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I S          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|205357935|ref|ZP_02574364.2| ribonuclease D [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205328669|gb|EDZ15433.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|323130091|gb|ADX17521.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
          Length = 390

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 82/191 (42%), Gaps = 6/191 (3%)

Query: 3   TIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++ E D  + + C A R   AIA+DTE +       +L ++QL  G     I  +  G
Sbjct: 17  NYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--G 74

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +   L  +L D    K  H G  D+ V    FG    P+  T+I +          G 
Sbjct: 75  ISDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGF 133

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E  G+ + K++  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    
Sbjct: 134 ASMVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPA 193

Query: 180 ATSCCNFLMDR 190
           A   C  +  R
Sbjct: 194 ALDECRLMQQR 204


>gi|117620631|ref|YP_856729.1| ribonuclease D [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117562038|gb|ABK38986.1| ribonuclease D [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 379

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 74/193 (38%), Gaps = 6/193 (3%)

Query: 2   TTIRVH--EGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              ++   + ++    A+     +A+DTE +       +L + Q+  G+    +      
Sbjct: 10  MHYQLISQQAELDQYLASLADVPLAIDTEFVRTRTYYPQLGLFQIYDGEHLALLDP---L 66

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  +L   L    +  I H    D+ ++ +  G     +  T++A+          G 
Sbjct: 67  TLDLSSLWQRLGRAGQIAILHASGEDLELIQHQAGHLPNQMHDTQLAAAFLGYGV-SVGF 125

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + E L + + K Q  +DW A  L+  QL+YAA+DV +L  L  +   KL   G+   
Sbjct: 126 GALVNEFLAVELEKDQARTDWLARPLTPRQLEYAAADVFYLLPLYEKVMAKLHESGKFAW 185

Query: 180 ATSCCNFLMDRAE 192
               C     R  
Sbjct: 186 FEQECQNHSARKT 198


>gi|294141241|ref|YP_003557219.1| ribonuclease D [Shewanella violacea DSS12]
 gi|293327710|dbj|BAJ02441.1| ribonuclease D [Shewanella violacea DSS12]
          Length = 369

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 75/186 (40%), Gaps = 6/186 (3%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M      E D  + A  +  R  D + +DTE +        L ++Q   G     I  +A
Sbjct: 1   MLAFEYIEDDASLTALVSQYRQSDLLVLDTEFVRTRTYYANLGLIQAYDGKTLALIDPVA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
                      +L +     + H    D+ V       +   +F ++IA+     + +  
Sbjct: 61  INN--LSEFWSLLTEPGITTVLHSCSEDLEVFARNGACQPYNLFDSQIAA-ALCGFGHGL 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    +++ L I++ K +  +DW    LS+ QL YAA+DV +L+ L  Q  EKLQ  GR 
Sbjct: 118 GYAKLVEQTLDISLDKGESRTDWMKRPLSEAQLNYAANDVYYLYNLYPQLLEKLQEQGRL 177

Query: 178 DLATSC 183
                 
Sbjct: 178 AWLFEE 183


>gi|218779802|ref|YP_002431120.1| 3'-5' exonuclease [Desulfatibacillum alkenivorans AK-01]
 gi|218761186|gb|ACL03652.1| 3'-5' exonuclease [Desulfatibacillum alkenivorans AK-01]
          Length = 388

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 7/188 (3%)

Query: 3   TIRVHEGD--IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              + + D  +     + +    IAVD E   +   +++ C++Q+   +G   I+     
Sbjct: 14  DFVLVDNDNALADLTQSLQSQKCIAVDLEADSMFHYQEKACLLQI-TSNGLNYIVDPLCD 72

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +   L  +L +++ +KIFH   +D+  LF  FG+ +  +F T++A+R       Q GL
Sbjct: 73  C-DVKALAPILENDEIQKIFHGADYDVRCLFRDFGIELHNLFDTQVAARFLGEP--QTGL 129

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              L+   G+ + K  Q  +WS   L  E + YAA+D VHL  L     ++L    R   
Sbjct: 130 APLLESRFGVQLEKKYQKKNWSLRPLPPEMMAYAANDTVHLLELAEILKKELVEKDRLFW 189

Query: 180 ATSCCNFL 187
               C  L
Sbjct: 190 VEEECEIL 197


>gi|225629620|ref|ZP_03787627.1| 3'-5' exonuclease [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591525|gb|EEH12558.1| 3'-5' exonuclease [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 135

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 90/133 (67%)

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
              KIFH+ RFD++++ Y       P +CTKIASRL RTYT+ H LK+   ELL   ++K
Sbjct: 1   NITKIFHFARFDVSIIRYYLETWALPCYCTKIASRLVRTYTDNHSLKELCLELLDTKLNK 60

Query: 134 AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            QQSSDW  ++L+D+Q  YAASDV++LH ++ +    L+R  R +LA  C  FL  R EL
Sbjct: 61  QQQSSDWGDENLTDKQKSYAASDVLYLHRIKEKLDLMLERENRKELAQKCFEFLPTRIEL 120

Query: 194 DLLGWENVDIFSH 206
           DL+GWENVDIF+H
Sbjct: 121 DLMGWENVDIFNH 133


>gi|323499349|ref|ZP_08104325.1| ribonuclease D [Vibrio sinaloensis DSM 21326]
 gi|323315534|gb|EGA68569.1| ribonuclease D [Vibrio sinaloensis DSM 21326]
          Length = 371

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 79/190 (41%), Gaps = 12/190 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+    I       ++    V +L D    
Sbjct: 19  ARESDVVMLDTEFVRTRTFYPQLGLIQLFDGEHLSLIDPTEL--EDMTAFVQLLQDTSVL 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V   +FG    P+  T++ +          G    +   L + + K++ 
Sbjct: 77  KVLHACGEDLEVFHNSFGCLPYPMVDTQLMAAFLGHGL-STGFAALVDHYLQVELDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL--------- 187
            +DW A  L+D+QL YAA+DV +L  L  +    +   G  + A    + L         
Sbjct: 136 RTDWLARPLTDKQLDYAAADVFYLWPLYEKLLAAVTEAGWWEAAQQESDLLASKRIKNVD 195

Query: 188 MDRAELDLLG 197
            + A LD+ G
Sbjct: 196 PELAYLDVKG 205


>gi|156933634|ref|YP_001437550.1| ribonuclease D [Cronobacter sakazakii ATCC BAA-894]
 gi|156531888|gb|ABU76714.1| hypothetical protein ESA_01456 [Cronobacter sakazakii ATCC BAA-894]
          Length = 369

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 75/174 (43%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE +       +L ++QL  G+    I  +     +      +L D+   
Sbjct: 15  ARTQRALALDTEFVRTRTYYPQLGLIQLYDGENVALIDPLT--ITDWAPFQALLQDQNVT 72

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F +   P   T++ +          G    ++   G+ + K++ 
Sbjct: 73  KFLHAGSEDLEVFQNAFSMMPDPFIDTQVLASFVGHPL-SCGFATLVEHHTGVVLDKSES 131

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  L++ Q  YAA+DV +L  +  +  E+++  G    A + C  +  R
Sbjct: 132 RTDWLARPLTERQCDYAAADVWYLLPIAHKLMEQVREAGWLTAAINECRLMTQR 185


>gi|90415433|ref|ZP_01223367.1| putative DNA polymerase I [marine gamma proteobacterium HTCC2207]
 gi|90332756|gb|EAS47926.1| putative DNA polymerase I [marine gamma proteobacterium HTCC2207]
          Length = 926

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 71/213 (33%), Gaps = 19/213 (8%)

Query: 4   IRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN 62
           I + E D+       +  D +AVDTET  L   R +L  + LS   G    I  A     
Sbjct: 330 IVLTEQDLATWIEKIKSADLVAVDTETTSLDYMRAKLVGISLSTAPGEACYIPFAHDYMG 389

Query: 63  AP----------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT 112
           AP           L   L D    K+    ++D++VL           F T + S +  +
Sbjct: 390 APEQLQPEFALEKLKPYLEDPAFPKVGQNLKYDMSVLAQHGISLRGITFDTMLESYVLDS 449

Query: 113 YTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQ 166
             ++H +       LG    K    +   A  L+  Q+       YAA D      L   
Sbjct: 450 VASRHDMDSLALNYLGEETIKFADVAGKGAAQLTFNQVALDQAGPYAAEDADITLRLHQT 509

Query: 167 FTEKLQRLG-RSDLATS-CCNFLMDRAELDLLG 197
              ++      + +        +   + ++  G
Sbjct: 510 LWPRVAAEPTLTKVFEEIELPLVPVLSRIERTG 542


>gi|57340046|gb|AAW50010.1| hypothetical protein FTT0776 [synthetic construct]
          Length = 399

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 42  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 99

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 100 KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 158

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL YA  DV +L  L+    ++L +    D      
Sbjct: 159 FSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 206


>gi|302037758|ref|YP_003798080.1| ribonuclease D [Candidatus Nitrospira defluvii]
 gi|300605822|emb|CBK42155.1| Ribonuclease D [Candidatus Nitrospira defluvii]
          Length = 401

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 87/185 (47%), Gaps = 5/185 (2%)

Query: 8   EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN- 65
           +  + A C    +   IA+DTE +G      RL ++Q++  +G   +I   A Q+ AP  
Sbjct: 14  DDALDALCDQLIHSSVIAIDTEFMGEEHFIPRLELIQVA-AEGVAAVIDFPAVQEAAPMA 72

Query: 66  -LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
               ++ D + EK+ H GR D+ +  +  G   +P F T+IA+ +      Q    + ++
Sbjct: 73  RFWEIVCDARIEKVLHAGRQDLELFAHHAGRLPKPFFDTQIAAAMVGYGA-QTAYANLVQ 131

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            + G+ + KA   ++WS   LS EQL YA  DV  L  +     +KL  +GRS+      
Sbjct: 132 RVQGVKLDKAHTFTNWSQRPLSREQLVYALDDVTFLLPVHRHLRQKLSVMGRSEWVDEEF 191

Query: 185 NFLMD 189
             L  
Sbjct: 192 ARLEV 196


>gi|89897107|ref|YP_520594.1| hypothetical protein DSY4361 [Desulfitobacterium hafniense Y51]
 gi|89336555|dbj|BAE86150.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 578

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/202 (26%), Positives = 88/202 (43%), Gaps = 7/202 (3%)

Query: 2   TTIR--VHEGDI-PAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
             I+  +H  D+ P          IAVDTET GL P   +L ++QL+  D  V +I   +
Sbjct: 1   MDIKRILHPADLVPYMEKLTAAKVIAVDTETTGLDPHTCQLRLIQLAAEDLPVLVIDCFS 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY--TNQ 116
                  L+  ++     KIF   +FD+  L     +    +F T +AS+L R      Q
Sbjct: 61  FLPEGRELINAILSTSGIKIFQNAKFDLQFLM-ALDIFPPTLFDTMLASQLLRGSGGPVQ 119

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGR 176
             LK   +  L  ++ K +Q+S+W  + L++ Q+ YAA D   L  LR     ++     
Sbjct: 120 SNLKALAQHYLNEDLDKEEQTSNWQGE-LTESQILYAARDAEILLRLRKVMIPQILENHL 178

Query: 177 SDLATSCCNFLMDRAELDLLGW 198
           + +A      +   A L+  G 
Sbjct: 179 TQIAGIEFRCVKAMAHLEYRGI 200


>gi|262276193|ref|ZP_06054002.1| ribonuclease D [Grimontia hollisae CIP 101886]
 gi|262220001|gb|EEY71317.1| ribonuclease D [Grimontia hollisae CIP 101886]
          Length = 405

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 80/171 (46%), Gaps = 3/171 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR V A+ +DTE +       RL ++QL  G+    I  I     +   L G+L DE   
Sbjct: 50  ARQVPAVMLDTEFVRTRTLYPRLGLIQLYDGETLSLIDPIEL--DDLSPLWGLLTDESVV 107

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V ++  G    P+  T+I +          G    ++E L + + K + 
Sbjct: 108 KVLHACSEDLEVFYHYAGAMPTPMVDTQIMAAFLGHGL-STGFASLVEEYLVVTLDKGEA 166

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DW A  LS++QL+YAA+DV +L  L  + ++++   G  +     C  +
Sbjct: 167 RTDWCARPLSEKQLEYAAADVYYLLPLYNELSKRVSAAGWDEAVKQECALM 217


>gi|260855663|ref|YP_003229554.1| ribonuclease D [Escherichia coli O26:H11 str. 11368]
 gi|257754312|dbj|BAI25814.1| ribonuclease D [Escherichia coli O26:H11 str. 11368]
          Length = 375

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|288870561|ref|ZP_06409803.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
 gi|288866720|gb|EFC99018.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
          Length = 653

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 63/202 (31%), Positives = 90/202 (44%), Gaps = 11/202 (5%)

Query: 10  DI-PAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ P     +    +A+DTET GL P  DRL ++Q+S     V +I  AA   +    + 
Sbjct: 85  DLTPYFHTVKEAPLLAIDTETTGLDPHSDRLRLIQISAPGIPVLVIDCAAFLPDGFACLK 144

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY--TNQHGLKDNLKEL 126
            L++   EKIFH  RFD+  L    G+   PVF T +A++L R      + GL       
Sbjct: 145 ELLNTPSEKIFHNARFDLQFLM-GIGIDCFPVFDTMLAAQLLRPCGGPLKAGLAVVADHY 203

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
           LGI + K +Q+  W +  L+  QL YAA D   L  L       L R G    A+     
Sbjct: 204 LGIKLDKTEQTGSWDSASLTGSQLAYAALDAWILLKLYDVMNPLLARHGLGRTASIEFAC 263

Query: 187 LMDRAE-------LDLLGWENV 201
           +   A        LDL  W+ +
Sbjct: 264 VSAIARTEYDGINLDLEKWDEL 285


>gi|238782530|ref|ZP_04626561.1| Ribonuclease D [Yersinia bercovieri ATCC 43970]
 gi|238716457|gb|EEQ08438.1| Ribonuclease D [Yersinia bercovieri ATCC 43970]
          Length = 395

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +L ++QL  G+    I  +            +L D    
Sbjct: 41  ARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP--ITEWQPFRELLQDLAVV 98

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F     P+  T++ +      +   G    + E  G+ + K++ 
Sbjct: 99  KYLHAGSEDLEVFLNAFDRMPTPMIDTQVLAAF-SGRSLSCGFAMLVNEFEGVELDKSES 157

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 158 RTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAKDECQLLCRR 211


>gi|260768989|ref|ZP_05877923.1| ribonuclease D [Vibrio furnissii CIP 102972]
 gi|260617019|gb|EEX42204.1| ribonuclease D [Vibrio furnissii CIP 102972]
          Length = 397

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++ +   D+   C+  R  D + +DTE +       +L ++QL  G+    I  +A  
Sbjct: 28  NYQIIDQLNDLERVCSLARDADVVMLDTEFVRTRTFYPQLGLIQLFDGENLSLIDPLAM- 86

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    DI V   +FG    P+  T+I +          G 
Sbjct: 87  -DEMTPFVELLQDTSVLKVLHACGEDIEVFKTSFGCVPFPMVDTQIMAAFLGYGL-STGF 144

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
                +LL + + K++  +DW A  LS +QL+YAA+DV +L  +  Q  EK+ + G  + 
Sbjct: 145 AALAHDLLNVELDKSESRTDWLARPLSQKQLEYAAADVFYLMPMYEQLLEKVTQAGWWEA 204

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 +   LD+ G
Sbjct: 205 AQQESELQVEKRTRTTDPEMVYLDIKG 231


>gi|39995551|ref|NP_951502.1| ribonuclease D [Geobacter sulfurreducens PCA]
 gi|39982314|gb|AAR33775.1| ribonuclease D, putative [Geobacter sulfurreducens PCA]
          Length = 381

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 5/176 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A D E   +   ++++C++Q +       +  +AA   +   L  +  +    
Sbjct: 24  LGSEPIVACDLEADSMHHYQEKVCLIQFAVPGYAAIVDPLAA--PDISPLAPLFANAAIR 81

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH   +DI  L   FG+ V  +F T IA +L        GL   L++  G+ + K  Q
Sbjct: 82  KVFHGADYDIRSLHRDFGIEVNNLFDTMIACQLLGEREF--GLAAQLRKRFGVELDKQYQ 139

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-MDRA 191
            +DWS   L+   ++YA  D   L  L  Q   +L+  GR       C  L   R 
Sbjct: 140 RADWSRRPLTVGMIEYAVKDTTLLIELYRQLVAELEEKGRRGWVEEECELLSRVRV 195


>gi|331005546|ref|ZP_08328920.1| Ribonuclease D [gamma proteobacterium IMCC1989]
 gi|330420648|gb|EGG94940.1| Ribonuclease D [gamma proteobacterium IMCC1989]
          Length = 383

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 85/186 (45%), Gaps = 6/186 (3%)

Query: 3   TIRVHEGD--IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
           T +  + D  +   C +     AIA+DTE +        + ++Q++  +G   I  +A  
Sbjct: 17  TYQWIDSDVALADLCQSLSTQSAIALDTEFVRTRTYYPHIGLLQIADENGVYLIDPLA-- 74

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +   +  +L +    K+ H    D+ V  Y FGV    +F T++A+      +   G 
Sbjct: 75  ISDTQPMADVLQNPAIVKVVHACSEDLEVFQYAFGVLPESLFDTQVAAGFAGYGS-SIGY 133

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
            + L+E+  I+I K +  SDW    LSD QL+YAA DV +L  +     EKLQ+  R   
Sbjct: 134 ANLLREIKRIDIPKQETRSDWLQRPLSDAQLRYAALDVEYLLEIYRGLVEKLQQQQRLLW 193

Query: 180 ATSCCN 185
             + C 
Sbjct: 194 VEADCQ 199


>gi|260868323|ref|YP_003234725.1| ribonuclease D [Escherichia coli O111:H- str. 11128]
 gi|257764679|dbj|BAI36174.1| ribonuclease D [Escherichia coli O111:H- str. 11128]
          Length = 375

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|26248062|ref|NP_754102.1| ribonuclease D [Escherichia coli CFT073]
 gi|91211019|ref|YP_541005.1| ribonuclease D [Escherichia coli UTI89]
 gi|215487015|ref|YP_002329446.1| ribonuclease D [Escherichia coli O127:H6 str. E2348/69]
 gi|218558666|ref|YP_002391579.1| ribonuclease D [Escherichia coli S88]
 gi|218689740|ref|YP_002397952.1| ribonuclease D [Escherichia coli ED1a]
 gi|26108465|gb|AAN80667.1|AE016761_242 Ribonuclease D [Escherichia coli CFT073]
 gi|91072593|gb|ABE07474.1| ribonuclease D [Escherichia coli UTI89]
 gi|215265087|emb|CAS09475.1| ribonuclease D [Escherichia coli O127:H6 str. E2348/69]
 gi|218365435|emb|CAR03162.1| ribonuclease D [Escherichia coli S88]
 gi|218427304|emb|CAR08103.1| ribonuclease D [Escherichia coli ED1a]
 gi|294489955|gb|ADE88711.1| ribonuclease D [Escherichia coli IHE3034]
          Length = 375

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|15831767|ref|NP_310540.1| ribonuclease D [Escherichia coli O157:H7 str. Sakai]
 gi|157156075|ref|YP_001463104.1| ribonuclease D [Escherichia coli E24377A]
 gi|187776027|ref|ZP_02799888.2| ribonuclease D [Escherichia coli O157:H7 str. EC4196]
 gi|188024852|ref|ZP_02774388.2| ribonuclease D [Escherichia coli O157:H7 str. EC4113]
 gi|189010430|ref|ZP_02807242.2| ribonuclease D [Escherichia coli O157:H7 str. EC4076]
 gi|189402540|ref|ZP_02783120.2| ribonuclease D [Escherichia coli O157:H7 str. EC4401]
 gi|189403490|ref|ZP_02795783.2| ribonuclease D [Escherichia coli O157:H7 str. EC4486]
 gi|189404421|ref|ZP_02789258.2| ribonuclease D [Escherichia coli O157:H7 str. EC4501]
 gi|189405084|ref|ZP_02813223.2| ribonuclease D [Escherichia coli O157:H7 str. EC869]
 gi|189406051|ref|ZP_02826040.2| ribonuclease D [Escherichia coli O157:H7 str. EC508]
 gi|191168835|ref|ZP_03030609.1| ribonuclease D [Escherichia coli B7A]
 gi|193066361|ref|ZP_03047410.1| ribonuclease D [Escherichia coli E22]
 gi|193071290|ref|ZP_03052209.1| ribonuclease D [Escherichia coli E110019]
 gi|194430003|ref|ZP_03062510.1| ribonuclease D [Escherichia coli B171]
 gi|208810493|ref|ZP_03252369.1| ribonuclease D [Escherichia coli O157:H7 str. EC4206]
 gi|208816683|ref|ZP_03257803.1| ribonuclease D [Escherichia coli O157:H7 str. EC4045]
 gi|208818758|ref|ZP_03259078.1| ribonuclease D [Escherichia coli O157:H7 str. EC4042]
 gi|209396542|ref|YP_002270881.1| ribonuclease D [Escherichia coli O157:H7 str. EC4115]
 gi|209919169|ref|YP_002293253.1| ribonuclease D [Escherichia coli SE11]
 gi|217328853|ref|ZP_03444934.1| ribonuclease D [Escherichia coli O157:H7 str. TW14588]
 gi|218554376|ref|YP_002387289.1| ribonuclease D [Escherichia coli IAI1]
 gi|218695366|ref|YP_002403033.1| ribonuclease D [Escherichia coli 55989]
 gi|218705302|ref|YP_002412821.1| ribonuclease D [Escherichia coli UMN026]
 gi|254793426|ref|YP_003078263.1| ribonuclease D [Escherichia coli O157:H7 str. TW14359]
 gi|260844148|ref|YP_003221926.1| ribonuclease D [Escherichia coli O103:H2 str. 12009]
 gi|291282984|ref|YP_003499802.1| Ribonuclease D [Escherichia coli O55:H7 str. CB9615]
 gi|293446176|ref|ZP_06662598.1| ribonuclease D [Escherichia coli B088]
 gi|332279045|ref|ZP_08391458.1| ribonuclease D [Shigella sp. D9]
 gi|13361980|dbj|BAB35936.1| RNase D, processes tRNA precursor [Escherichia coli O157:H7 str.
           Sakai]
 gi|157078105|gb|ABV17813.1| ribonuclease D [Escherichia coli E24377A]
 gi|187769404|gb|EDU33248.1| ribonuclease D [Escherichia coli O157:H7 str. EC4196]
 gi|188016291|gb|EDU54413.1| ribonuclease D [Escherichia coli O157:H7 str. EC4113]
 gi|189000217|gb|EDU69203.1| ribonuclease D [Escherichia coli O157:H7 str. EC4076]
 gi|189355025|gb|EDU73444.1| ribonuclease D [Escherichia coli O157:H7 str. EC4401]
 gi|189360343|gb|EDU78762.1| ribonuclease D [Escherichia coli O157:H7 str. EC4486]
 gi|189365729|gb|EDU84145.1| ribonuclease D [Escherichia coli O157:H7 str. EC4501]
 gi|189371954|gb|EDU90370.1| ribonuclease D [Escherichia coli O157:H7 str. EC869]
 gi|189376734|gb|EDU95150.1| ribonuclease D [Escherichia coli O157:H7 str. EC508]
 gi|190901115|gb|EDV60890.1| ribonuclease D [Escherichia coli B7A]
 gi|192926009|gb|EDV80654.1| ribonuclease D [Escherichia coli E22]
 gi|192955385|gb|EDV85869.1| ribonuclease D [Escherichia coli E110019]
 gi|194411930|gb|EDX28245.1| ribonuclease D [Escherichia coli B171]
 gi|208725009|gb|EDZ74716.1| ribonuclease D [Escherichia coli O157:H7 str. EC4206]
 gi|208731026|gb|EDZ79715.1| ribonuclease D [Escherichia coli O157:H7 str. EC4045]
 gi|208738881|gb|EDZ86563.1| ribonuclease D [Escherichia coli O157:H7 str. EC4042]
 gi|209157942|gb|ACI35375.1| ribonuclease D [Escherichia coli O157:H7 str. EC4115]
 gi|209768038|gb|ACI82331.1| RNase D [Escherichia coli]
 gi|209768040|gb|ACI82332.1| RNase D [Escherichia coli]
 gi|209768042|gb|ACI82333.1| RNase D [Escherichia coli]
 gi|209768044|gb|ACI82334.1| RNase D [Escherichia coli]
 gi|209768046|gb|ACI82335.1| RNase D [Escherichia coli]
 gi|209912428|dbj|BAG77502.1| ribonuclease D [Escherichia coli SE11]
 gi|217318200|gb|EEC26627.1| ribonuclease D [Escherichia coli O157:H7 str. TW14588]
 gi|218352098|emb|CAU97835.1| ribonuclease D [Escherichia coli 55989]
 gi|218361144|emb|CAQ98727.1| ribonuclease D [Escherichia coli IAI1]
 gi|218432399|emb|CAR13290.1| ribonuclease D [Escherichia coli UMN026]
 gi|254592826|gb|ACT72187.1| ribonuclease D [Escherichia coli O157:H7 str. TW14359]
 gi|257759295|dbj|BAI30792.1| ribonuclease D [Escherichia coli O103:H2 str. 12009]
 gi|290762857|gb|ADD56818.1| Ribonuclease D [Escherichia coli O55:H7 str. CB9615]
 gi|291323006|gb|EFE62434.1| ribonuclease D [Escherichia coli B088]
 gi|332101397|gb|EGJ04743.1| ribonuclease D [Shigella sp. D9]
          Length = 375

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|281178870|dbj|BAI55200.1| ribonuclease D [Escherichia coli SE15]
          Length = 375

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|323175119|gb|EFZ60733.1| ribonuclease D [Escherichia coli LT-68]
          Length = 375

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|194434924|ref|ZP_03067168.1| ribonuclease D [Shigella dysenteriae 1012]
 gi|194416812|gb|EDX32937.1| ribonuclease D [Shigella dysenteriae 1012]
          Length = 375

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKSILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|304411369|ref|ZP_07392983.1| ribonuclease D [Shewanella baltica OS183]
 gi|307305309|ref|ZP_07585057.1| ribonuclease D [Shewanella baltica BA175]
 gi|304350224|gb|EFM14628.1| ribonuclease D [Shewanella baltica OS183]
 gi|306911612|gb|EFN42037.1| ribonuclease D [Shewanella baltica BA175]
          Length = 369

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L D    K
Sbjct: 21  KQSKILVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLAQFWALLSDPNIIK 78

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 79  LVHSCSEDLEVFAHYGKCQPTPLFDSQIAA-SLCGMGHGVGYAKLVETCLGEVIDKGESR 137

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++L+ L  Q   KL   GR       
Sbjct: 138 TDWIRRPLTEAQLSYAANDVLYLYQLYPQLEAKLSVQGRLAWLYEE 183


>gi|166711789|ref|ZP_02242996.1| ribonuclease D [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 363

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 3/188 (1%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQ++ G+  + I  +      A  L
Sbjct: 7   HPSELTDRLQAARPARIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPSMNAA--L 64

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E+
Sbjct: 65  KEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 123

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L    R          
Sbjct: 124 TGTLLTKGETRSDWMRRPLSPSQLEYAADDVRYLFAIHDELTRRLTEQNRLGWLAEDAER 183

Query: 187 LMDRAELD 194
           L+   E D
Sbjct: 184 LLATVEHD 191


>gi|289665658|ref|ZP_06487239.1| ribonuclease D [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 210

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/188 (27%), Positives = 79/188 (42%), Gaps = 3/188 (1%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQL+ G+  + I  +  G   A  L
Sbjct: 7   HPSELTDRLQAARPSRIGLDTEFIRERTYWPQLALVQLAIGEEILLIDPLIPGMNEA--L 64

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E+
Sbjct: 65  KEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 123

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + T +L    R          
Sbjct: 124 TGTLLTKGETRSDWMRRPLSPSQLEYAADDVRYLFAIHDELTRRLTEQDRLGWLAEDAER 183

Query: 187 LMDRAELD 194
           L+   E D
Sbjct: 184 LLATVEHD 191


>gi|170680016|ref|YP_001743442.1| ribonuclease D [Escherichia coli SMS-3-5]
 gi|218699628|ref|YP_002407257.1| ribonuclease D [Escherichia coli IAI39]
 gi|170517734|gb|ACB15912.1| ribonuclease D [Escherichia coli SMS-3-5]
 gi|218369614|emb|CAR17383.1| ribonuclease D [Escherichia coli IAI39]
          Length = 375

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GISDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|157161268|ref|YP_001458586.1| ribonuclease D [Escherichia coli HS]
 gi|188495947|ref|ZP_03003217.1| ribonuclease D [Escherichia coli 53638]
 gi|194439630|ref|ZP_03071702.1| ribonuclease D [Escherichia coli 101-1]
 gi|254161863|ref|YP_003044971.1| ribonuclease D [Escherichia coli B str. REL606]
 gi|157066948|gb|ABV06203.1| ribonuclease D [Escherichia coli HS]
 gi|188491146|gb|EDU66249.1| ribonuclease D [Escherichia coli 53638]
 gi|194421451|gb|EDX37466.1| ribonuclease D [Escherichia coli 101-1]
 gi|242377525|emb|CAQ32279.1| RNase D [Escherichia coli BL21(DE3)]
 gi|253973764|gb|ACT39435.1| ribonuclease D [Escherichia coli B str. REL606]
 gi|253977958|gb|ACT43628.1| ribonuclease D [Escherichia coli BL21(DE3)]
          Length = 375

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|191171723|ref|ZP_03033270.1| ribonuclease D [Escherichia coli F11]
 gi|190908053|gb|EDV67645.1| ribonuclease D [Escherichia coli F11]
 gi|284921723|emb|CBG34795.1| ribonuclease D [Escherichia coli 042]
          Length = 375

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GISDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|153840116|ref|ZP_01992783.1| ribonuclease D [Vibrio parahaemolyticus AQ3810]
 gi|149746274|gb|EDM57352.1| ribonuclease D [Vibrio parahaemolyticus AQ3810]
          Length = 341

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 6/188 (3%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   CA AR  D + +DTE + +     +L ++QL  G     I      
Sbjct: 18  NYQIITKNKDLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  + + +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTSFIELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  + 
Sbjct: 135 ATLVEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEA 194

Query: 180 ATSCCNFL 187
                + L
Sbjct: 195 VQQESDLL 202


>gi|16129758|ref|NP_416318.1| ribonuclease D [Escherichia coli str. K-12 substr. MG1655]
 gi|89108643|ref|AP_002423.1| ribonuclease D [Escherichia coli str. K-12 substr. W3110]
 gi|170081460|ref|YP_001730780.1| ribonuclease D [Escherichia coli str. K-12 substr. DH10B]
 gi|238901018|ref|YP_002926814.1| ribonuclease D [Escherichia coli BW2952]
 gi|301019362|ref|ZP_07183546.1| ribonuclease D [Escherichia coli MS 196-1]
 gi|133152|sp|P09155|RND_ECOLI RecName: Full=Ribonuclease D; Short=RNase D
 gi|75765643|pdb|1YT3|A Chain A, Crystal Structure Of Escherichia Coli Rnase D, An
           Exoribonuclease Involved In Structured Rna Processing
 gi|581215|emb|CAA30098.1| unnamed protein product [Escherichia coli]
 gi|1736427|dbj|BAA15599.1| ribonuclease D [Escherichia coli str. K12 substr. W3110]
 gi|1788105|gb|AAC74874.1| ribonuclease D [Escherichia coli str. K-12 substr. MG1655]
 gi|169889295|gb|ACB03002.1| ribonuclease D [Escherichia coli str. K-12 substr. DH10B]
 gi|238863466|gb|ACR65464.1| ribonuclease D [Escherichia coli BW2952]
 gi|299882254|gb|EFI90465.1| ribonuclease D [Escherichia coli MS 196-1]
 gi|309702026|emb|CBJ01340.1| ribonuclease D [Escherichia coli ETEC H10407]
 gi|315136445|dbj|BAJ43604.1| ribonuclease D [Escherichia coli DH1]
 gi|226093|prf||1410308A ribonuclease D
          Length = 375

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|158522583|ref|YP_001530453.1| DNA polymerase I [Desulfococcus oleovorans Hxd3]
 gi|158511409|gb|ABW68376.1| DNA polymerase I [Desulfococcus oleovorans Hxd3]
          Length = 892

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/198 (20%), Positives = 67/198 (33%), Gaps = 17/198 (8%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
                  A DTET  L P + RL  + L+        I +    + AP           L
Sbjct: 310 LEKASCFAFDTETTALDPMKARLVGISLALEPDEAFYIPVGHAYEGAPVQLDRDAVLRIL 369

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
                + K  KI    ++D  VL         PVF T IA+ L       +GL     + 
Sbjct: 370 APAFENTKITKIGQNVKYDWTVLSRCGFKIDGPVFDTMIAAYLLNPTRRSYGLDRLAADY 429

Query: 127 LGINISKAQQSSDWSADDLS------DEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           L   +   Q  +    +         +E + YAA D     +L     ++L++ G  +L 
Sbjct: 430 LNHRMISYQDVTGTGKNAKCFSAVPLEEAIPYAAEDADITFSLHRLLEKELKQGGLFELL 489

Query: 181 T-SCCNFLMDRAELDLLG 197
                  +     +++ G
Sbjct: 490 ETIEMPLVPVLMHMEMAG 507


>gi|332702439|ref|ZP_08422527.1| ribonuclease D [Desulfovibrio africanus str. Walvis Bay]
 gi|332552588|gb|EGJ49632.1| ribonuclease D [Desulfovibrio africanus str. Walvis Bay]
          Length = 409

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 55/172 (31%), Positives = 80/172 (46%), Gaps = 3/172 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            R  DA+ +DTE +        L ++QL   DG V ++    G  +   LV +L D +  
Sbjct: 42  LRGCDAVGMDTEFVRSRTYFPTLGLIQL-VADGGVFLVDPL-GVDDLSPLVEILADPRLI 99

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KIFH  + D+  L+Y  G    PVF T++A+        Q G    +K L G+ + K + 
Sbjct: 100 KIFHSCQEDLEALYYLCGFAPGPVFDTQVAASFLGYGF-QPGYGSLVKALFGVELDKDET 158

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            S+W    LS+ QL YAA DV +L A+     + L   GR   A   C  L 
Sbjct: 159 RSNWIKRPLSESQLIYAAQDVRYLPAMYSILGQALTEQGRLSWAREECAALE 210


>gi|197116637|ref|YP_002137064.1| ribonuclease D [Geobacter bemidjiensis Bem]
 gi|197085997|gb|ACH37268.1| ribonuclease D, putative [Geobacter bemidjiensis Bem]
          Length = 377

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 72/171 (42%), Gaps = 4/171 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A D E   L    +++C++Q+S       I  +A    +   L  +  +   +
Sbjct: 29  LSRESVLAFDLEADSLHHYTEKVCLIQVSSTSEDRLIDPLAPI--DVKVLAPIFANPAIK 86

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KIFH   +D+  L+  FG+ V  +F T IAS+         GL   LK+  G+ + K  Q
Sbjct: 87  KIFHGADYDMRSLYRDFGIEVVNLFDTMIASQFLGESEF--GLAALLKKRFGVELDKRYQ 144

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DWS    S E L YA  D   L  L  Q   +L++ GR          +
Sbjct: 145 KADWSKRPFSQEMLDYAMKDTSLLIELYRQLEAELKQKGRLAWVEEESELV 195


>gi|254226821|ref|ZP_04920393.1| ribonuclease D [Vibrio cholerae V51]
 gi|125620668|gb|EAZ49030.1| ribonuclease D [Vibrio cholerae V51]
          Length = 381

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  + 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTQAGWWEA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|157375657|ref|YP_001474257.1| ribonuclease D [Shewanella sediminis HAW-EB3]
 gi|157318031|gb|ABV37129.1| ribonuclease D [Shewanella sediminis HAW-EB3]
          Length = 369

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 75/186 (40%), Gaps = 6/186 (3%)

Query: 1   MTTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M   +  + D  +    +  R    + +DTE +       RL ++Q   G     I  IA
Sbjct: 1   MLAFQYIDDDASLTELVSQYRQSTLLVLDTEFVRTRTYYARLGLIQAYDGKTLALIDPIA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
            G         +L + +   + H    D+ V       +   +F ++IA+     + +  
Sbjct: 61  VGN--LSEFWSLLTEPEITTVLHSCSEDLEVFARNGQCQPIRLFDSQIAA-SLCGFGHGL 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    +++ L I + K +  +DW    LS  QL YAA+DV +L+ L  Q  +KL+   R 
Sbjct: 118 GYAKLVEQTLNIALDKGESRTDWMKRPLSKAQLTYAANDVYYLYELYPQLIQKLEDTDRL 177

Query: 178 DLATSC 183
           D     
Sbjct: 178 DWVFEE 183


>gi|260901199|ref|ZP_05909594.1| ribonuclease D [Vibrio parahaemolyticus AQ4037]
 gi|308106837|gb|EFO44377.1| ribonuclease D [Vibrio parahaemolyticus AQ4037]
          Length = 354

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 6/188 (3%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   CA AR  D + +DTE + +     +L ++QL  G     I      
Sbjct: 18  NYQIITKNKDLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  + + +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTSFIELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  + 
Sbjct: 135 ATLVEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEA 194

Query: 180 ATSCCNFL 187
                + L
Sbjct: 195 VQQESDLL 202


>gi|328675812|gb|AEB28487.1| Ribonuclease D [Francisella cf. novicida 3523]
          Length = 364

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 71/168 (42%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 IAVDTE   +      LC+VQ++  +    I        +   L  +  ++  +
Sbjct: 16  ISNTSQIAVDTEFYWMRTYYPELCLVQIATENEIFLID--TLKDLDFSKLKDIFENKDIQ 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I + K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAAAFLG-FQTQSSLKTLLKEILDIEMEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+ +QL YA  DV +L  L+    ++L +           
Sbjct: 133 FSDWRNRPLTQKQLNYAIKDVEYLIQLKEYLQQQLIKSEYQGFFEQEL 180


>gi|213865181|ref|ZP_03387300.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
          Length = 200

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 5   RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 62

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 63  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFASMVEEYTGVALDKSESR 121

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 122 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 174


>gi|254508462|ref|ZP_05120581.1| ribonuclease D [Vibrio parahaemolyticus 16]
 gi|219548574|gb|EED25580.1| ribonuclease D [Vibrio parahaemolyticus 16]
          Length = 386

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/190 (24%), Positives = 79/190 (41%), Gaps = 12/190 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR VD + +DTE +       +L ++QL  G+    I             V +L D    
Sbjct: 34  AREVDVVMLDTEFVRTRTFYPQLGLIQLFDGEQLSLIDPTEL--DEMTPFVELLQDTSVL 91

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V   +FG    P+  T++ +          G    ++  L + + K++ 
Sbjct: 92  KVLHACGEDLEVFQNSFGCLPYPMVDTQVMAAFLGHGL-STGFASLVEHYLQVELDKSES 150

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL--------- 187
            +DW A  L+D+QL YAA+DV +L  L  +    +   G  + A    + L         
Sbjct: 151 RTDWLARPLTDKQLDYAAADVFYLLPLYEKLLNAVTEAGWWEAAQQESDLLAAKRIKNTD 210

Query: 188 MDRAELDLLG 197
            + A LD+ G
Sbjct: 211 PEMAYLDVKG 220


>gi|222474840|ref|YP_002563255.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
 gi|222418976|gb|ACM48999.1| ribonuclease D (rnd) [Anaplasma marginale str. Florida]
          Length = 386

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 80/177 (45%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLG-LMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
           A+      +++A+DTE +        RLC++Q++   G   ++ +   + +   L  +  
Sbjct: 18  AQILRDRPESLAIDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFD 76

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           DE   K+FH  R D+  L   F    RP+F T+ AS L   + N  G    +++ LG+ +
Sbjct: 77  DEGIYKVFHDCRQDLDALSQRFTRLPRPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKL 136

Query: 132 SKA-QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +K   +  DWS   LS+ +++YA  DV +LH L       L    R          +
Sbjct: 137 NKLLFKRVDWSHRPLSEGKVRYALDDVTYLHELYEVLLGILTAKERLTWFLEEMENI 193


>gi|315634066|ref|ZP_07889355.1| ribonuclease D [Aggregatibacter segnis ATCC 33393]
 gi|315477316|gb|EFU68059.1| ribonuclease D [Aggregatibacter segnis ATCC 33393]
          Length = 385

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 76/171 (44%), Gaps = 3/171 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR   A+A+DTE + +     +L ++QL  GD    I       ++    + +L DE   
Sbjct: 30  ARTQSAVALDTEFVRVRTLHPKLGLIQLYAGDEVALIDPT--MIQDFSPFIALLADESVL 87

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + F    +P+  T++ +          G    ++    I I K   
Sbjct: 88  KVLHACGEDLEVFQHYFQQLPQPMCDTQVMANFLGFAG-SAGFATLVQHYFHIEIDKGAS 146

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DW A  LS+ QL+YAA+DV +L  L +Q   +L +        + C FL
Sbjct: 147 RTDWLARPLSEIQLRYAAADVWYLLPLYVQMQTQLAQTEWQSAVKNECEFL 197


>gi|326623067|gb|EGE29412.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 371

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFAAMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|254286913|ref|ZP_04961865.1| ribonuclease D [Vibrio cholerae AM-19226]
 gi|150423063|gb|EDN15012.1| ribonuclease D [Vibrio cholerae AM-19226]
          Length = 381

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  + 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWEA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVVKRTKVSNPELAYLDIKG 213


>gi|163786572|ref|ZP_02181020.1| DNA polymerase I [Flavobacteriales bacterium ALC-1]
 gi|159878432|gb|EDP72488.1| DNA polymerase I [Flavobacteriales bacterium ALC-1]
          Length = 948

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 65/203 (32%), Gaps = 11/203 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----LVGMLV 71
                 ++  DTET GL P    L  +  S   G    +     +  A      L     
Sbjct: 370 NLMNQTSVCFDTETTGLNPLTAELVGIAFSWETGKGFYVPFPEDKNEAQELIEVLRPFFE 429

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
           ++  EKI    ++DI VL          +F T +A  L       +         +    
Sbjct: 430 NDNIEKIGQNLKYDIKVLAKYNVEVKGKLFDTMLAHYLINPDMRHNMDVLAETYLNYTPI 489

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++     +   D+Q +YA  D      L+  F ++L       L      
Sbjct: 490 SITELIGKKGKNQLSMREVPLDKQTEYAVEDADITLQLKEHFEKELGEANTQKLFNDIEL 549

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
             L   A ++L G      F +S
Sbjct: 550 PLLRVLAAMELEGINLDKDFLNS 572


>gi|320085676|emb|CBY95454.1| RNase D, processes tRNA precursor [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 371

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFAAMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|224583693|ref|YP_002637491.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|238912118|ref|ZP_04655955.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|224468220|gb|ACN46050.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 371

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFAAMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|161613674|ref|YP_001587639.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161363038|gb|ABX66806.1| hypothetical protein SPAB_01399 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|322616813|gb|EFY13721.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618052|gb|EFY14944.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625723|gb|EFY22542.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626173|gb|EFY22983.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633779|gb|EFY30519.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322638933|gb|EFY35626.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640751|gb|EFY37401.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644138|gb|EFY40683.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649210|gb|EFY45648.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655369|gb|EFY51677.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660875|gb|EFY57106.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662828|gb|EFY59035.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668012|gb|EFY64171.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322674226|gb|EFY70320.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675419|gb|EFY71493.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322683166|gb|EFY79182.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686859|gb|EFY82837.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195248|gb|EFZ80428.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200159|gb|EFZ85245.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323203843|gb|EFZ88861.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207397|gb|EFZ92345.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213750|gb|EFZ98532.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217380|gb|EGA02099.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220925|gb|EGA05358.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323224700|gb|EGA08971.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231403|gb|EGA15516.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235843|gb|EGA19922.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240412|gb|EGA24455.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245305|gb|EGA29305.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323246673|gb|EGA30645.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253527|gb|EGA37355.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323263330|gb|EGA46866.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266778|gb|EGA50264.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323268984|gb|EGA52440.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 371

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFASMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|56413264|ref|YP_150339.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197362190|ref|YP_002141827.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56127521|gb|AAV77027.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197093667|emb|CAR59137.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 371

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RTCPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFASMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|84999262|ref|XP_954352.1| DNA polymerase i [Theileria annulata]
 gi|65305350|emb|CAI73675.1| DNA polymerase i, putative [Theileria annulata]
          Length = 1786

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 53/199 (26%), Positives = 85/199 (42%), Gaps = 17/199 (8%)

Query: 18   RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN--------------- 62
            +   A+ VD ET GL    +++ +VQLS  +    II +     N               
Sbjct: 1217 KDPKAVGVDIETTGLDHNTNQIRLVQLSVPNQPSVIIDLFKLNTNNPESDNVVPGRNELI 1276

Query: 63   -APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTR-TYTNQHGLK 120
                L  +   +   K+FH G+FDI  L         P+F T +AS+L   +      L 
Sbjct: 1277 KCEWLKNLFKSKDTVKVFHNGKFDINFLRVYGFEFEGPIFDTMVASKLLVASRYISCKLT 1336

Query: 121  DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
               +  L I + K QQ SDWS   L +EQL Y+A D   L  L +     L+    +D+A
Sbjct: 1337 HVSERYLNIVLDKTQQYSDWSTLQLFEEQLLYSARDSFVLLPLYVILEHLLKINNLADIA 1396

Query: 181  TSCCNFLMDRAELDLLGWE 199
            +     ++  ++++L G +
Sbjct: 1397 SVENKCILATSDMELNGIK 1415


>gi|229521896|ref|ZP_04411313.1| ribonuclease D [Vibrio cholerae TM 11079-80]
 gi|229340821|gb|EEO05826.1| ribonuclease D [Vibrio cholerae TM 11079-80]
          Length = 381

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQVGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|317491812|ref|ZP_07950247.1| ribonuclease D [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920246|gb|EFV41570.1| ribonuclease D [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 371

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/192 (22%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++     D+   C  A     IA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTSSDLKQVCEQASRHAYIALDTEFVRTRTYYPQLGLIQLFDGETLTLIDPLP- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    V +L + +  K+ H    D+ V  + F     P+  T+I +          G
Sbjct: 60  -ITDWQPFVALLKNPEVTKLLHACSEDLEVFLHEFQTLPTPMIDTQILAAF-TGRALSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + + L + + K++  +DW A  L++ Q +YAA+DV +L  L  +   ++   G  D
Sbjct: 118 FAAMVNDYLQVELDKSESRTDWLARPLTERQCEYAAADVFYLLPLADKLIAEVAEAGWLD 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AAKDDCLSLCRR 189


>gi|163752438|ref|ZP_02159629.1| ribonuclease D [Shewanella benthica KT99]
 gi|161327662|gb|EDP98855.1| ribonuclease D [Shewanella benthica KT99]
          Length = 380

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/183 (25%), Positives = 76/183 (41%), Gaps = 6/183 (3%)

Query: 4   IRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
               E D  + A  +  R  D + +DTE +       RL ++Q   G     I  +A   
Sbjct: 12  FEYIEDDASLTALVSQYRQSDLLVLDTEFVRTRTFYARLGLIQAYDGKTLALIDPVAVNN 71

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
                  G+L +     + H    D+ V       +   +F ++IA+       +  G  
Sbjct: 72  --LSEFWGLLAEPGITTVLHSCSEDLEVFARNGHCQPANLFDSQIAA-ALCGLGHGLGYA 128

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             +++ L I++ K +  +DW    LS+ QL YAA+DV +L+ L  Q  EKLQ+ GR    
Sbjct: 129 KLVEQTLDISLDKGESRTDWMKRPLSEAQLNYAANDVYYLYNLYPQLLEKLQQQGRLAWV 188

Query: 181 TSC 183
              
Sbjct: 189 IEE 191


>gi|297579488|ref|ZP_06941416.1| ribonuclease D [Vibrio cholerae RC385]
 gi|297537082|gb|EFH75915.1| ribonuclease D [Vibrio cholerae RC385]
          Length = 381

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|153801848|ref|ZP_01956434.1| ribonuclease D [Vibrio cholerae MZO-3]
 gi|153829828|ref|ZP_01982495.1| ribonuclease D [Vibrio cholerae 623-39]
 gi|229515363|ref|ZP_04404823.1| ribonuclease D [Vibrio cholerae TMA 21]
 gi|229528995|ref|ZP_04418385.1| ribonuclease D [Vibrio cholerae 12129(1)]
 gi|124122620|gb|EAY41363.1| ribonuclease D [Vibrio cholerae MZO-3]
 gi|148874687|gb|EDL72822.1| ribonuclease D [Vibrio cholerae 623-39]
 gi|229332769|gb|EEN98255.1| ribonuclease D [Vibrio cholerae 12129(1)]
 gi|229348068|gb|EEO13027.1| ribonuclease D [Vibrio cholerae TMA 21]
          Length = 381

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|258621252|ref|ZP_05716286.1| ribonuclease D [Vibrio mimicus VM573]
 gi|258586640|gb|EEW11355.1| ribonuclease D [Vibrio mimicus VM573]
          Length = 373

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 85/208 (40%), Gaps = 15/208 (7%)

Query: 2   TTIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I     
Sbjct: 1   MNYQIITQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVI 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                   V +L D    K+ H    D+ V    FG    P+  T+I +          G
Sbjct: 61  N--EMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G  +
Sbjct: 118 FAALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAGWWE 177

Query: 179 LATSCCNFL---------MDRAELDLLG 197
            A                 + A LD+ G
Sbjct: 178 AALQESELQVAKRTKVSNPELAYLDIKG 205


>gi|322417808|ref|YP_004197031.1| 3'-5' exonuclease [Geobacter sp. M18]
 gi|320124195|gb|ADW11755.1| 3'-5' exonuclease [Geobacter sp. M18]
          Length = 377

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 71/171 (41%), Gaps = 4/171 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A D E   L    +++C++Q+S       I  +A    +   L  +  +   +
Sbjct: 29  LSKESVLAFDLEADSLHHYTEKVCLIQVSSESENRLIDPLAPI--DVRVLAPIFANPAIK 86

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KIFH   +D+  L+  FG+ V  +F T IAS+         GL   LK+  G+ + K  Q
Sbjct: 87  KIFHGADYDMRSLYRDFGIEVVNLFDTMIASQFLGESEF--GLAALLKKRFGVELDKRYQ 144

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DWS    S E L+YA  D   L  L  Q   +L   GR          +
Sbjct: 145 KADWSKRPFSQEMLEYAMKDTSLLIELYRQLEAELLAKGRLAWVEEESELV 195


>gi|161503057|ref|YP_001570169.1| ribonuclease D [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864404|gb|ABX21027.1| hypothetical protein SARI_01122 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 371

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGADVALIDPL--GITDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFASMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|269959116|ref|YP_003328905.1| ribonuclease D [Anaplasma centrale str. Israel]
 gi|269848947|gb|ACZ49591.1| ribonuclease D [Anaplasma centrale str. Israel]
          Length = 389

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLG-LMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
           A+      +++AVDTE +        RLC++Q++   G   ++ +   + +   L  +  
Sbjct: 18  AQILRDRPESLAVDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFD 76

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           DE   K+FH  R D+  L   F    +P+F T+ AS L   + N  G    +++ LG+ +
Sbjct: 77  DEGICKVFHDCRQDLDALSQRFLRLPKPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKL 136

Query: 132 SKA-QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +K   +  DWS   LS+ +++YA  DV +LH L     + L   GR          +
Sbjct: 137 NKLLFKRVDWSHRPLSEGKVRYALDDVTYLHELYGVLLDILVAKGRLTWFREEMAGI 193


>gi|37526051|ref|NP_929395.1| ribonuclease D [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36785481|emb|CAE14428.1| Ribonuclease D (RNase D) [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 375

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/192 (21%), Positives = 78/192 (40%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  A+    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDAQLQQVCEGAKKYSKVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              N      ++   +  K+ H G  D+ V    F     P+  T++ +          G
Sbjct: 59  NITNWQPFRELITHPQILKLLHAGSEDLEVFLNAFQCLPEPMIDTQVLAAFIGHPL-SCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E + + + K++  +DW A  LS++Q +YAA+DV +L  L         + G  +
Sbjct: 118 FAALVAEYIHVELDKSESRTDWLARPLSEKQCEYAAADVYYLLPLADILMTATAQAGYME 177

Query: 179 LATSCCNFLMDR 190
            AT  C  +  R
Sbjct: 178 AATGECRLISRR 189


>gi|51596384|ref|YP_070575.1| ribonuclease D [Yersinia pseudotuberculosis IP 32953]
 gi|149365996|ref|ZP_01888031.1| ribonuclease D [Yersinia pestis CA88-4125]
 gi|153949850|ref|YP_001400986.1| ribonuclease D [Yersinia pseudotuberculosis IP 31758]
 gi|162421744|ref|YP_001606825.1| ribonuclease D [Yersinia pestis Angola]
 gi|165928352|ref|ZP_02224184.1| ribonuclease D [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938856|ref|ZP_02227410.1| ribonuclease D [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009317|ref|ZP_02230215.1| ribonuclease D [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166210648|ref|ZP_02236683.1| ribonuclease D [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167401505|ref|ZP_02307002.1| ribonuclease D [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420357|ref|ZP_02312110.1| ribonuclease D [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167424411|ref|ZP_02316164.1| ribonuclease D [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170024358|ref|YP_001720863.1| ribonuclease D [Yersinia pseudotuberculosis YPIII]
 gi|218929182|ref|YP_002347057.1| ribonuclease D [Yersinia pestis CO92]
 gi|229894791|ref|ZP_04509971.1| ribonuclease D [Yersinia pestis Pestoides A]
 gi|229898140|ref|ZP_04513289.1| ribonuclease D [Yersinia pestis biovar Orientalis str. India 195]
 gi|229902002|ref|ZP_04517123.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|270490819|ref|ZP_06207893.1| ribonuclease D [Yersinia pestis KIM D27]
 gi|294503859|ref|YP_003567921.1| ribonuclease D [Yersinia pestis Z176003]
 gi|51589666|emb|CAH21296.1| ribonuclease D [Yersinia pseudotuberculosis IP 32953]
 gi|115347793|emb|CAL20710.1| ribonuclease D [Yersinia pestis CO92]
 gi|149292409|gb|EDM42483.1| ribonuclease D [Yersinia pestis CA88-4125]
 gi|152961345|gb|ABS48806.1| ribonuclease D [Yersinia pseudotuberculosis IP 31758]
 gi|162354559|gb|ABX88507.1| ribonuclease D [Yersinia pestis Angola]
 gi|165913219|gb|EDR31842.1| ribonuclease D [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919635|gb|EDR36968.1| ribonuclease D [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991872|gb|EDR44173.1| ribonuclease D [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207828|gb|EDR52308.1| ribonuclease D [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962052|gb|EDR58073.1| ribonuclease D [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049201|gb|EDR60609.1| ribonuclease D [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056293|gb|EDR66062.1| ribonuclease D [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169750892|gb|ACA68410.1| ribonuclease D [Yersinia pseudotuberculosis YPIII]
 gi|229680898|gb|EEO76993.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|229688856|gb|EEO80923.1| ribonuclease D [Yersinia pestis biovar Orientalis str. India 195]
 gi|229702264|gb|EEO90283.1| ribonuclease D [Yersinia pestis Pestoides A]
 gi|262362022|gb|ACY58743.1| ribonuclease D [Yersinia pestis D106004]
 gi|262365841|gb|ACY62398.1| ribonuclease D [Yersinia pestis D182038]
 gi|270339323|gb|EFA50100.1| ribonuclease D [Yersinia pestis KIM D27]
 gi|294354318|gb|ADE64659.1| ribonuclease D [Yersinia pestis Z176003]
 gi|320015246|gb|ADV98817.1| ribonuclease D [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 373

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 77/192 (40%), Gaps = 6/192 (3%)

Query: 2   TTIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++      +   C  AR    IA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTNNALQQVCEQARTHAHIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                     +L D    K  H G  D+ V    F     P+  T++ +      +   G
Sbjct: 60  -ITEWQPFRALLQDLNVVKYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAF-SGRSLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E  G+ + K++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D
Sbjct: 118 FAMLVAEFEGVELDKSESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMD 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AAKDECLLLCRR 189


>gi|213052594|ref|ZP_03345472.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213419335|ref|ZP_03352401.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
 gi|213426609|ref|ZP_03359359.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213609541|ref|ZP_03369367.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|289828970|ref|ZP_06546670.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
          Length = 371

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFASMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|312912807|dbj|BAJ36781.1| ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224451|gb|EFX49514.1| Ribonuclease D [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
          Length = 371

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFASMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|260878202|ref|ZP_05890557.1| ribonuclease D [Vibrio parahaemolyticus AN-5034]
 gi|308090210|gb|EFO39905.1| ribonuclease D [Vibrio parahaemolyticus AN-5034]
          Length = 372

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 6/188 (3%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   CA AR  D + +DTE + +     +L ++QL  G     I      
Sbjct: 18  NYQIITKNKDLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  + + +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTSFIELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  + 
Sbjct: 135 ATLVEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEA 194

Query: 180 ATSCCNFL 187
                + L
Sbjct: 195 VQQESDLL 202


>gi|254369642|ref|ZP_04985652.1| hypothetical protein FTAG_00956 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122601|gb|EDO66730.1| hypothetical protein FTAG_00956 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 364

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 70/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQL+  +    I            L  +  D+   
Sbjct: 16  LKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLID--TLKDLEFKKLKEIFEDKDIL 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+     +  Q  LK  LKE+L I I K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLG-FQTQSSLKTLLKEILDIEIEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    L+  QL Y+  DV +L  L+    ++L +    D      
Sbjct: 133 FSDWRNRPLTQNQLNYSIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL 180


>gi|153823321|ref|ZP_01975988.1| ribonuclease D [Vibrio cholerae B33]
 gi|126519155|gb|EAZ76378.1| ribonuclease D [Vibrio cholerae B33]
          Length = 246

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 86/208 (41%), Gaps = 15/208 (7%)

Query: 2   TTIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I     
Sbjct: 1   MNYQIISQVGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                   V +L D    K+ H    D+ V    FG    P+  T+I +          G
Sbjct: 61  --DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D
Sbjct: 118 FAALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWD 177

Query: 179 LATSCCNFL---------MDRAELDLLG 197
            A                 + A LD+ G
Sbjct: 178 AALQESELQVAKRTKVSNPELAYLDIKG 205


>gi|307131134|ref|YP_003883150.1| ribonuclease D [Dickeya dadantii 3937]
 gi|306528663|gb|ADM98593.1| ribonuclease D [Dickeya dadantii 3937]
          Length = 373

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + A CA A  V  +A+DTE +       +L ++QL  GD    I  +A 
Sbjct: 1   MNYQLITTDEGLSAVCAQACAVSEVALDTEFVRTRTYYPQLGLIQLYDGDNLSLIDPLA- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++      +L + +  K  H G  D+ V    FG    P   T+I +         +G
Sbjct: 60  -IRDWAPFRALLQNPQVTKFLHAGSEDLEVFLNAFGGLPSPFIDTQILAAFLGKPL-SYG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + +   + + K++  +DW A  LS++Q QYAA+DV +L  +     E+ +  G  +
Sbjct: 118 FAALVADYRQVALDKSESRTDWLARPLSEKQCQYAAADVFYLLPVARTLVEETRAAGWLE 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AALDECLLLCQR 189


>gi|320183816|gb|EFW58649.1| Ribonuclease D [Shigella flexneri CDC 796-83]
 gi|332096395|gb|EGJ01392.1| ribonuclease D [Shigella boydii 3594-74]
          Length = 371

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I S          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|293410113|ref|ZP_06653689.1| ribonuclease D [Escherichia coli B354]
 gi|291470581|gb|EFF13065.1| ribonuclease D [Escherichia coli B354]
          Length = 371

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLSAALDECRLMQMR 185


>gi|260895639|ref|ZP_05904135.1| ribonuclease D [Vibrio parahaemolyticus Peru-466]
 gi|308088174|gb|EFO37869.1| ribonuclease D [Vibrio parahaemolyticus Peru-466]
          Length = 325

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 6/188 (3%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   CA AR  D + +DTE + +     +L ++QL  G     I      
Sbjct: 18  NYQIITKNKDLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  + + +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTSFIELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  + 
Sbjct: 135 ATLVEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEA 194

Query: 180 ATSCCNFL 187
                + L
Sbjct: 195 VQQESDLL 202


>gi|153826834|ref|ZP_01979501.1| ribonuclease D [Vibrio cholerae MZO-2]
 gi|149739355|gb|EDM53601.1| ribonuclease D [Vibrio cholerae MZO-2]
          Length = 381

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|224368350|ref|YP_002602513.1| PolA [Desulfobacterium autotrophicum HRM2]
 gi|223691066|gb|ACN14349.1| PolA [Desulfobacterium autotrophicum HRM2]
          Length = 891

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/199 (18%), Positives = 66/199 (33%), Gaps = 17/199 (8%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------LV 67
           +  D ++VDTET    P   +L  +  +        I +     +A            + 
Sbjct: 310 KQADILSVDTETTSKHPMLAKLVGISFAVEPHRAYYIPVGHTGMDAKKQPDLSRVIALIR 369

Query: 68  GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELL 127
            +L + + +K+    ++D  VL           F T IAS L       H L     +LL
Sbjct: 370 PLLENPEVKKVGQNIKYDYIVLTRHGIRMQGLGFDTMIASHLLNPSQRGHSLDKIAMDLL 429

Query: 128 GINISKAQQSSDWS------ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
                + ++ +          +      L YAA D            +KLQ     DL  
Sbjct: 430 DHKTIRYKEVTGSGKTQIGFNEVEIQTALDYAAEDADITLLCHGILKQKLQESNLLDLMN 489

Query: 182 S-CCNFLMDRAELDLLGWE 199
                 +   A++++ G +
Sbjct: 490 QVEMPLITVLADMEMHGIK 508


>gi|91794967|ref|YP_564618.1| DNA polymerase I [Shewanella denitrificans OS217]
 gi|91716969|gb|ABE56895.1| DNA polymerase I [Shewanella denitrificans OS217]
          Length = 921

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 73/211 (34%), Gaps = 19/211 (9%)

Query: 6   VHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           +   D+    A       IA+DTET  L     +L  +  +   G    + +A    +AP
Sbjct: 326 LTLDDLDTWIAKLSQAKLIAIDTETTSLNYMDAKLVGISFAIEAGEAAYLPLAHDYLDAP 385

Query: 65  ----------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
                      L  +L  +   K+    ++DI++            F T + S +  +  
Sbjct: 386 SQIDMATALEKLRPLLESDNPAKVGQNLKYDISIFANVGIKLKGVHFDTMLESYVFNSVA 445

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFT 168
           ++H +     + LG      +  +   A  L+  Q+       YAA D      L     
Sbjct: 446 SRHDMDGLALKYLGHKNISFEDVAGKGAKQLTFNQIDLDTAAPYAAEDADITLRLHQHLW 505

Query: 169 EKLQRL-GRSDLATS-CCNFLMDRAELDLLG 197
            +L++    + + T      +   ++++  G
Sbjct: 506 PRLEKEPELAQVFTELELPLIQVLSDIERQG 536


>gi|308270300|emb|CBX26912.1| hypothetical protein N47_A09410 [uncultured Desulfobacterium sp.]
          Length = 382

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 43/178 (24%), Positives = 74/178 (41%), Gaps = 4/178 (2%)

Query: 12  PAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
            A    +    I  D E   +    +++C++Q++  +    I  I         L  +  
Sbjct: 20  DALVNIKEEKKIGFDLEADSMHHFPEKVCLLQVATKNCIFVIDTIKLK--ELSLLKPIFA 77

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           D +  KIFH   +D+  LF  F + +  +F +++ASR         GL+  ++    + +
Sbjct: 78  DNEITKIFHGADYDVRSLFRDFNIEINNLFDSELASRFLGVKET--GLEAVIRHRFNVYL 135

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMD 189
            K     DWS   L D+ L YAA DV +L  L     ++L  +GR       C+ L  
Sbjct: 136 EKKFTKRDWSKRPLIDDMLHYAADDVRYLVPLYEILEKELNDIGRLFWVKEECDILCS 193


>gi|110805403|ref|YP_688923.1| ribonuclease D [Shigella flexneri 5 str. 8401]
 gi|110614951|gb|ABF03618.1| RNase D, processes tRNA precursor [Shigella flexneri 5 str. 8401]
 gi|281600843|gb|ADA73827.1| RNase D [Shigella flexneri 2002017]
 gi|332759595|gb|EGJ89901.1| ribonuclease D [Shigella flexneri K-671]
 gi|333018392|gb|EGK37691.1| ribonuclease D [Shigella flexneri K-304]
          Length = 375

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRVFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|303232226|ref|ZP_07318925.1| ribonuclease D [Atopobium vaginae PB189-T1-4]
 gi|302481636|gb|EFL44697.1| ribonuclease D [Atopobium vaginae PB189-T1-4]
          Length = 437

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 84/187 (44%), Gaps = 10/187 (5%)

Query: 12  PAECAA-----RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           P E  A          +A+DTE +       +LC++Q++    +  +  +A       +L
Sbjct: 67  PDELKAFCAHVAQEGCVAIDTEFIREKTYYPQLCLIQMATHTQSAVVDPLACSS--LCDL 124

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D+   K+F     DI VL+   GV  + VF  ++A+     Y  Q G    ++ +
Sbjct: 125 ACLLEDKSIIKVFFACSQDIEVLYDALGVVPKNVFDAQLAAAFLG-YRYQLGYGALVEAM 183

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
           +G+++ K Q  +DWS   L++EQL+YAA DV++   +      +L R  R    T     
Sbjct: 184 VGVHLPKTQALTDWSLRPLTEEQLKYAADDVIYQPQMYTLLVRELTRTNRYAWFTHEMK- 242

Query: 187 LMDRAEL 193
                ++
Sbjct: 243 -QTLDDM 248


>gi|28897645|ref|NP_797250.1| ribonuclease D [Vibrio parahaemolyticus RIMD 2210633]
 gi|28805858|dbj|BAC59134.1| ribonuclease D [Vibrio parahaemolyticus RIMD 2210633]
 gi|328473373|gb|EGF44221.1| ribonuclease D [Vibrio parahaemolyticus 10329]
          Length = 388

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 6/188 (3%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   CA AR  D + +DTE + +     +L ++QL  G     I      
Sbjct: 18  NYQIITKNKDLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  + + +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTSFIELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  + 
Sbjct: 135 ATLVEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEA 194

Query: 180 ATSCCNFL 187
                + L
Sbjct: 195 VQQESDLL 202


>gi|153217090|ref|ZP_01950854.1| ribonuclease D [Vibrio cholerae 1587]
 gi|124113892|gb|EAY32712.1| ribonuclease D [Vibrio cholerae 1587]
          Length = 381

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|213648384|ref|ZP_03378437.1| ribonuclease D [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
          Length = 371

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I  +  G  +   L  +L D    K
Sbjct: 16  RACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPL--GISDWSPLKAVLRDTGITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG    P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPL-SWGFASMVEEYTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAALDECRLMQQR 185


>gi|295132395|ref|YP_003583071.1| DNA polymerase I [Zunongwangia profunda SM-A87]
 gi|294980410|gb|ADF50875.1| DNA polymerase I [Zunongwangia profunda SM-A87]
          Length = 941

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 67/198 (33%), Gaps = 12/198 (6%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM----LVD 72
                ++  DTET  L P   +L  +  S   G    +      +    L+ +       
Sbjct: 364 LMKQKSVCFDTETTSLNPLEAQLVGIAFSWEGGKGYYLPFEDNIEKTQQLIELLRPFFES 423

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKEL 126
            + EKI    ++DI VL         P F T IA  L       +         +   + 
Sbjct: 424 PEIEKIGQNLKYDIKVLDKYGIKVEGPTFDTMIAHYLINPDMRHNMDILAETYLNYTPQP 483

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CCN 185
           +   I K  ++     D    EQ +YAA D      L+  F ++L       L       
Sbjct: 484 ISELIGKKGKNQKSMRDVPLAEQTEYAAEDADITFQLKEFFEKELDEAKTRKLFNEIEMP 543

Query: 186 FLMDRAELDLLGWE-NVD 202
            +   A++++ G   ++D
Sbjct: 544 LVEVLADMEIEGINLDLD 561


>gi|333003670|gb|EGK23206.1| ribonuclease D [Shigella flexneri VA-6]
          Length = 371

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRADW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|157145434|ref|YP_001452753.1| ribonuclease D [Citrobacter koseri ATCC BAA-895]
 gi|157082639|gb|ABV12317.1| hypothetical protein CKO_01177 [Citrobacter koseri ATCC BAA-895]
          Length = 371

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I     G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHVALIDP--HGITDWSPLRAVLRDTAITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V   TFG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNTFGELPQPLIDTQILAAFCGRPL-SWGFAAMVEEFTGVALDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITKKLMVETEASGWLPAALDECRLMQQR 185


>gi|56416471|ref|YP_153545.1| ribonuclease D [Anaplasma marginale str. St. Maries]
 gi|56387703|gb|AAV86290.1| ribonuclease D [Anaplasma marginale str. St. Maries]
          Length = 401

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 80/177 (45%), Gaps = 3/177 (1%)

Query: 13  AECAARYVDAIAVDTETLG-LMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
           A+      +++A+DTE +        RLC++Q++   G   ++ +   + +   L  +  
Sbjct: 18  AQILRDRPESLAIDTEFVRSFNDYYPRLCLLQMAYQGGQC-VVDVLDERLDLSPLQEIFD 76

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           DE   K+FH  R D+  L   F    RP+F T+ AS L   + N  G    +++ LG+ +
Sbjct: 77  DEGIYKVFHDCRQDLDALSQRFTRLPRPIFDTQTASMLCEYHDNSVGYSKLVEQFLGVKL 136

Query: 132 SKA-QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +K   +  DWS   LS+ +++YA  DV +LH L       L    R          +
Sbjct: 137 NKLLFKRVDWSHRPLSEGKVRYALDDVTYLHELYEVLLGILTAKERLTWFLEEMENI 193


>gi|15641986|ref|NP_231618.1| ribonuclease D [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591319|ref|ZP_01678609.1| ribonuclease D [Vibrio cholerae 2740-80]
 gi|147675516|ref|YP_001217510.1| ribonuclease D [Vibrio cholerae O395]
 gi|153819311|ref|ZP_01971978.1| ribonuclease D [Vibrio cholerae NCTC 8457]
 gi|227082111|ref|YP_002810662.1| ribonuclease D [Vibrio cholerae M66-2]
 gi|229507927|ref|ZP_04397432.1| ribonuclease D [Vibrio cholerae BX 330286]
 gi|229511838|ref|ZP_04401317.1| ribonuclease D [Vibrio cholerae B33]
 gi|229518974|ref|ZP_04408417.1| ribonuclease D [Vibrio cholerae RC9]
 gi|229607472|ref|YP_002878120.1| ribonuclease D [Vibrio cholerae MJ-1236]
 gi|254849070|ref|ZP_05238420.1| ribonuclease D [Vibrio cholerae MO10]
 gi|298497984|ref|ZP_07007791.1| ribonuclease D [Vibrio cholerae MAK 757]
 gi|9656525|gb|AAF95132.1| ribonuclease D [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121546819|gb|EAX56983.1| ribonuclease D [Vibrio cholerae 2740-80]
 gi|126510131|gb|EAZ72725.1| ribonuclease D [Vibrio cholerae NCTC 8457]
 gi|146317399|gb|ABQ21938.1| ribonuclease D [Vibrio cholerae O395]
 gi|227009999|gb|ACP06211.1| ribonuclease D [Vibrio cholerae M66-2]
 gi|227013881|gb|ACP10091.1| ribonuclease D [Vibrio cholerae O395]
 gi|229343663|gb|EEO08638.1| ribonuclease D [Vibrio cholerae RC9]
 gi|229351803|gb|EEO16744.1| ribonuclease D [Vibrio cholerae B33]
 gi|229355432|gb|EEO20353.1| ribonuclease D [Vibrio cholerae BX 330286]
 gi|229370127|gb|ACQ60550.1| ribonuclease D [Vibrio cholerae MJ-1236]
 gi|254844775|gb|EET23189.1| ribonuclease D [Vibrio cholerae MO10]
 gi|297542317|gb|EFH78367.1| ribonuclease D [Vibrio cholerae MAK 757]
          Length = 381

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQVGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVEQVTQAGWWDA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|320173702|gb|EFW48889.1| Ribonuclease D [Shigella dysenteriae CDC 74-1112]
          Length = 371

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPAITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I S          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILSAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|118582016|ref|YP_903266.1| 3'-5' exonuclease [Pelobacter propionicus DSM 2379]
 gi|118504726|gb|ABL01209.1| 3'-5' exonuclease [Pelobacter propionicus DSM 2379]
          Length = 382

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 49/173 (28%), Positives = 72/173 (41%), Gaps = 4/173 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           +      +AVD E   L   R+++C++Q+S    +  I  +A    +   L   L +   
Sbjct: 26  SINSEREVAVDLEMDSLHHYREKVCLIQISTRTESWLIDPLALK--DLSPLAAPLGNRDI 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
             + H   +DI  L    G+ V  +F T IASRL        GL   LK   GI ++K  
Sbjct: 84  LIVMHGADYDIRSLHRDHGIEVTNLFDTMIASRLLGITEF--GLAALLKARFGIELNKKY 141

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           Q +DWS   LS E   YA +D   L  L     ++L   GR       C  + 
Sbjct: 142 QKADWSKRPLSPEMRAYAVADTADLLRLYDMLRDELLEKGRLAWLEEECRLVC 194


>gi|156086202|ref|XP_001610510.1| DNA polymerase I [Babesia bovis T2Bo]
 gi|154797763|gb|EDO06942.1| DNA polymerase I, putative [Babesia bovis]
          Length = 1613

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 87/192 (45%), Gaps = 8/192 (4%)

Query: 18   RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ----KNAPNLVGMLVDE 73
             +     +D ET GL  R DR+ ++Q+S  D    +I +        K    LV +L   
Sbjct: 1054 EHTKLCTLDIETTGLNHREDRIRLLQISTPDQPSVVIDVFKVPVPTLKECTWLVKLL-GS 1112

Query: 74   KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT--RTYTNQHGLKDNLKELLGINI 131
            +  K+ H G+FDI  L +       P+F T IA++L     +     L    +  L I +
Sbjct: 1113 QAVKVLHNGKFDINFLSHNGFNVKGPIFDTMIAAKLLSATRFNWSCKLGHVAERYLNIVL 1172

Query: 132  SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRA 191
             K+QQ SDW+ D L +EQ+ YA+ D   L  L     EKL+      +A      ++   
Sbjct: 1173 DKSQQFSDWTLDPLFEEQVIYASRDTAVLLPLYFILQEKLKAERLDMIADIENKCVLAVC 1232

Query: 192  ELDLLGWE-NVD 202
            +++  G + ++D
Sbjct: 1233 QMEQNGIKVDLD 1244


>gi|323152955|gb|EFZ39224.1| ribonuclease D [Escherichia coli EPECa14]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|239992935|ref|ZP_04713459.1| ribonuclease D [Alteromonas macleodii ATCC 27126]
          Length = 385

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 79/180 (43%), Gaps = 5/180 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA+  +A+A+DTE +        L ++QL  G   V I  +A    N    + ++ + + 
Sbjct: 18  AAQRQEAVALDTEFVRTKTLTPHLGLIQLYDGHQLVLIDPLA--IDNMQPFIDLMENTEV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    DI      F     PVF T++A  +        G    ++ L  I++ K +
Sbjct: 76  VKVLHSCSEDIEAFLTAFDTVPTPVFDTQLAGSILDMGP-SLGYAKLVELLCDISLDKGE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL--MDRAEL 193
             +DW A  L + QL YAA+DV++L     Q   K+Q  G+          L    RA++
Sbjct: 135 SRTDWLARPLREAQLSYAANDVLYLLPCYQQLASKVQEAGKVHWIYQEIALLVDKKRAQM 194


>gi|309788586|ref|ZP_07683188.1| ribonuclease D [Shigella dysenteriae 1617]
 gi|308923613|gb|EFP69118.1| ribonuclease D [Shigella dysenteriae 1617]
          Length = 275

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 23  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 81  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 140 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|222053523|ref|YP_002535885.1| 3'-5' exonuclease [Geobacter sp. FRC-32]
 gi|221562812|gb|ACM18784.1| 3'-5' exonuclease [Geobacter sp. FRC-32]
          Length = 390

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 6/186 (3%)

Query: 8   EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           + D+          + +A D E   L    +++C++Q+S    T  I  +A    +   L
Sbjct: 26  QKDLNLLVEQLSRENILAFDLEADSLHHYTEKVCLIQVSNLSQTALIDPLAPV--DLSPL 83

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D    K+FH   +D+  L+  FG+ V  +F T IA +         GL   LK+ 
Sbjct: 84  APVLADRGIRKVFHGADYDMRSLYRDFGLEVCNMFDTMIACQFLGEKEV--GLAAALKKR 141

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G+ ++K  Q +DWS    S E ++YA  D   L  L LQ  E+L+  GR +        
Sbjct: 142 FGVELNKKYQKADWSKRPFSAEMIEYAKMDTALLIRLYLQLEEELRAKGRLEWVEEESEL 201

Query: 187 L-MDRA 191
           +   RA
Sbjct: 202 VSCVRA 207


>gi|119384625|ref|YP_915681.1| ribonuclease D [Paracoccus denitrificans PD1222]
 gi|119374392|gb|ABL69985.1| ribonuclease D [Paracoccus denitrificans PD1222]
          Length = 401

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 80/186 (43%), Gaps = 10/186 (5%)

Query: 11  IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGD--------GTVDIIRIAAGQK 61
           +   C   +    + +DTE L       +LC++Q +           G   +I       
Sbjct: 22  LAEFCELAKAEPYVTLDTEFLRERTYYSKLCLIQAALPPASATKAAGGLSVLIDPLVEGL 81

Query: 62  NAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKD 121
           +   L  +   +   K+FH  R D+ + F+  GV   P+F T+IA+     +  Q G + 
Sbjct: 82  SLEPLYDLFRHKPTVKVFHAARQDLEIFFHDAGVMPDPLFDTQIAAM-VCGFGEQVGYET 140

Query: 122 NLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT 181
            +K++    + K+ + +DWS   LSD Q  YA +DV HL A+    + +L + GR+    
Sbjct: 141 LVKKIARQPLDKSSRFTDWSHRPLSDAQAAYALADVTHLRAIYEFLSAQLDKTGRAPWLA 200

Query: 182 SCCNFL 187
                L
Sbjct: 201 EEVAVL 206


>gi|308187080|ref|YP_003931211.1| RNase D, processes tRNA precursor [Pantoea vagans C9-1]
 gi|308057590|gb|ADO09762.1| RNase D, processes tRNA precursor [Pantoea vagans C9-1]
          Length = 373

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 49/196 (25%), Positives = 81/196 (41%), Gaps = 7/196 (3%)

Query: 2   TTIRVHEGD--IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               + + D  +   C  AR   A+A+DTE +       +L ++QL      V I  +  
Sbjct: 1   MNYSLIDQDEQLADVCQKARQHAAVALDTEFVRTRTYYPQLGLIQLFDDHQLVLIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++    + +L D    K  H G  D+ V  + FGV   P+  T+I +          G
Sbjct: 59  NIRDWSPFIALLTDTSVTKFLHAGGEDLEVFLHRFGVLPTPMIDTQILAAF-SGQPLSWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +     + + K++  +DW A  L+  Q +YAA+DV +L  +  Q     +  G   
Sbjct: 118 FASMVAHFTQVELDKSESRTDWLARPLTQRQCEYAAADVHYLLPIARQLMINTEEAGNMA 177

Query: 179 LATSCCNFLMDRAELD 194
            A S C+ L  R  LD
Sbjct: 178 AALSECDNLCQR-RLD 192


>gi|300904667|ref|ZP_07122502.1| ribonuclease D [Escherichia coli MS 84-1]
 gi|301305900|ref|ZP_07211983.1| ribonuclease D [Escherichia coli MS 124-1]
 gi|300403417|gb|EFJ86955.1| ribonuclease D [Escherichia coli MS 84-1]
 gi|300838826|gb|EFK66586.1| ribonuclease D [Escherichia coli MS 124-1]
 gi|315257385|gb|EFU37353.1| ribonuclease D [Escherichia coli MS 85-1]
 gi|323180583|gb|EFZ66128.1| ribonuclease D [Escherichia coli 1180]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|323186982|gb|EFZ72300.1| ribonuclease D [Escherichia coli RN587/1]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|320181157|gb|EFW56076.1| Ribonuclease D [Shigella boydii ATCC 9905]
 gi|332089922|gb|EGI95022.1| ribonuclease D [Shigella boydii 5216-82]
 gi|332093315|gb|EGI98374.1| ribonuclease D [Shigella dysenteriae 155-74]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKSILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|117623964|ref|YP_852877.1| ribonuclease D [Escherichia coli APEC O1]
 gi|227885769|ref|ZP_04003574.1| ribonuclease D [Escherichia coli 83972]
 gi|237705754|ref|ZP_04536235.1| ribonuclease D [Escherichia sp. 3_2_53FAA]
 gi|300994259|ref|ZP_07180813.1| ribonuclease D [Escherichia coli MS 45-1]
 gi|301050852|ref|ZP_07197705.1| ribonuclease D [Escherichia coli MS 185-1]
 gi|306814949|ref|ZP_07449105.1| ribonuclease D [Escherichia coli NC101]
 gi|312967002|ref|ZP_07781220.1| ribonuclease D [Escherichia coli 2362-75]
 gi|331657844|ref|ZP_08358806.1| ribonuclease D [Escherichia coli TA206]
 gi|115513088|gb|ABJ01163.1| Ribonuclease D [Escherichia coli APEC O1]
 gi|222033551|emb|CAP76292.1| ribonuclease D [Escherichia coli LF82]
 gi|226900511|gb|EEH86770.1| ribonuclease D [Escherichia sp. 3_2_53FAA]
 gi|227837342|gb|EEJ47808.1| ribonuclease D [Escherichia coli 83972]
 gi|300297490|gb|EFJ53875.1| ribonuclease D [Escherichia coli MS 185-1]
 gi|300406325|gb|EFJ89863.1| ribonuclease D [Escherichia coli MS 45-1]
 gi|305851597|gb|EFM52050.1| ribonuclease D [Escherichia coli NC101]
 gi|307553822|gb|ADN46597.1| ribonuclease D [Escherichia coli ABU 83972]
 gi|307626717|gb|ADN71021.1| ribonuclease D [Escherichia coli UM146]
 gi|312288466|gb|EFR16368.1| ribonuclease D [Escherichia coli 2362-75]
 gi|312946400|gb|ADR27227.1| ribonuclease D [Escherichia coli O83:H1 str. NRG 857C]
 gi|315286519|gb|EFU45954.1| ribonuclease D [Escherichia coli MS 110-3]
 gi|315290392|gb|EFU49767.1| ribonuclease D [Escherichia coli MS 153-1]
 gi|315299924|gb|EFU59162.1| ribonuclease D [Escherichia coli MS 16-3]
 gi|323952305|gb|EGB48178.1| ribonuclease D [Escherichia coli H252]
 gi|323956433|gb|EGB52175.1| ribonuclease D [Escherichia coli H263]
 gi|323978014|gb|EGB73100.1| ribonuclease D [Escherichia coli TW10509]
 gi|324007181|gb|EGB76400.1| ribonuclease D [Escherichia coli MS 57-2]
 gi|331056092|gb|EGI28101.1| ribonuclease D [Escherichia coli TA206]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|195937492|ref|ZP_03082874.1| ribonuclease D [Escherichia coli O157:H7 str. EC4024]
 gi|256018008|ref|ZP_05431873.1| ribonuclease D [Shigella sp. D9]
 gi|261227700|ref|ZP_05941981.1| ribonuclease D [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258135|ref|ZP_05950668.1| ribonuclease D [Escherichia coli O157:H7 str. FRIK966]
 gi|293405300|ref|ZP_06649292.1| ribonuclease D [Escherichia coli FVEC1412]
 gi|298380942|ref|ZP_06990541.1| ribonuclease D [Escherichia coli FVEC1302]
 gi|300816311|ref|ZP_07096533.1| ribonuclease D [Escherichia coli MS 107-1]
 gi|300823140|ref|ZP_07103273.1| ribonuclease D [Escherichia coli MS 119-7]
 gi|300899043|ref|ZP_07117330.1| ribonuclease D [Escherichia coli MS 198-1]
 gi|300917626|ref|ZP_07134277.1| ribonuclease D [Escherichia coli MS 115-1]
 gi|300924870|ref|ZP_07140803.1| ribonuclease D [Escherichia coli MS 182-1]
 gi|307314118|ref|ZP_07593730.1| ribonuclease D [Escherichia coli W]
 gi|309794180|ref|ZP_07688604.1| ribonuclease D [Escherichia coli MS 145-7]
 gi|331663292|ref|ZP_08364202.1| ribonuclease D [Escherichia coli TA143]
 gi|331668492|ref|ZP_08369340.1| ribonuclease D [Escherichia coli TA271]
 gi|331673338|ref|ZP_08374106.1| ribonuclease D [Escherichia coli TA280]
 gi|331677680|ref|ZP_08378355.1| ribonuclease D [Escherichia coli H591]
 gi|291427508|gb|EFF00535.1| ribonuclease D [Escherichia coli FVEC1412]
 gi|298278384|gb|EFI19898.1| ribonuclease D [Escherichia coli FVEC1302]
 gi|300357343|gb|EFJ73213.1| ribonuclease D [Escherichia coli MS 198-1]
 gi|300415143|gb|EFJ98453.1| ribonuclease D [Escherichia coli MS 115-1]
 gi|300418949|gb|EFK02260.1| ribonuclease D [Escherichia coli MS 182-1]
 gi|300524294|gb|EFK45363.1| ribonuclease D [Escherichia coli MS 119-7]
 gi|300531001|gb|EFK52063.1| ribonuclease D [Escherichia coli MS 107-1]
 gi|306906256|gb|EFN36773.1| ribonuclease D [Escherichia coli W]
 gi|308122085|gb|EFO59347.1| ribonuclease D [Escherichia coli MS 145-7]
 gi|315061107|gb|ADT75434.1| ribonuclease D [Escherichia coli W]
 gi|320188500|gb|EFW63162.1| Ribonuclease D [Escherichia coli O157:H7 str. EC1212]
 gi|320197983|gb|EFW72591.1| Ribonuclease D [Escherichia coli EC4100B]
 gi|320641655|gb|EFX11043.1| ribonuclease D [Escherichia coli O157:H7 str. G5101]
 gi|320647014|gb|EFX15847.1| ribonuclease D [Escherichia coli O157:H- str. 493-89]
 gi|320652296|gb|EFX20594.1| ribonuclease D [Escherichia coli O157:H- str. H 2687]
 gi|320657898|gb|EFX25660.1| ribonuclease D [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320658471|gb|EFX26165.1| ribonuclease D [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668369|gb|EFX35196.1| ribonuclease D [Escherichia coli O157:H7 str. LSU-61]
 gi|323158715|gb|EFZ44729.1| ribonuclease D [Escherichia coli E128010]
 gi|323186449|gb|EFZ71797.1| ribonuclease D [Escherichia coli 1357]
 gi|323378318|gb|ADX50586.1| ribonuclease D [Escherichia coli KO11]
 gi|323948311|gb|EGB44299.1| ribonuclease D [Escherichia coli H120]
 gi|324018061|gb|EGB87280.1| ribonuclease D [Escherichia coli MS 117-3]
 gi|324118864|gb|EGC12753.1| ribonuclease D [Escherichia coli E1167]
 gi|326342179|gb|EGD65960.1| Ribonuclease D [Escherichia coli O157:H7 str. 1044]
 gi|326343729|gb|EGD67491.1| Ribonuclease D [Escherichia coli O157:H7 str. 1125]
 gi|331059091|gb|EGI31068.1| ribonuclease D [Escherichia coli TA143]
 gi|331063686|gb|EGI35597.1| ribonuclease D [Escherichia coli TA271]
 gi|331069536|gb|EGI40923.1| ribonuclease D [Escherichia coli TA280]
 gi|331074140|gb|EGI45460.1| ribonuclease D [Escherichia coli H591]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|24374123|ref|NP_718166.1| ribonuclease D [Shewanella oneidensis MR-1]
 gi|24348616|gb|AAN55610.1|AE015699_8 ribonuclease D [Shewanella oneidensis MR-1]
          Length = 367

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 71/166 (42%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  IA    +      +L +    K
Sbjct: 19  QQSPLLVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPIAL--PDLSAFWALLDNPNIIK 76

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 77  LVHSCSEDLEVFAHYGQRQPTPLFDSQIAA-SLCGMGHGLGYAKLVETCLGEVIDKGESR 135

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L+D QL YAA+DV++L+ L  Q  EKLQ   R D     
Sbjct: 136 TDWMRRPLTDAQLSYAANDVLYLYQLYPQLAEKLQTQDRLDWLYEE 181


>gi|260366009|ref|ZP_05778494.1| ribonuclease D [Vibrio parahaemolyticus K5030]
 gi|308111259|gb|EFO48799.1| ribonuclease D [Vibrio parahaemolyticus K5030]
          Length = 292

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 6/188 (3%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   CA AR  D + +DTE + +     +L ++QL  G     I      
Sbjct: 18  NYQIITKNKDLEQVCAQARDADVVMLDTEFVRIRTFYPQLGLIQLFDGKHLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +  + + +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTSFIELLKDASVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+   G  + 
Sbjct: 135 ATLVEEYLGVALDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTEAGWWEA 194

Query: 180 ATSCCNFL 187
                + L
Sbjct: 195 VQQESDLL 202


>gi|331647298|ref|ZP_08348392.1| ribonuclease D [Escherichia coli M605]
 gi|330911610|gb|EGH40120.1| ribonuclease D [Escherichia coli AA86]
 gi|331044081|gb|EGI16217.1| ribonuclease D [Escherichia coli M605]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNIFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|15802217|ref|NP_288240.1| ribonuclease D [Escherichia coli O157:H7 EDL933]
 gi|12515844|gb|AAG56793.1|AE005403_4 RNase D, processes tRNA precursor [Escherichia coli O157:H7 str.
           EDL933]
          Length = 375

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 23  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 81  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 140 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|30062942|ref|NP_837113.1| ribonuclease D [Shigella flexneri 2a str. 2457T]
 gi|56479892|ref|NP_707318.2| ribonuclease D [Shigella flexneri 2a str. 301]
 gi|30041191|gb|AAP16920.1| RNase D [Shigella flexneri 2a str. 2457T]
 gi|56383443|gb|AAN43025.2| RNase D [Shigella flexneri 2a str. 301]
 gi|313649164|gb|EFS13598.1| ribonuclease D [Shigella flexneri 2a str. 2457T]
 gi|332758877|gb|EGJ89192.1| ribonuclease D [Shigella flexneri 2747-71]
 gi|332762455|gb|EGJ92720.1| ribonuclease D [Shigella flexneri 4343-70]
 gi|332767130|gb|EGJ97325.1| ribonuclease D [Shigella flexneri 2930-71]
 gi|333004261|gb|EGK23792.1| ribonuclease D [Shigella flexneri K-218]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|157373237|ref|YP_001471837.1| DNA-directed DNA polymerase [Shewanella sediminis HAW-EB3]
 gi|157315611|gb|ABV34709.1| DNA-directed DNA polymerase [Shewanella sediminis HAW-EB3]
          Length = 933

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 80/215 (37%), Gaps = 20/215 (9%)

Query: 2   TTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           +TI  H+  +          +  AVDTET  L     +L  +  +   G    + +A   
Sbjct: 335 STILTHDE-LDEWIDKLSKAELFAVDTETTSLNYMEAKLVGLSFAVEAGKAAYLPLAHDY 393

Query: 61  KNAPN----------LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT 110
            +AP           L  +L + + +K+    ++D+++L           F T + S + 
Sbjct: 394 LDAPQQLNQAEALAKLKPLLENPEIKKVGQNLKYDMSILANVGIKLQGIAFDTMLESYVF 453

Query: 111 RTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALR 164
            +  ++H + D   + LG      ++ +   A  L+  Q+       YAA D      L 
Sbjct: 454 NSVASKHNMDDLALKYLGHKNISFEEIAGKGAKQLTFNQISLEVAAPYAAEDADITLRLH 513

Query: 165 LQFTEKLQRL-GRSDLATS-CCNFLMDRAELDLLG 197
                +LQ+    + + T      +   ++++  G
Sbjct: 514 QHLWPRLQKEPELASIFTEIELPLVQVLSDMERQG 548


>gi|253773243|ref|YP_003036074.1| ribonuclease D [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|297516497|ref|ZP_06934883.1| ribonuclease D [Escherichia coli OP50]
 gi|300927881|ref|ZP_07143442.1| ribonuclease D [Escherichia coli MS 187-1]
 gi|312969840|ref|ZP_07784023.1| ribonuclease D [Escherichia coli 1827-70]
 gi|253324287|gb|ACT28889.1| ribonuclease D [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|300464070|gb|EFK27563.1| ribonuclease D [Escherichia coli MS 187-1]
 gi|310338125|gb|EFQ03214.1| ribonuclease D [Escherichia coli 1827-70]
 gi|323961858|gb|EGB57457.1| ribonuclease D [Escherichia coli H489]
 gi|323972689|gb|EGB67892.1| ribonuclease D [Escherichia coli TA007]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|300938850|ref|ZP_07153558.1| ribonuclease D [Escherichia coli MS 21-1]
 gi|300456240|gb|EFK19733.1| ribonuclease D [Escherichia coli MS 21-1]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|110641921|ref|YP_669651.1| ribonuclease D [Escherichia coli 536]
 gi|300981914|ref|ZP_07175784.1| ribonuclease D [Escherichia coli MS 200-1]
 gi|110343513|gb|ABG69750.1| ribonuclease D [Escherichia coli 536]
 gi|300307392|gb|EFJ61912.1| ribonuclease D [Escherichia coli MS 200-1]
 gi|324011590|gb|EGB80809.1| ribonuclease D [Escherichia coli MS 60-1]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|170019851|ref|YP_001724805.1| ribonuclease D [Escherichia coli ATCC 8739]
 gi|256022532|ref|ZP_05436397.1| ribonuclease D [Escherichia sp. 4_1_40B]
 gi|293415119|ref|ZP_06657762.1| ribonuclease D [Escherichia coli B185]
 gi|300951410|ref|ZP_07165251.1| ribonuclease D [Escherichia coli MS 116-1]
 gi|300956696|ref|ZP_07168970.1| ribonuclease D [Escherichia coli MS 175-1]
 gi|301645686|ref|ZP_07245613.1| ribonuclease D [Escherichia coli MS 146-1]
 gi|307138464|ref|ZP_07497820.1| ribonuclease D [Escherichia coli H736]
 gi|331642413|ref|ZP_08343548.1| ribonuclease D [Escherichia coli H736]
 gi|331653208|ref|ZP_08354213.1| ribonuclease D [Escherichia coli M718]
 gi|169754779|gb|ACA77478.1| ribonuclease D [Escherichia coli ATCC 8739]
 gi|260449075|gb|ACX39497.1| ribonuclease D [Escherichia coli DH1]
 gi|291432767|gb|EFF05746.1| ribonuclease D [Escherichia coli B185]
 gi|300316496|gb|EFJ66280.1| ribonuclease D [Escherichia coli MS 175-1]
 gi|300449336|gb|EFK12956.1| ribonuclease D [Escherichia coli MS 116-1]
 gi|301076058|gb|EFK90864.1| ribonuclease D [Escherichia coli MS 146-1]
 gi|323937062|gb|EGB33342.1| ribonuclease D [Escherichia coli E1520]
 gi|323940530|gb|EGB36721.1| ribonuclease D [Escherichia coli E482]
 gi|331039211|gb|EGI11431.1| ribonuclease D [Escherichia coli H736]
 gi|331049306|gb|EGI21378.1| ribonuclease D [Escherichia coli M718]
 gi|332343528|gb|AEE56862.1| ribonuclease D [Escherichia coli UMNK88]
 gi|333006772|gb|EGK26269.1| ribonuclease D [Shigella flexneri K-272]
          Length = 371

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|256372386|ref|YP_003110210.1| 3'-5' exonuclease [Acidimicrobium ferrooxidans DSM 10331]
 gi|256008970|gb|ACU54537.1| 3'-5' exonuclease [Acidimicrobium ferrooxidans DSM 10331]
          Length = 396

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 82/191 (42%), Gaps = 10/191 (5%)

Query: 8   EGDIPAECAAR-YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           + D+         V  IA+DTE         RL +VQ++       I  +         L
Sbjct: 27  QSDLDELVGVGLGVPRIAIDTEFHRERTYYPRLALVQVAIDRRVWLIDPLRVD------L 80

Query: 67  VGMLVDEKR-EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
             +       E +FH    D+ ++    G R R +F T++A            L   L  
Sbjct: 81  SPIAAWFDEVELVFHAADQDLEIIERAVGARPRRIFDTQVAGGFLGAGHAS--LGALLDR 138

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
            LG++ISKA+++SDW    L   QL YAA+DV +L AL  +  E+L   GR D A S   
Sbjct: 139 YLGVSISKAERTSDWLRRPLEPGQLAYAANDVRYLAALADRLLEELHARGREDWARSEMA 198

Query: 186 FLMDRAELDLL 196
            L++R   D+ 
Sbjct: 199 RLVERRRRDIE 209


>gi|224023510|ref|ZP_03641876.1| hypothetical protein BACCOPRO_00212 [Bacteroides coprophilus DSM
           18228]
 gi|224016732|gb|EEF74744.1| hypothetical protein BACCOPRO_00212 [Bacteroides coprophilus DSM
           18228]
          Length = 932

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 66/210 (31%), Gaps = 16/210 (7%)

Query: 3   TIRVHEGDIPAECAARY---VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++ + +       +       +++DTET    P R  L  +  S  +     + + A 
Sbjct: 339 NYQLVDNEEKLSQLLQNIVTQSVLSLDTETTSTDPIRAELVGMSFSYAENQAFYVPVPAD 398

Query: 60  QKNAP----NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           +  A         +  + +  K+    ++D+ VL         P+F T +A  + +    
Sbjct: 399 RSEAQKIVDRFRPVFENREIMKVGQNIKYDMLVLANYGVQLQGPLFDTMVAHYVLQPELR 458

Query: 116 QH-------GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFT 168
            +        L      +  +   K +   +   D       +YA  D      L+ +  
Sbjct: 459 HNMDYLAEIYLNYQTIHIEELIGPKGKNQGNM-RDLPPASVYEYACEDADVTLKLKNKLE 517

Query: 169 EKLQRLGRSDLATS-CCNFLMDRAELDLLG 197
           ++L       L        +   A ++  G
Sbjct: 518 KELDENNVRKLFEEIEMPLIPVLAYMERNG 547


>gi|78485923|ref|YP_391848.1| 3'-5' exonuclease [Thiomicrospira crunogena XCL-2]
 gi|78364209|gb|ABB42174.1| ribonuclease D [Thiomicrospira crunogena XCL-2]
          Length = 385

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 6/189 (3%)

Query: 2   TTIRVH--EGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   + D+ A C   +    IA+DTE +        L ++Q+   DG   II   A
Sbjct: 1   MDYKIINQQADLDAFCELLKTCPWIALDTEFVRTDTYFSILSLIQIQTHDGQAAIIDPLA 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
            + +   L  ++ +    K+FH  R DI VL+   G     ++ T+IA    +      G
Sbjct: 61  IE-DLTALWSIISNPNVRKVFHSARQDIEVLYQVSGQMPISIYDTQIACLFLQHGDL-AG 118

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
           L   +K  L   + K Q  ++W    L+D+QL+YA +DV +L  L  +   +L    ++ 
Sbjct: 119 LARVVKAELNFTLEKDQTRTNWQQRPLTDKQLEYAINDVRYLAPLYEKLQAELTEQQQAA 178

Query: 179 LATSCCNFL 187
           L       L
Sbjct: 179 L-EEDFQAL 186


>gi|262171029|ref|ZP_06038707.1| ribonuclease D [Vibrio mimicus MB-451]
 gi|261892105|gb|EEY38091.1| ribonuclease D [Vibrio mimicus MB-451]
          Length = 381

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 85/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIITQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTV-- 67

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 68  IDEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G  + 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAGWWEA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|258626516|ref|ZP_05721356.1| ribonuclease D [Vibrio mimicus VM603]
 gi|258581227|gb|EEW06136.1| ribonuclease D [Vibrio mimicus VM603]
          Length = 385

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 85/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 14  NYQIITQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTV-- 71

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 72  IDEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 130

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G  + 
Sbjct: 131 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAGWWEA 190

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 191 ALQESELQVAKRTKVSNPELAYLDIKG 217


>gi|325914723|ref|ZP_08177061.1| ribonuclease D [Xanthomonas vesicatoria ATCC 35937]
 gi|325539000|gb|EGD10658.1| ribonuclease D [Xanthomonas vesicatoria ATCC 35937]
          Length = 364

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 51/188 (27%), Positives = 80/188 (42%), Gaps = 3/188 (1%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  L
Sbjct: 7   HPSELTERLQAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNEA--L 64

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E+
Sbjct: 65  KEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 123

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + + +L  L R          
Sbjct: 124 TGTLLTKGETRSDWMRRPLSASQLEYAADDVRYLFAIHDELSRRLTELDRLGWLAEDAER 183

Query: 187 LMDRAELD 194
           L+   E D
Sbjct: 184 LLATVEHD 191


>gi|331683306|ref|ZP_08383907.1| ribonuclease D [Escherichia coli H299]
 gi|331079521|gb|EGI50718.1| ribonuclease D [Escherichia coli H299]
          Length = 371

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GISDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|290475404|ref|YP_003468292.1| RNase D, processes tRNA [Xenorhabdus bovienii SS-2004]
 gi|289174725|emb|CBJ81524.1| RNase D, processes tRNA precursor [Xenorhabdus bovienii SS-2004]
          Length = 385

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/191 (21%), Positives = 77/191 (40%), Gaps = 6/191 (3%)

Query: 3   TIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++   D  + + C  A+    IA+DTE +       +L ++QL  G+    I  +   
Sbjct: 12  NYQLITSDAQLQSICERAKKHATIALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPL--D 69

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                    +L D    K  H G  D+ V + +F     P+  T++ +          G 
Sbjct: 70  ISEWQPFRELLTDRDVLKFIHAGSEDLEVFWNSFQCLPTPMIDTQVLAAFIGHPM-SCGF 128

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + + L + + K++  +DW A  LS++Q +YAA+DV +L  L        ++ G    
Sbjct: 129 ATLVAQYLHVELDKSESRTDWLARPLSEKQCEYAAADVYYLLPLADILMAATEQAGYMGA 188

Query: 180 ATSCCNFLMDR 190
           A      +  R
Sbjct: 189 AQDESYLIAQR 199


>gi|304396155|ref|ZP_07378037.1| ribonuclease D [Pantoea sp. aB]
 gi|304356524|gb|EFM20889.1| ribonuclease D [Pantoea sp. aB]
          Length = 373

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/196 (25%), Positives = 82/196 (41%), Gaps = 7/196 (3%)

Query: 2   TTIRVH-EGDIPAEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               +  + D  A+    AR   A+A+DTE +       +L ++QL      V I  +  
Sbjct: 1   MNYSLIDQNDQLADVCQKARQQAAVALDTEFVRTRTYYPQLGLIQLFDDHQLVLIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++    + +L D +  K  H G  D+ V  + FGV   P+  T+I +          G
Sbjct: 59  NIRDWSPFIALLTDTRVTKFLHAGGEDLEVFLHRFGVLPTPMIDTQILAAF-SGQPLSWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +     + + K++  +DW A  L+  Q +YAA+DV +L  +  Q     +  G   
Sbjct: 118 FASMVAHFTQVELDKSESRTDWLARPLTQRQCEYAAADVHYLLPIARQLMINTEEAGNMA 177

Query: 179 LATSCCNFLMDRAELD 194
            A S C+ L  R  LD
Sbjct: 178 AALSECDNLCQR-RLD 192


>gi|269967938|ref|ZP_06181978.1| ribonuclease D [Vibrio alginolyticus 40B]
 gi|269827461|gb|EEZ81755.1| ribonuclease D [Vibrio alginolyticus 40B]
          Length = 388

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 86/206 (41%), Gaps = 9/206 (4%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   C  AR  D + +DTE + +     +L ++QL  G+    I      
Sbjct: 18  NYQIITKNKDLEEVCTHAREADVVMLDTEFVRIRTFYPQLGLIQLFDGNRLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +    V +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTPFVALLKDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G  + 
Sbjct: 135 ASLVEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLFDKVTQAGWWEA 194

Query: 180 ATSCCNFL---MDRAELDLLGWENVD 202
                + L     R   +   + ++ 
Sbjct: 195 VQQESDLLVSKRIRVTNEENAYLDIK 220


>gi|258566335|ref|XP_002583912.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237907613|gb|EEP82014.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 635

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 7/171 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    I +D E          +C++Q+S  D    +  +   ++    L  +  + +  
Sbjct: 243 LKCAKEIGIDLEHHDTHSYYGLVCLMQISTRDKDWIVDTLLPWREELQILNEVFANPQIV 302

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+  L    G+ +  +F T  A+     +  +  LK  L + +     K  Q
Sbjct: 303 KVLHGSSMDVIWLQRDLGLYLVGLFDTYHAAAAL--HYPKKSLKFLLDKFVNFQAEKKYQ 360

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQR-----LGRSDLATS 182
            +DW    L      YA SD  +L  +      +L           D    
Sbjct: 361 IADWRVRPLLPGMFDYARSDTHYLLYIYDHLRNELIERSTPGENLIDYVQE 411


>gi|262394860|ref|YP_003286714.1| ribonuclease D [Vibrio sp. Ex25]
 gi|262338454|gb|ACY52249.1| ribonuclease D [Vibrio sp. Ex25]
          Length = 388

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 86/206 (41%), Gaps = 9/206 (4%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   C  AR  D + +DTE + +     +L ++QL  G+    I      
Sbjct: 18  NYQIITKNKDLEEVCIHAREADVVMLDTEFVRIRTFYPQLGLIQLFDGNRLSLIDPTEL- 76

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +    V +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 77  -TDMTPFVALLKDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 134

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G  + 
Sbjct: 135 ASLVEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLLDKVTQAGWWEA 194

Query: 180 ATSCCNFL---MDRAELDLLGWENVD 202
                + L     R   +   + ++ 
Sbjct: 195 VQQESDLLVSKRIRVTNEENAYLDIK 220


>gi|283781120|ref|YP_003371875.1| 3'-5' exonuclease [Pirellula staleyi DSM 6068]
 gi|283439573|gb|ADB18015.1| 3'-5' exonuclease [Pirellula staleyi DSM 6068]
          Length = 399

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 3/169 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + IA DTE +     +  LC++Q++       I  +    ++      +L +  RE
Sbjct: 19  LASAEIIAFDTEFVSEDSYQPELCLIQVAADGNLAIIDPLEV--QDLSPFWNLLTEPGRE 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
            + H GR +    F   G R    F  +IA+                + L+G ++ K + 
Sbjct: 77  TLVHAGREEFRFCFKGAGRRPHKWFDVQIAA-GLIGMEFPASYGTLAQRLIGKSLPKDET 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
            +DW    LS  QL+YA  DV+ L  +R     KL++LGR     +   
Sbjct: 136 RTDWRRRPLSQRQLEYALLDVLDLEQIRDVLVGKLEKLGRLSWLDTELA 184


>gi|254514489|ref|ZP_05126550.1| ribonuclease D [gamma proteobacterium NOR5-3]
 gi|219676732|gb|EED33097.1| ribonuclease D [gamma proteobacterium NOR5-3]
          Length = 372

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/196 (23%), Positives = 71/196 (36%), Gaps = 10/196 (5%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
            T  + E D  +            IAVDTE +        + ++QL   D    I  +  
Sbjct: 1   MTWTLVESDEALAEALDALSNASEIAVDTEFMRRNTYYPHIALLQLCSDDHAWLIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +   L  ++ D    K+ H    D+ V  +  GV   P+  T+ A           G
Sbjct: 59  KVTDLDGLRALMTDTGCWKVLHSCSEDLEVFRHWLGVVPSPLIDTQRA-TALLGKGFGLG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            +  ++ LLG+ + K +  SDW    LSD Q  YAA DV+ L        +     GR +
Sbjct: 118 YRALIELLLGVELDKGETRSDWLKRPLSDSQCHYAALDVLKLVPAWKILKDLALSQGRME 177

Query: 179 LATSC----CNFLMDR 190
                       L +R
Sbjct: 178 WILDEGEEAIRLLNER 193


>gi|322514433|ref|ZP_08067476.1| ribonuclease D [Actinobacillus ureae ATCC 25976]
 gi|322119681|gb|EFX91739.1| ribonuclease D [Actinobacillus ureae ATCC 25976]
          Length = 371

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/193 (23%), Positives = 75/193 (38%), Gaps = 9/193 (4%)

Query: 1   MT-TIRVHEGDIPAECA-----ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDII 54
           M   I     D   + A     A    A+ +DTE + +     +L ++QL  G+    I 
Sbjct: 1   MNQNIHYIWVDTNQKLAEVCQNASQKPAVTLDTEFIRIRTYYPKLGLIQLFDGEQVSLID 60

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
                  +    + +L +++  K+ H    D+ V  + F     P+  T+I +       
Sbjct: 61  PT--KIDDFAPFIELLANQQVVKVLHACGEDLEVFQHRFKQLPTPLVDTQIMADFAGIGV 118

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
              G    +   L I + K    +DW A  LS+EQLQYAA+DV +L  +  +    L   
Sbjct: 119 -SMGFAKLVAHYLQIELDKGASRTDWLARPLSEEQLQYAAADVWYLLPVYQRLVVDLDVT 177

Query: 175 GRSDLATSCCNFL 187
              +     C  L
Sbjct: 178 RWQNAVEEECQTL 190


>gi|91762671|ref|ZP_01264636.1| DNA polymerase I [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718473|gb|EAS85123.1| DNA polymerase I [Candidatus Pelagibacter ubique HTCC1002]
          Length = 924

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 79/219 (36%), Gaps = 18/219 (8%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +   E +I      A     +A+DTET  L   +  L  + LS   G    I I   
Sbjct: 323 NYHLITNEKEIDEWINEAEEAGELAIDTETSSLDAHQTDLVGISLSTKIGKACYIPIGHK 382

Query: 60  QKNA-------PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT 112
            K           L  +L D+  +KI    +FD  VL+         +  T + S +   
Sbjct: 383 FKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLYKHGINMN-SMEDTMLMSYVLDA 441

Query: 113 YTNQHGLKDNLKELLGINISKAQQSSDWSADDLS------DEQLQYAASDVVHLHALRLQ 166
             N+H +    +  L       ++       +++      D+ ++YAA D    + L   
Sbjct: 442 GKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAEDADITYRLYKI 501

Query: 167 FTEKLQRLGRSDLATS-CCNFLMDRAELDLLGWENVDIF 204
           F++ L+    +++        +   A +++ G +  + F
Sbjct: 502 FSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKF 540


>gi|237731840|ref|ZP_04562321.1| ribonuclease D [Citrobacter sp. 30_2]
 gi|226907379|gb|EEH93297.1| ribonuclease D [Citrobacter sp. 30_2]
          Length = 371

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 74/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I     G  +   L  +L D    K
Sbjct: 16  REFPAIALDTEFVRTRTYYPQLGLIQLFDGKHVALIDPQ--GITDWSPLRDILRDTAITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPQPLIDTQILAAFCGRPM-SWGFAAMVEEFTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 133 TDWLARPLTERQCEYAAADVWYLLPITTKLMVETEASGWLPAALDECRLMQQR 185


>gi|330829588|ref|YP_004392540.1| ribonuclease D [Aeromonas veronii B565]
 gi|328804724|gb|AEB49923.1| Ribonuclease D [Aeromonas veronii B565]
          Length = 370

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/193 (20%), Positives = 75/193 (38%), Gaps = 6/193 (3%)

Query: 2   TTIRVH--EGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              ++   + ++    A+     +A+DTE +       +L + Q+  G+    +      
Sbjct: 1   MHYQLITQQDELEQYLASLADVPLAIDTEFVRTRTYYPQLGLFQIYDGEHLALLDP---L 57

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +   L   L    +  I H    D+ ++ +  G     +  T++A+          G 
Sbjct: 58  TLDLSALWQRLGRAGQIAILHASGEDLELIQHQAGHLPNQMHDTQLATAFLGYGV-SVGF 116

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + E LG+ + K Q  +DW A  L+  QL+YAA+DV +L  L  +   KL+  G+   
Sbjct: 117 GALVNEFLGVELEKDQARTDWLARPLTPRQLEYAAADVFYLMPLYEKVMAKLRESGKFAW 176

Query: 180 ATSCCNFLMDRAE 192
               C     R  
Sbjct: 177 FEQECQNHSARKT 189


>gi|301026544|ref|ZP_07189972.1| ribonuclease D [Escherichia coli MS 69-1]
 gi|300395475|gb|EFJ79013.1| ribonuclease D [Escherichia coli MS 69-1]
          Length = 371

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPI-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|113970513|ref|YP_734306.1| ribonuclease D [Shewanella sp. MR-4]
 gi|113885197|gb|ABI39249.1| ribonuclease D [Shewanella sp. MR-4]
          Length = 384

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 70/166 (42%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L +    K
Sbjct: 36  QQSPLLVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLSAFWSLLDNPNIIK 93

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 94  LVHSCSEDLEVFAHYGQRQPTPLFDSQIAA-SLCGMGHGLGYAKLVETCLGEVIDKGESR 152

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++L+ L  Q  +KL+   R       
Sbjct: 153 TDWMRRPLTEAQLSYAANDVLYLYQLYPQLADKLKAQDRLGWLYEE 198


>gi|82776970|ref|YP_403319.1| ribonuclease D [Shigella dysenteriae Sd197]
 gi|81241118|gb|ABB61828.1| RNase D [Shigella dysenteriae Sd197]
          Length = 375

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 23  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 80

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 81  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 139

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 140 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 189


>gi|115948726|ref|XP_001193541.1| PREDICTED: similar to exosome component 10, partial
           [Strongylocentrotus purpuratus]
          Length = 776

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/160 (23%), Positives = 58/160 (36%), Gaps = 3/160 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           + +    IAVD E           C++Q+S  +    ++     +     L     D K 
Sbjct: 133 SLKQSKEIAVDLEHHSYRSYLGFTCLMQISTAEHD-YVVDTLELRSELQMLNDAFTDPKI 191

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH    D   L    G+ V  +F T  ASR      +   L   L     +   K  
Sbjct: 192 VKVFHGANMDFDWLQRDLGLYVVNMFDTHQASRSLGFPHHS--LASLLSRYCQVEADKQY 249

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q +DW    L +E L YA  D  +L  +      +L + G
Sbjct: 250 QLADWRIRPLPEEMLHYAREDTHYLLYIYHTMKNELIKRG 289


>gi|71082906|ref|YP_265625.1| DNA polymerase I [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062019|gb|AAZ21022.1| DNA polymerase I [Candidatus Pelagibacter ubique HTCC1062]
          Length = 924

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 79/219 (36%), Gaps = 18/219 (8%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +   E +I      A     +A+DTET  L   +  L  + LS   G    I I   
Sbjct: 323 NYHLITNEKEIDEWINEAEEAGELAIDTETSSLDAHQTDLVGISLSTKIGQACYIPIGHK 382

Query: 60  QKNA-------PNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT 112
            K           L  +L D+  +KI    +FD  VL+         +  T + S +   
Sbjct: 383 FKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLYKQGINMN-SMEDTMLMSYVLDA 441

Query: 113 YTNQHGLKDNLKELLGINISKAQQSSDWSADDLS------DEQLQYAASDVVHLHALRLQ 166
             N+H +    +  L       ++       +++      D+ ++YAA D    + L   
Sbjct: 442 GKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAEDADITYRLYKI 501

Query: 167 FTEKLQRLGRSDLATS-CCNFLMDRAELDLLGWENVDIF 204
           F++ L+    +++        +   A +++ G +  + F
Sbjct: 502 FSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKF 540


>gi|33152538|ref|NP_873891.1| ribonuclease D [Haemophilus ducreyi 35000HP]
 gi|33148762|gb|AAP96280.1| ribonuclease D [Haemophilus ducreyi 35000HP]
          Length = 373

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 72/182 (39%), Gaps = 5/182 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A    AIA+DTE +       +  ++QL  G+ T  I             + +L +    
Sbjct: 23  ASDKTAIALDTEFIRTRSYYPKFGLIQLFDGEQTSLIDPTTISDFLP--FIDLLANPNIV 80

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ +  + F   + P+  T+I +          G    +   L I + K   
Sbjct: 81  KVLHACSEDLEIFQHQFNQALTPLIDTQIMAAF-SGLGLSIGFAKLVNHYLNIELDKGAS 139

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL--MDRAELD 194
            +DW A  L++ QLQYAA+DV +L  +  +   +L +    +     C  L       L+
Sbjct: 140 RTDWLARPLTETQLQYAAADVYYLLPIYQKLQAELAQTNWQEAVNQECQLLVNKRNKTLE 199

Query: 195 LL 196
           L 
Sbjct: 200 LN 201


>gi|212711905|ref|ZP_03320033.1| hypothetical protein PROVALCAL_02980 [Providencia alcalifaciens DSM
           30120]
 gi|212685427|gb|EEB44955.1| hypothetical protein PROVALCAL_02980 [Providencia alcalifaciens DSM
           30120]
          Length = 373

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRV--HEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              R+   + ++   C  A     +A+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYRLVTTDSELAKVCQEASDAPWLALDTEFVRTRTYYPQLGLLQLYDGKQVSLIDPLLM 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L +  + K  H G  D+ V  + FG    P+  T++ +          G
Sbjct: 61  --TDFSPFKALLTNPNQLKFLHAGSEDLEVFMHDFGCVPEPMIDTQVLAAFLGYPI-SCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E LGI + K++  +DW A  LS++Q  YA +DV++L  L     EK+   G   
Sbjct: 118 FATLVAEHLGIELDKSESRTDWLARPLSEKQCDYATADVLYLLPLAKILMEKVSEEGLLA 177

Query: 179 LATSCCNFLMDR 190
            A   C  ++ R
Sbjct: 178 DAQDECQRIVAR 189


>gi|301327561|ref|ZP_07220781.1| ribonuclease D [Escherichia coli MS 78-1]
 gi|300845871|gb|EFK73631.1| ribonuclease D [Escherichia coli MS 78-1]
          Length = 371

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQREYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|156936143|ref|YP_001440059.1| DNA polymerase I [Cronobacter sakazakii ATCC BAA-894]
 gi|156534397|gb|ABU79223.1| hypothetical protein ESA_04040 [Cronobacter sakazakii ATCC BAA-894]
          Length = 927

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 71/201 (35%), Gaps = 18/201 (8%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
            +    +AVDTET  L      L  +  +   G    I +A    +AP+          L
Sbjct: 345 IKNAPVVAVDTETDSLDNLTANLVGISFATEPGLAAYIPVAHDYLDAPDQLSRDRVLELL 404

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L DE   K+    +FD  +L           F T + S +  + + +H +       
Sbjct: 405 KPLLEDESLVKVGQNLKFDRGILQNYGIELRGIAFDTMLESYILDSVSGRHDMDSLSSRW 464

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRL-GRSDL 179
           L       +Q +    + L+  Q+       YAA D      L L+   KLQ+  G  ++
Sbjct: 465 LKHTTITFEQIAGKGKNQLTFNQIDLEQAGRYAAEDADVTLQLHLKMWPKLQQHKGPLNI 524

Query: 180 AT-SCCNFLMDRAELDLLGWE 199
                   +   + ++  G +
Sbjct: 525 FEHIEMPLVPVLSRIERNGVK 545


>gi|149378378|ref|ZP_01896080.1| DNA polymerase I [Marinobacter algicola DG893]
 gi|149357343|gb|EDM45863.1| DNA polymerase I [Marinobacter algicola DG893]
          Length = 911

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 69/209 (33%), Gaps = 19/209 (9%)

Query: 8   EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP-- 64
           + ++ +     +     A DTET  L      +  V  +   G    +        AP  
Sbjct: 318 QAELDSWIDRLKKAPLFAFDTETTSLRYMDADVVGVSFAIEPGEAAYVPFGHDYMGAPEQ 377

Query: 65  --------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                    L  +L D K+ K+    ++D  VL             T + S +  +  ++
Sbjct: 378 LDRDTVLSQLKPLLEDPKKAKLGQNLKYDKNVLANHGINLNGIAEDTMLESYVLNSVGSR 437

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEK 170
           H +     + LG      +  +   A  L+  Q++      YAA D      L      +
Sbjct: 438 HDMDSLAMQYLGEQTITFESIAGKGAKQLTFNQIELEQAGPYAAEDADITLRLHQALRPQ 497

Query: 171 LQRLGRS-DLATS-CCNFLMDRAELDLLG 197
           L++ GR  ++        +   + ++  G
Sbjct: 498 LEKTGRLQEVYEKIDLPLVPVLSRMEQRG 526


>gi|88705065|ref|ZP_01102777.1| ribonuclease D [Congregibacter litoralis KT71]
 gi|88700760|gb|EAQ97867.1| ribonuclease D [Congregibacter litoralis KT71]
          Length = 370

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/196 (26%), Positives = 73/196 (37%), Gaps = 10/196 (5%)

Query: 2   TTIRVHEGDIP---AECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               + E D     A  +    D IAVDTE +        + ++QL   D    I  +  
Sbjct: 1   MNWTLVENDDSLRGALASLAGADEIAVDTEFMRRNSYYPHIALLQLCTDDHAWLIDPLTI 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +   L  +L D    K+ H    D+ V  +  GV   P+  T+ A           G
Sbjct: 61  SNLD--GLRALLTDSACIKVLHSCSEDLEVFRHWLGVLPSPLVDTQRA-TALLGKGFGLG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            +  +KELLG+ + K +  SDW    LS+ Q  YAA DV+ L        E  +  GR  
Sbjct: 118 YRALVKELLGVELDKGETRSDWLKRPLSESQCHYAALDVLELVPAWRILRELAEEQGRMQ 177

Query: 179 LATSC----CNFLMDR 190
                       L DR
Sbjct: 178 WVLDEGEEAIRLLKDR 193


>gi|239616633|ref|YP_002939955.1| DNA polymerase I [Kosmotoga olearia TBF 19.5.1]
 gi|239505464|gb|ACR78951.1| DNA polymerase I [Kosmotoga olearia TBF 19.5.1]
          Length = 896

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 68/196 (34%), Gaps = 15/196 (7%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP--------NLVG 68
            +  D I++D ET  L P   ++  + ++  DG    I +     +           L  
Sbjct: 318 LKGSDVISIDLETSSLDPHEAKIVGISVAIKDGEGFYIPVNHESSDWQADEKQVLLRLKE 377

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +L D   + +    +FD  +L       V P F T IA+ L    + +  L D   + LG
Sbjct: 378 LLEDSGTKIVGQNLKFDYEILEKHGIEPVVPHFDTMIAAYLLNPDSRRFNLDDLALKFLG 437

Query: 129 INI------SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA-T 181
                        Q  D       +E  +Y+  D      L    ++KL      ++   
Sbjct: 438 YRTTSFSELMNKNQLKDQFEKVSVEEAAKYSVEDADIALRLYRVLSKKLYESDLDNIFHK 497

Query: 182 SCCNFLMDRAELDLLG 197
                +   AEL+L G
Sbjct: 498 IEMELIPVLAELELNG 513


>gi|117920828|ref|YP_870020.1| ribonuclease D [Shewanella sp. ANA-3]
 gi|117613160|gb|ABK48614.1| ribonuclease D [Shewanella sp. ANA-3]
          Length = 388

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 70/166 (42%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L +    K
Sbjct: 40  QQSPLLVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLSAFWSLLDNPNIIK 97

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 98  LVHSCSEDLEVFAHYGQRQPTPLFDSQIAA-SLCGMGHGLGYAKLVETCLGEVIDKGESR 156

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++L+ L  Q  +KL+   R       
Sbjct: 157 TDWMRRPLTEAQLSYAANDVLYLYQLYPQLADKLKAQDRLGWLYEE 202


>gi|115653109|ref|XP_001198503.1| PREDICTED: similar to exosome component 10 [Strongylocentrotus
           purpuratus]
 gi|115960717|ref|XP_001189337.1| PREDICTED: similar to exosome component 10 [Strongylocentrotus
           purpuratus]
          Length = 819

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/160 (24%), Positives = 59/160 (36%), Gaps = 3/160 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           + +    IAVD E           C++Q+S  +    ++     +     L     D K 
Sbjct: 279 SLKQSKEIAVDLEHHSYRSYLGFTCLMQISTAEHD-YVVDTLELRSELQMLNDAFTDPKI 337

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH    DI  L    G+ V  +F T  ASR      +   L   L     +   K  
Sbjct: 338 VKVFHGANMDIDWLQRDLGLYVVNMFDTHQASRSLGFPHHS--LASLLSRYCQVEADKQY 395

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
           Q +DW    L +E L YA  D  +L  +      +L + G
Sbjct: 396 QLADWRIRPLPEEMLHYAREDTHYLLYIYHTMKNELIKRG 435


>gi|114047748|ref|YP_738298.1| ribonuclease D [Shewanella sp. MR-7]
 gi|113889190|gb|ABI43241.1| ribonuclease D [Shewanella sp. MR-7]
          Length = 384

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 70/166 (42%), Gaps = 3/166 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           +    + +DTE +       +L ++Q   G     I  +A    +      +L +    K
Sbjct: 36  QQSPLLVLDTEFVRTRTYYAKLGLIQAYDGKTLALIDPVAL--PDLSAFWSLLDNPNIIK 93

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V  +    +  P+F ++IA+       +  G    ++  LG  I K +  
Sbjct: 94  LVHSCSEDLEVFAHYGQRQPTPLFDSQIAA-SLCGMGHGLGYAKLVETCLGEVIDKGESR 152

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
           +DW    L++ QL YAA+DV++L+ L  Q  +KL+   R       
Sbjct: 153 TDWMRRPLTEAQLSYAANDVLYLYQLYPQLADKLKAQDRLGWLYEE 198


>gi|146299377|ref|YP_001193968.1| DNA polymerase I [Flavobacterium johnsoniae UW101]
 gi|146153795|gb|ABQ04649.1| DNA polymerase I [Flavobacterium johnsoniae UW101]
          Length = 949

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/210 (18%), Positives = 72/210 (34%), Gaps = 14/210 (6%)

Query: 4   IRVHEGDIPAECAARY---VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            +  +GD+  +   +      ++  DTET G+      L  +  S   G    +     Q
Sbjct: 355 YQTVQGDLGIKLLLQNLQKQTSVCFDTETTGIDALHAELVGMSFSYEKGKAFYVPFPESQ 414

Query: 61  KNAPNLV----GMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
           + A  L+        +E  EKI    ++D+ +L          +F T IA  L       
Sbjct: 415 EEAKVLIDKFVPFFENENIEKIGQNLKYDLKILSNYGVTVKGKLFDTMIAHYLINPDMRH 474

Query: 117 H------GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEK 170
           +             + +   I K  ++     D   ++  +YAA D      L+  FT +
Sbjct: 475 NMDILAETYLKYSPKSIETLIGKKGKNQLSMRDVPLEDIKEYAAEDADVTLQLKEIFTAE 534

Query: 171 LQRLGRSDLATS-CCNFLMDRAELDLLGWE 199
           L++     L        +   A+++  G  
Sbjct: 535 LEKTETKKLFDEIEIPLVSVLADMETEGIR 564


>gi|238754880|ref|ZP_04616230.1| Ribonuclease D [Yersinia ruckeri ATCC 29473]
 gi|238706891|gb|EEP99258.1| Ribonuclease D [Yersinia ruckeri ATCC 29473]
          Length = 373

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  AR+   +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDAALQQVCEQARHHAQVALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPLP- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                     +L D+   K  H G  D+ V    F     P+  T++ +      T   G
Sbjct: 60  -ITEWQPFRELLQDQSVVKFLHAGSEDLEVFLNAFQQLPTPMIDTQVLAAF-TGRTLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + EL G+ + K++  +DW A  L+++Q  YAA+DV +L  +  Q     +  GR  
Sbjct: 118 FAMLVAELQGVELDKSESRTDWLARPLTEKQCDYAAADVFYLLPMAQQLVAATEAAGRMA 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AAEDECLLLCRR 189


>gi|120553478|ref|YP_957829.1| DNA polymerase I [Marinobacter aquaeolei VT8]
 gi|120323327|gb|ABM17642.1| DNA polymerase I [Marinobacter aquaeolei VT8]
          Length = 908

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 65/209 (31%), Gaps = 19/209 (9%)

Query: 8   EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP-- 64
           + D+       +  D  A DTET  L      +  V  +   G    + +      AP  
Sbjct: 315 QADLDQWLKKLKDSDLFAFDTETTSLRYMDAEIVGVSFAVEPGKAAYVPLGHDYMGAPEQ 374

Query: 65  --------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQ 116
                    L  +L D K +K+    ++D  VL             T + S +  +   +
Sbjct: 375 LDRDSVLEQLKPLLEDPKHKKVGQNLKYDKNVLANHDIQLEGIAEDTMVESYVLNSVGTR 434

Query: 117 HGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEK 170
           H +    +  L       +  +   A  L+  Q+       YAA D      L      +
Sbjct: 435 HDMDSLARTYLDEETITYESIAGKGAKQLTFNQIDLESAGPYAAEDADITLRLHQTLAPR 494

Query: 171 LQRLGRSDLATSCC--NFLMDRAELDLLG 197
           L+  G+ +          +   + ++  G
Sbjct: 495 LKDTGKLESVYREIDLPLVPVLSRMEQRG 523


>gi|253989912|ref|YP_003041268.1| ribonuclease D [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|211638250|emb|CAR66874.1| ribonuclease d (rnase d) [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781362|emb|CAQ84524.1| ribonuclease d (rnase d) [Photorhabdus asymbiotica]
          Length = 375

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/192 (21%), Positives = 77/192 (40%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  A+    IA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDAQLQQVCERAKEYAKIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              N      ++ + +  K  H G  D+ V    F     P+  T++ +          G
Sbjct: 59  NITNWQPFRELITNPQILKFLHAGSEDLEVFLNAFQCLPEPMIDTQVLAAFIGHPL-SCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E + + + K++  +DW A  LS++Q +YAA+DV +L  L         + G  +
Sbjct: 118 FAALVAEYIHVELDKSESRTDWLARPLSEKQCEYAAADVYYLLPLADILITATTQAGYME 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AAIGECELISQR 189


>gi|189426679|ref|YP_001953856.1| 3'-5' exonuclease [Geobacter lovleyi SZ]
 gi|189422938|gb|ACD97336.1| 3'-5' exonuclease [Geobacter lovleyi SZ]
          Length = 381

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/182 (29%), Positives = 83/182 (45%), Gaps = 5/182 (2%)

Query: 7   HEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN 65
           H   +   CA       +A+D E   +   R+++C++QLS   GT  +  +     +   
Sbjct: 11  HNHQLEQLCAELTDETELALDLEADSMHHYREKVCLLQLSNRAGTWLVDPLRL--SDLSP 68

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L       + H G +DI  L   FG+ V+ +F T +A++ T       GL   L+E
Sbjct: 69  LRVLLARPGLRTVLHGGDYDIRSLHRDFGIVVQQMFDTMVAAQFTGATEF--GLAALLRE 126

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
             GI + K  Q +DWS   L+ E   YAA D  HL  L  +   +L++LGR +     C 
Sbjct: 127 HFGIELDKRFQKADWSKRPLTTEMADYAAHDTAHLLELADRLHARLEQLGRREWVAEECA 186

Query: 186 FL 187
            L
Sbjct: 187 LL 188


>gi|323968571|gb|EGB63977.1| ribonuclease D [Escherichia coli M863]
 gi|327252925|gb|EGE64579.1| ribonuclease D [Escherichia coli STEC_7v]
          Length = 371

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 74/170 (43%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +     +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLV--ITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|229523996|ref|ZP_04413401.1| ribonuclease D [Vibrio cholerae bv. albensis VL426]
 gi|229337577|gb|EEO02594.1| ribonuclease D [Vibrio cholerae bv. albensis VL426]
          Length = 381

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIISQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMLDGENLSLIDPTVL- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++ + G  D 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLVERVTQAGWWDA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRTKVSNPELAYLDIKG 213


>gi|261253420|ref|ZP_05945993.1| ribonuclease D [Vibrio orientalis CIP 102891]
 gi|260936811|gb|EEX92800.1| ribonuclease D [Vibrio orientalis CIP 102891]
          Length = 371

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 6/188 (3%)

Query: 2   TTIRVH--EGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++      +   C +AR VD + +DTE +       +L ++QL  G+    I     
Sbjct: 1   MNYQIITQSSQLEEVCQSARNVDVVMLDTEFVRTRTYYPQLGLIQLFDGEKLSLIDPTV- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
             ++    V +L D    K+ H    D+ V   +FG    P+  T++ +          G
Sbjct: 60  -IEDMTAFVELLKDTSVLKVLHACGEDLEVFHNSFGCLPYPMVDTQLMAAFLGHGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++  LG+ + K++  +DW A  LSD+QL+YAA+DV +L  L  Q  EK+ + G  +
Sbjct: 118 FAALVENYLGVELDKSESRTDWLARPLSDKQLEYAAADVYYLQPLYEQLFEKITQAGWWE 177

Query: 179 LATSCCNF 186
            A    + 
Sbjct: 178 AAQQESDL 185


>gi|212528170|ref|XP_002144242.1| exosome complex exonuclease Rrp6, putative [Penicillium marneffei
           ATCC 18224]
 gi|210073640|gb|EEA27727.1| exosome complex exonuclease Rrp6, putative [Penicillium marneffei
           ATCC 18224]
          Length = 795

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 66/170 (38%), Gaps = 7/170 (4%)

Query: 10  DIPAECA-----ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           D P   A      +  + IAVD E   +      + ++Q+S  D    +  +   +++  
Sbjct: 232 DTPEGVAEMVKELKKANEIAVDLEHHDMHTYYGLVSLMQISTRDKDWVVDTLQPWREDLQ 291

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +  D    K+FH    DI  L    G+ V  +F T  A+           LK  L+
Sbjct: 292 QLNEVFADPNILKVFHGSTMDIVWLQRDLGLYVVGLFDTYHAAVALGFPKRS--LKFLLE 349

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           +       K  Q +DW    L++E L+YA +D  +L  +      +L   
Sbjct: 350 KYARYEADKKYQMADWRLRPLTEEMLRYARADTHYLLYIYDCLRNELLEK 399


>gi|229897495|ref|ZP_04512651.1| Ribonuclease D [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229693832|gb|EEO83881.1| Ribonuclease D [Yersinia pestis biovar Orientalis str. PEXU2]
          Length = 308

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    IA+DTE +       +L ++QL  G+    I  +            +L D    
Sbjct: 32  ARTHAHIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP--ITEWQPFRALLQDLNVV 89

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F     P+  T++ +      +   G    + E  G+ + K++ 
Sbjct: 90  KYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAF-SGRSLSCGFAMLVAEFEGVELDKSES 148

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 149 RTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAKDECLLLCRR 202


>gi|32035264|ref|ZP_00135282.1| COG0349: Ribonuclease D [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126208098|ref|YP_001053323.1| ribonuclease D [Actinobacillus pleuropneumoniae L20]
 gi|190149931|ref|YP_001968456.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|307249819|ref|ZP_07531795.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307261076|ref|ZP_07542755.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|307263258|ref|ZP_07544876.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|126096890|gb|ABN73718.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 5b str.
           L20]
 gi|189915062|gb|ACE61314.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|306858121|gb|EFM90201.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306869208|gb|EFN01006.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|306871320|gb|EFN03046.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 371

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 75/189 (39%), Gaps = 8/189 (4%)

Query: 4   IRVHEGDIPAEC-----AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           I  H  D   +       A    A+A+DTE +       +L ++QL  GD    I   + 
Sbjct: 5   IHYHWIDTDEKLKTVCENACRKSAVALDTEFIRTRSYYPKLGLIQLFDGDTVSLIDPNS- 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    +G+L  +   K+ H    D+ V  + F     P+  T+I +          G
Sbjct: 64  -ISDFSPFIGLLTCQNVVKVLHACSEDLEVFQHLFKQLPTPLADTQIMAGFAGGGI-SLG 121

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +   L + + K    +DW A  L++EQLQYAA+DV +L  +  +    L      +
Sbjct: 122 FAKLVAHYLNVELDKGASRTDWLARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQN 181

Query: 179 LATSCCNFL 187
                C +L
Sbjct: 182 AVEQECRYL 190


>gi|307256641|ref|ZP_07538420.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306864689|gb|EFM96593.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 371

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 74/189 (39%), Gaps = 8/189 (4%)

Query: 4   IRVHEGDIPAEC-----AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           I  H  D   +       A    A+A+DTE +       +L ++QL  GD    I     
Sbjct: 5   IHYHWIDTDEKLKTVCENACRKSAVALDTEFIRTRSYYPKLGLIQLFDGDTVSLIDPNP- 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    +G+L  +   K+ H    D+ V  + F     P+  T+I +          G
Sbjct: 64  -ISDFSPFIGLLTCQNVVKVLHACSEDLEVFQHLFKQLPTPLADTQIMAGFAGGGI-SLG 121

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +   L + + K    +DW A  L++EQLQYAA+DV +L  +  +    L      +
Sbjct: 122 FAKLVAHYLNVELDKGASRTDWLARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQN 181

Query: 179 LATSCCNFL 187
                C +L
Sbjct: 182 AVEQECRYL 190


>gi|165976032|ref|YP_001651625.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|303249665|ref|ZP_07335870.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307245476|ref|ZP_07527563.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307252170|ref|ZP_07534068.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307254430|ref|ZP_07536267.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307258890|ref|ZP_07540621.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|165876133|gb|ABY69181.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|302651477|gb|EFL81628.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306853535|gb|EFM85753.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306860314|gb|EFM92329.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306862571|gb|EFM94528.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306866914|gb|EFM98771.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
          Length = 371

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 74/189 (39%), Gaps = 8/189 (4%)

Query: 4   IRVHEGDIPAEC-----AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           I  H  D   +       A    A+A+DTE +       +L ++QL  GD    I     
Sbjct: 5   IHYHWIDTDEKLKTVCENACRKSAVALDTEFIRTRSYYPKLGLIQLFDGDTVSLIDPNP- 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    +G+L  +   K+ H    D+ V  + F     P+  T+I +          G
Sbjct: 64  -ISDFSPFIGLLTCQNVVKVLHACSEDLEVFQHLFKQLPTPLADTQIMAGFAGGGI-SLG 121

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +   L + + K    +DW A  L++EQLQYAA+DV +L  +  +    L      +
Sbjct: 122 FAKLVAHYLNVELDKGASRTDWLARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQN 181

Query: 179 LATSCCNFL 187
                C +L
Sbjct: 182 AVEQECRYL 190


>gi|254566215|ref|XP_002490218.1| Exonuclease component of the nuclear exosome [Pichia pastoris
           GS115]
 gi|238030014|emb|CAY67937.1| Exonuclease component of the nuclear exosome [Pichia pastoris
           GS115]
 gi|328350615|emb|CCA37015.1| exosome complex exonuclease RRP6 [Pichia pastoris CBS 7435]
          Length = 717

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 61/162 (37%), Gaps = 3/162 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               D IAVD E   L      +C++Q+S  +    I+     +     L  +  D    
Sbjct: 228 LSKADVIAVDLEHHDLRTYYGLVCLMQISTRNQD-YIVDTLKLRFKLQPLNKVFTDPSIV 286

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH    DI  L    G+ V  +F T  AS+L     +   L   L+       SK  Q
Sbjct: 287 KVFHGAFMDIIWLQRDLGLYVVSLFDTFHASKLLGFPKHS--LAYLLETYAKFKTSKKYQ 344

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            +DW    L+   L YA SD   L  +  Q    L   G+  
Sbjct: 345 LADWRVRPLTKPLLAYARSDTHFLLYIFDQLNNMLIESGKLS 386


>gi|238897738|ref|YP_002923417.1| RNase D, processes tRNA precursor [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229465495|gb|ACQ67269.1| RNase D, processes tRNA precursor [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 387

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            A+A+DTE +        L ++QL  G     I               +L ++K  K  H
Sbjct: 34  KAVALDTEFVRTKTYYAELGLIQLYDGHRVSLIDPFL--ITEWAPFYCLLKNKKIVKFLH 91

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               DI + F+ F     P+  ++I +          G    +KE  GI ++KA+  +DW
Sbjct: 92  SAGEDIEIFFHFFKTLPEPLIDSQILAAF-TGRPVSCGFSILVKEFQGIVLNKAESRTDW 150

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  LS +Q  YAA DV +L  L     +K++  G  +     C  L  R
Sbjct: 151 LARPLSQKQCDYAAEDVFYLLPLANALMKKIETSGWMEAVKEECELLCQR 200


>gi|22126121|ref|NP_669544.1| ribonuclease D [Yersinia pestis KIM 10]
 gi|45441720|ref|NP_993259.1| ribonuclease D [Yersinia pestis biovar Microtus str. 91001]
 gi|108807454|ref|YP_651370.1| ribonuclease D [Yersinia pestis Antiqua]
 gi|108811715|ref|YP_647482.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|145598343|ref|YP_001162419.1| ribonuclease D [Yersinia pestis Pestoides F]
 gi|167469552|ref|ZP_02334256.1| ribonuclease D [Yersinia pestis FV-1]
 gi|186895427|ref|YP_001872539.1| ribonuclease D [Yersinia pseudotuberculosis PB1/+]
 gi|21959080|gb|AAM85795.1|AE013826_7 RNase D [Yersinia pestis KIM 10]
 gi|45436582|gb|AAS62136.1| ribonuclease D [Yersinia pestis biovar Microtus str. 91001]
 gi|108775363|gb|ABG17882.1| ribonuclease D [Yersinia pestis Nepal516]
 gi|108779367|gb|ABG13425.1| ribonuclease D [Yersinia pestis Antiqua]
 gi|145210039|gb|ABP39446.1| ribonuclease D [Yersinia pestis Pestoides F]
 gi|186698453|gb|ACC89082.1| ribonuclease D [Yersinia pseudotuberculosis PB1/+]
          Length = 386

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    IA+DTE +       +L ++QL  G+    I  +            +L D    
Sbjct: 32  ARTHAHIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP--ITEWQPFRALLQDLNVV 89

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F     P+  T++ +      +   G    + E  G+ + K++ 
Sbjct: 90  KYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAF-SGRSLSCGFAMLVAEFEGVELDKSES 148

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 149 RTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAKDECLLLCRR 202


>gi|37679238|ref|NP_933847.1| ribonuclease D [Vibrio vulnificus YJ016]
 gi|37197981|dbj|BAC93818.1| ribonuclease D [Vibrio vulnificus YJ016]
          Length = 390

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 77/187 (41%), Gaps = 6/187 (3%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   C+ AR  D + +DTE +       +L ++QL  GD    I      
Sbjct: 21  NYQIITENQDLARVCSKAREADVVMLDTEFVRTRTYYPQLGLIQLFDGDSLSLIDPTVL- 79

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +      +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 80  -TDMSAFTELLNDASVMKVLHACGEDLEVFHNAFGAMPVPMVDTQIMAAFLGHGL-STGF 137

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  L     EK+   G    
Sbjct: 138 AALVEQYLNVELDKSESRTDWLARPLSDKQLEYAAADVHYLLPLYEILLEKVMAAGWWQA 197

Query: 180 ATSCCNF 186
           A      
Sbjct: 198 AQQESEL 204


>gi|238794476|ref|ZP_04638085.1| Ribonuclease D [Yersinia intermedia ATCC 29909]
 gi|238726159|gb|EEQ17704.1| Ribonuclease D [Yersinia intermedia ATCC 29909]
          Length = 373

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +L ++QL  G+    I  +            +L D    
Sbjct: 19  ARTHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP--ITEWQPFSELLQDLNVV 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F     P+  T+I +      T   G    + E  G+ + K++ 
Sbjct: 77  KYLHAGSEDLEVFLNAFSRMPTPMIDTQILAAF-SGRTLSCGFAMLVNEFEGVELDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 136 RTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAIDECQLLCRR 189


>gi|238756989|ref|ZP_04618177.1| Ribonuclease D [Yersinia aldovae ATCC 35236]
 gi|238704819|gb|EEP97348.1| Ribonuclease D [Yersinia aldovae ATCC 35236]
          Length = 373

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +       +L ++QL  G+    I  +            +L D    
Sbjct: 19  ARTHTHVALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPLP--ITQWQPFRALLQDLSVV 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K  H G  D+ V    F     P+  T++ +      T   G    + E  GI + K++ 
Sbjct: 77  KYLHAGSEDLEVFLNAFEQMPTPMIDTQVLAAF-SGRTLSCGFAMLVNEFEGIELDKSES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D A   C  L  R
Sbjct: 136 RTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAIDECELLCRR 189


>gi|238751610|ref|ZP_04613100.1| Ribonuclease D [Yersinia rohdei ATCC 43380]
 gi|238710172|gb|EEQ02400.1| Ribonuclease D [Yersinia rohdei ATCC 43380]
          Length = 394

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 79/191 (41%), Gaps = 6/191 (3%)

Query: 3   TIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++   D  +   C  AR    +A+DTE +       +L ++QL  G+    I  +   
Sbjct: 23  NYQLITTDSALQQVCEQARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP-- 80

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                    ++ D    K  H G  D+ V    F     P+  T++ +      +   G 
Sbjct: 81  ITQWQPFRELIQDLNVVKYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAF-SGRSLSCGF 139

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + E  G+ + K++  +DW A  LS++Q  YAA+DV +L  L  +  E  +  GR D 
Sbjct: 140 AMLVNEFEGVELDKSESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDA 199

Query: 180 ATSCCNFLMDR 190
           A   CN L  R
Sbjct: 200 AIDECNLLCRR 210


>gi|91228923|ref|ZP_01262822.1| ribonuclease D [Vibrio alginolyticus 12G01]
 gi|91187531|gb|EAS73864.1| ribonuclease D [Vibrio alginolyticus 12G01]
          Length = 277

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 86/206 (41%), Gaps = 9/206 (4%)

Query: 3   TIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++     D+   C  AR  D + +DTE + +     +L ++QL  G+    I      
Sbjct: 15  NYQIITKNKDLEEVCTHAREADVVMLDTEFVRIRTFYPQLGLIQLFDGNRLSLIDPTEL- 73

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +    V +L D    K+ H    D+ V    FG    P+  T++ +          G 
Sbjct: 74  -TDMTPFVALLKDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQLMAAFLGHGL-STGF 131

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              ++E LG+ + K++  +DW A  L+ +QL YAA+DV +L  L  +  +K+ + G  + 
Sbjct: 132 ASLVEEYLGVELDKSESRTDWMARPLTQKQLDYAAADVHYLLPLYEKLFDKVTQAGWWEA 191

Query: 180 ATSCCNFL---MDRAELDLLGWENVD 202
                + L     R   +   + ++ 
Sbjct: 192 VQQESDLLVSKRIRVTNEENAYLDIK 217


>gi|283832800|ref|ZP_06352541.1| ribonuclease D [Citrobacter youngae ATCC 29220]
 gi|291072487|gb|EFE10596.1| ribonuclease D [Citrobacter youngae ATCC 29220]
          Length = 371

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 73/173 (42%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++QL  G     I     G  +   L  +L D    K
Sbjct: 16  REFPAIALDTEFVRTRTYYPQLGLIQLFDGKHVALIDPQ--GITDWSPLRAILRDTAITK 73

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  
Sbjct: 74  FLHAGSEDLEVFLNAFGELPQPLIDTQILAAFCGRPL-SWGFAAMVEEFTGVALDKSESR 132

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  L++ Q +YAA+DV +L  +      + +  G    A   C  +  R
Sbjct: 133 TDWLARPLTERQCEYAAADVWYLLPITTTLMAETEASGWLPAALDECRLMQQR 185


>gi|320157018|ref|YP_004189397.1| ribonuclease D [Vibrio vulnificus MO6-24/O]
 gi|319932330|gb|ADV87194.1| ribonuclease D [Vibrio vulnificus MO6-24/O]
          Length = 390

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 71/170 (41%), Gaps = 3/170 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  GD    I        +      +L D    
Sbjct: 38  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGDTLSLIDPTVL--TDMSAFTELLNDASVM 95

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V    FG    P+  T+I +          G    +++ L + + K++ 
Sbjct: 96  KVLHACGEDLEVFHNAFGAIPVPMVDTQIMAAFLGHGL-STGFAALVEQYLNVELDKSES 154

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            +DW A  LSD+QL+YAA+DV +L  L     EK+   G    A      
Sbjct: 155 RTDWLARPLSDKQLEYAAADVHYLLPLYEILLEKVMEAGWWQAAQQESEL 204


>gi|188991267|ref|YP_001903277.1| hypothetical protein xccb100_1872 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167733027|emb|CAP51225.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 362

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 55/200 (27%), Positives = 84/200 (42%), Gaps = 9/200 (4%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++      R    I +DTE +       +L +VQ++ G+  + I  +  G  +A  L
Sbjct: 7   HPSELTERLQLRPS-RIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMTDA--L 63

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              LV     K+ H    D+       GV  RP+F T+IA+ L          K  ++E+
Sbjct: 64  KDWLVAPDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 122

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+    T KL    R          
Sbjct: 123 TGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDALTAKLTAQDRLGWLAEDGER 182

Query: 187 LMDRAELDLLGWENVDIFSH 206
           L+   E D     + D + H
Sbjct: 183 LLGTVEHD-----DGDRWPH 197


>gi|312882610|ref|ZP_07742349.1| DNA polymerase I [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369695|gb|EFP97208.1| DNA polymerase I [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 927

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 67/199 (33%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            R  D IA DTET  L      L  V  +  +G    + +A    +AP           L
Sbjct: 344 LRSADVIAFDTETDSLDYMEANLVGVSFAIEEGVAAYVPVAHDYMDAPKQLERDWVLEQL 403

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D  R K+    ++D +VL           F T +AS +  +   +H +       
Sbjct: 404 KPILEDGSRAKVGQNLKYDASVLARYGIDMRGIKFDTMLASYVYNSVAGKHDMDSLALRF 463

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRS-DL 179
           L  +    +Q +      L+  Q+       YAA D      L  +  + L    +   +
Sbjct: 464 LQHSCISFEQVAGKGKKQLTFNQIDLEQAAPYAAEDADVTFRLHQRLQKSLDASDKLASI 523

Query: 180 ATS-CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 524 YRDIEMPLVPVLSRIERTG 542


>gi|308049432|ref|YP_003912998.1| ribonuclease D [Ferrimonas balearica DSM 9799]
 gi|307631622|gb|ADN75924.1| ribonuclease D [Ferrimonas balearica DSM 9799]
          Length = 374

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/179 (25%), Positives = 81/179 (45%), Gaps = 8/179 (4%)

Query: 10  DIPAECAA-----RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           D   + AA     R  DA+A+DTE +       +L ++QL  G+    I  +    ++  
Sbjct: 11  DNDDDLAALCRQCRQKDAVALDTEFVRTRTLHAQLGLIQLYDGETLALIDPLE--IQDLG 68

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  ++ D+   K+ H    D+ +  Y  GV  +P+F T++A  +        G    + 
Sbjct: 69  PLWQLIADKNVVKVLHSASEDLEIFAYRGGVIPQPLFDTQVA-GVLLNLGGAMGYGKLIH 127

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
             LG+ + K +  +DW    LS++QL YAA+DV +L  +       ++ +GR D     
Sbjct: 128 HYLGLELDKGEARTDWLKRPLSEKQLTYAAADVYYLLQVYRMMRPAIEEMGRLDWLWQE 186


>gi|153871900|ref|ZP_02000951.1| DNA-directed DNA polymerase [Beggiatoa sp. PS]
 gi|152071634|gb|EDN69049.1| DNA-directed DNA polymerase [Beggiatoa sp. PS]
          Length = 914

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 67/213 (31%), Gaps = 20/213 (9%)

Query: 6   VHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           + + D+          +  A DTET  L   + ++  V  +   G    + +A     AP
Sbjct: 321 LTQADLDDWLNRLNQAELFAFDTETTSLDYLQAQIVGVSFAVQVGEAAYVPLAHDYLGAP 380

Query: 65  N----------LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
                      L  +L + K+ KI    ++D  VL           F T + S +    T
Sbjct: 381 QQLSCDNVLAVLKPLLENPKKRKIGQNLKYDAHVLANHGIHLQGMAFDTMLESYVLN-ST 439

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQL------QYAASDVVHLHALRLQFT 168
            +H +    +  L       +  +      LS  Q+       YA  D      L     
Sbjct: 440 TKHDMDSLAQIYLQKTTITFEDVAGKGKKQLSFNQIPLEHATPYACEDADITLQLHQNLW 499

Query: 169 EKLQ-RLGRSDLATS-CCNFLMDRAELDLLGWE 199
           E+LQ R     +        +     ++  G +
Sbjct: 500 EQLQNRPKLERIFDDLEMPLIPVLIRMERHGVK 532


>gi|54308269|ref|YP_129289.1| ribonuclease D [Photobacterium profundum SS9]
 gi|46912697|emb|CAG19487.1| hypothetical ribonuclease D [Photobacterium profundum SS9]
          Length = 374

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 75/171 (43%), Gaps = 3/171 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    + +DTE +       +L ++Q+  GD  V I  I     +      +L D+   
Sbjct: 19  ARTHSVVMLDTEFVRTRTLYPKLGLIQMFDGDNLVLIDPIE--IDDLTPFWDLLRDQSII 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  +  G    P+  T++ +          G    + E +G+++ K + 
Sbjct: 77  KVLHACGEDLEVFQHHAGCLPTPMIDTQLMAAFLGHGV-SAGFGSLVSEYVGVDLEKGEA 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            ++W A  L+D+QL YAA+DV +L  L     EK++  G  +     C  L
Sbjct: 136 RTNWLARPLTDKQLDYAAADVFYLLPLYETLLEKVKAKGWMEALELECAAL 186


>gi|303253729|ref|ZP_07339866.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307247590|ref|ZP_07529633.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|302647454|gb|EFL77673.1| ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306855860|gb|EFM88020.1| Ribonuclease D [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
          Length = 371

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 74/189 (39%), Gaps = 8/189 (4%)

Query: 4   IRVHEGDIPAEC-----AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
           I  H  D   +       A    A+A+DTE +       +L ++QL  GD    I     
Sbjct: 5   IHYHWIDTDEKLKTVCENACRKSAVALDTEFIRTRSYYPKLGLIQLFDGDTVSLIDPNP- 63

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +    +G+L  +   K+ H    D+ V  + F     P+  T+I +          G
Sbjct: 64  -ISDFSPFIGLLTCQNVVKVLHACSEDLEVFQHLFKQLPTPLADTQIMAGFAGVGI-SLG 121

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               +   L + + K    +DW A  L++EQLQYAA+DV +L  +  +    L      +
Sbjct: 122 FAKLVAHYLNVELDKGASRTDWLARPLTEEQLQYAAADVWYLLPVYQRLVSDLDATRWQN 181

Query: 179 LATSCCNFL 187
                C +L
Sbjct: 182 AVEQECQYL 190


>gi|268589713|ref|ZP_06123934.1| ribonuclease D [Providencia rettgeri DSM 1131]
 gi|291314943|gb|EFE55396.1| ribonuclease D [Providencia rettgeri DSM 1131]
          Length = 373

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRV--HEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              R+   + ++   C  A     +A+DTE +       +L ++QL  G     I  +  
Sbjct: 1   MNYRLVTTDSELAQVCQEASNAPWLALDTEFVRTRTYYPQLGLLQLYDGKQVSLIDPLLM 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L + ++ K  H G  D+ V  + F     P+  T++ +          G
Sbjct: 61  --TDFSPFKALLTNPEQLKFLHAGSEDLEVFMHDFDCVPEPMIDTQVVAAFLGYPI-SCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E LGI + K++  +DW A  LS++Q  YAA+DV++L  L     EK+   G  +
Sbjct: 118 FASLVAEHLGIELDKSESRTDWLARPLSEKQCDYAAADVLYLLPLAEILMEKVTEAGYLE 177

Query: 179 LATSCCNFLMDR 190
            A   C  ++ R
Sbjct: 178 DAKDECQRVVAR 189


>gi|119773235|ref|YP_925975.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
 gi|119765735|gb|ABL98305.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
          Length = 923

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 75/211 (35%), Gaps = 19/211 (9%)

Query: 6   VHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           + E ++ A        + IAVDTET  L   +  L  +  +   G    + +      AP
Sbjct: 328 LTESELDAWLDKLSKAELIAVDTETTSLDYMQAELVGLSFAIEAGKAAYLPLGHDYPGAP 387

Query: 65  ----------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
                      L  +L +   +K+    ++D++VL           F T + S +  +  
Sbjct: 388 SQLPREATLAKLKPLLENPDIKKVGQNLKYDMSVLANAGIQLKGVAFDTMLESYVFNSVA 447

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFT 168
           ++H +     + LG      ++ +   A  L+  Q+       YAA D      L     
Sbjct: 448 SRHDMDGLALKYLGHKNISFEEIAGKGAKQLTFNQIALEQAAPYAAEDADITLRLHQHLW 507

Query: 169 EKL-QRLGRSDLATS-CCNFLMDRAELDLLG 197
            +L +  G   + T      +   ++++  G
Sbjct: 508 PRLSKEEGLESVFTELELPLIEVLSDIERRG 538


>gi|298207105|ref|YP_003715284.1| DNA polymerase I [Croceibacter atlanticus HTCC2559]
 gi|83849739|gb|EAP87607.1| DNA polymerase I [Croceibacter atlanticus HTCC2559]
          Length = 956

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 66/200 (33%), Gaps = 11/200 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----LVGMLV 71
                 ++  DTET GL P    L  +  S   G    +  +  ++ A      L     
Sbjct: 379 NLNKQTSVCFDTETTGLNPLTAELVGIAFSWDAGKGFYLPFSDNKEEAQQLIEELRPFFE 438

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
           +E  +K+    ++DI VL         P+F T +A  L       +         +    
Sbjct: 439 NEDIQKVGQNLKYDIKVLHKYDIEVRGPLFDTMLAHYLINPDMRHNMDVLAETYLNYSPV 498

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++     D   ++Q +YA  D      L+  F ++L       L      
Sbjct: 499 SIETLIGKKGKNQKSMRDVPLEDQTEYAVEDADITLQLKEHFEKELGDANTQKLFDDIEI 558

Query: 185 NFLMDRAELDLLGWENVDIF 204
             L   A ++L G      F
Sbjct: 559 PLLRVLAAMELEGINLDKAF 578


>gi|300775482|ref|ZP_07085343.1| DNA-directed DNA polymerase I [Chryseobacterium gleum ATCC 35910]
 gi|300505509|gb|EFK36646.1| DNA-directed DNA polymerase I [Chryseobacterium gleum ATCC 35910]
          Length = 944

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 57/194 (29%), Gaps = 11/194 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN----APNLVGMLV 71
                  +  DTET  L      L  +  S   G    I ++  +               
Sbjct: 367 NLLQQKVVCFDTETTSLNELEAELVGMSFSYKKGLAYYIPLSEDRAEVLQTLEIFRPFFE 426

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--YTNQHGLKDNLKELLGI 129
            E   K+ H  +FD  VL          +F T IA  L           L +       +
Sbjct: 427 KEDLLKVAHNLKFDYKVLKQYDITVKGAMFDTMIAHYLLNPDGRHGMDYLSEVYLNYKPV 486

Query: 130 NIS----KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL-ATSCC 184
           +I     K  +      D     Q  YAA D      L   F  +L++    +L      
Sbjct: 487 SIETIIGKKGKKQGNFRDADLRTQTDYAAEDADVTFQLYELFAPQLKKENLEELFYNIEM 546

Query: 185 NFLMDRAELDLLGW 198
             +   A+++L G 
Sbjct: 547 PLMEVLAKMELSGI 560


>gi|120434510|ref|YP_860207.1| DNA polymerase I [Gramella forsetii KT0803]
 gi|117576660|emb|CAL65129.1| DNA polymerase I [Gramella forsetii KT0803]
          Length = 942

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/194 (20%), Positives = 66/194 (34%), Gaps = 11/194 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----LVGMLVD 72
                ++  DTET  L      L  +  S   G    +     +K A      L     +
Sbjct: 365 LLKQKSVCFDTETTSLNTLDAELVGIAFSWEAGKGFYLPFPEEKKEAQKLIEELRNFFEN 424

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKEL 126
           +K EKI    ++DI VL          +F T IA  L       +         +   + 
Sbjct: 425 DKIEKIGQNLKYDIKVLDKYKIDVKGALFDTMIAHYLINPDMRHNMDVLAETYLNYTPQP 484

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CCN 185
           +   I K  ++     D   D+Q +YA  D      L+  F ++L+      L       
Sbjct: 485 ISELIGKKGKNQGSMRDVALDKQTEYAVEDADITFQLKNLFEKELEEAETRKLFNEIEIP 544

Query: 186 FLMDRAELDLLGWE 199
            +   A+++L G +
Sbjct: 545 LVEVLADMELEGIK 558


>gi|333018685|gb|EGK37978.1| ribonuclease D [Shigella flexneri K-227]
          Length = 371

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 74/170 (43%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA+DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YA +DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAVADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|317478024|ref|ZP_07937206.1| DNA polymerase I [Bacteroides sp. 4_1_36]
 gi|316905813|gb|EFV27585.1| DNA polymerase I [Bacteroides sp. 4_1_36]
          Length = 951

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 73/209 (34%), Gaps = 14/209 (6%)

Query: 3   TIRVHE-GDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++ +  D  AE        + +++DTET G  P    L  +  S  +     + + A 
Sbjct: 358 DYQLIDTEDKRAEIIQKLLTSEILSIDTETTGTEPMDAELVGMSFSDAENRAYYVPVPAE 417

Query: 60  QKN----APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--Y 113
           ++           +  +EK  K+    ++D+ +L          +F T +A  + +    
Sbjct: 418 REEVLKIVNEFRPLFENEKSMKVGQNIKYDMIILQNYGVQVKGKLFDTMLAHYVLQPELR 477

Query: 114 TNQHGLKDNLKELLGINISKAQQSSDWSADDL----SDEQLQYAASDVVHLHALRLQFTE 169
            N   L +       I+I K   +   +  ++     ++  +YA  D      L+    +
Sbjct: 478 HNMDYLAEIYLHYQTIHIDKLIGARGKNQKNMRDLSPEDVYRYACEDADVTLKLKNVLEK 537

Query: 170 KLQRLGRSDL-ATSCCNFLMDRAELDLLG 197
           +L+  G   L        +     ++  G
Sbjct: 538 ELKEQGAEHLFYEIEMPLVPVLVNIESNG 566


>gi|21231744|ref|NP_637661.1| ribonuclease D [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66768130|ref|YP_242892.1| ribonuclease D [Xanthomonas campestris pv. campestris str. 8004]
 gi|21113449|gb|AAM41585.1| ribonuclease D [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573462|gb|AAY48872.1| ribonuclease D [Xanthomonas campestris pv. campestris str. 8004]
          Length = 362

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/200 (27%), Positives = 84/200 (42%), Gaps = 9/200 (4%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++      R    I +DTE +       +L +VQ++ G+  + I  +  G  +A  L
Sbjct: 7   HPSELTERLQLRPS-RIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMTDA--L 63

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L+     K+ H    D+       GV  RP+F T+IA+ L          K  ++E+
Sbjct: 64  KDWLIAPDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 122

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+    T KL    R          
Sbjct: 123 TGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDALTAKLTAQDRLGWLAEDGER 182

Query: 187 LMDRAELDLLGWENVDIFSH 206
           L+   E D     + D + H
Sbjct: 183 LLGTVEHD-----DGDRWPH 197


>gi|262404337|ref|ZP_06080892.1| ribonuclease D [Vibrio sp. RC586]
 gi|262349369|gb|EEY98507.1| ribonuclease D [Vibrio sp. RC586]
          Length = 381

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 85/207 (41%), Gaps = 15/207 (7%)

Query: 3   TIRVHE--GDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++    GD+     AAR  D + +DTE +       +L ++Q+  G+    I      
Sbjct: 10  NYQIITQLGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVM- 68

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                  V +L D    K+ H    D+ V    FG    P+  T+I +          G 
Sbjct: 69  -DEMTPFVELLQDTSVLKVLHACGEDLEVFQNAFGCTPFPMVDTQIMAAFLGYGL-STGF 126

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              +++ L + + K++  +DW A  LSD+QL+YAA+DV +L  +  +  E++   G  + 
Sbjct: 127 AALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMYEKLLERVTHAGWWEA 186

Query: 180 ATSCCNFL---------MDRAELDLLG 197
           A                 + A LD+ G
Sbjct: 187 ALQESELQVAKRIKVSNPEHAYLDIKG 213


>gi|242767043|ref|XP_002341292.1| exosome complex exonuclease Rrp6, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218724488|gb|EED23905.1| exosome complex exonuclease Rrp6, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 771

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 65/170 (38%), Gaps = 7/170 (4%)

Query: 10  DIPAECA-----ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           D P   A      +    IAVD E   +      + ++Q+S  D    +  +   +++  
Sbjct: 232 DTPEGVAEMVEELKKAKEIAVDLEHHDVHTYYGLVSLMQISTRDKDWVVDTLQPWREDLQ 291

Query: 65  NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLK 124
            L  +  D    K+FH    DI  L    G+ V  +F T  A+           LK  L+
Sbjct: 292 RLNEVFTDPNILKVFHGSTMDIVWLQRDLGLYVVSLFDTYHAAVALGFPKRS--LKFLLE 349

Query: 125 ELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           +       K  Q +DW    L+DE L+YA +D  +L  +      +L   
Sbjct: 350 KYAHYEADKKYQMADWRLRPLTDEMLKYARADTHYLLYIYDCLRNELLEK 399


>gi|300723126|ref|YP_003712424.1| RNase D, processes tRNA [Xenorhabdus nematophila ATCC 19061]
 gi|297629641|emb|CBJ90244.1| RNase D, processes tRNA precursor [Xenorhabdus nematophila ATCC
           19061]
          Length = 379

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+    IA+DTE +       +L ++QL  G+    I  +   Q     L  +LVD    
Sbjct: 22  AKKHARIALDTEFVRTRTYYPQLGLIQLFDGEQLSLIDPLEISQ--WQPLKALLVDPDVL 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H G  D+ V   +F     P+  T++ +          G    + E L + + K++ 
Sbjct: 80  KLIHAGSEDLEVFGNSFQCLPTPMIDTQVLAAFIGHPI-SCGFATLVAEYLHVELDKSES 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS +Q +YAA+DV +L  L     +K ++ G  D A    + +  R
Sbjct: 139 RTDWLARPLSRKQCEYAAADVYYLLPLADILLKKTEQAGYFDAAKDESDLIAQR 192


>gi|169767462|ref|XP_001818202.1| exosome complex exonuclease Rrp6 [Aspergillus oryzae RIB40]
 gi|83766057|dbj|BAE56200.1| unnamed protein product [Aspergillus oryzae]
          Length = 760

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 59/158 (37%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +   +  + ++Q+S  D    +  +   ++    L  +  D    
Sbjct: 236 LKSAKEIAIDLEHHDVHSYQGLVSLMQISTRDKDWVVDTLKPWREELQMLNEVFADPSIL 295

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH    DI  L    G+ V  +F T  A+           LK  L++ +     K  Q
Sbjct: 296 KVFHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRS--LKFLLQKFVNFEADKRYQ 353

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            +DW    + +    YA SD  +L  +      +L   
Sbjct: 354 MADWRIRPIPEGMFDYARSDTHYLLHIFDHLRNELIEN 391


>gi|323495020|ref|ZP_08100109.1| ribonuclease D [Vibrio brasiliensis LMG 20546]
 gi|323310677|gb|EGA63852.1| ribonuclease D [Vibrio brasiliensis LMG 20546]
          Length = 346

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/182 (25%), Positives = 77/182 (42%), Gaps = 12/182 (6%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRF 84
           +DTE +       +L ++QL  G     I        +    V +L D    K+ H    
Sbjct: 2   LDTEFVRTRTYYPQLGLIQLYDGQTLSLIDPTV--IDDMTAFVHLLQDTSVLKVLHACGE 59

Query: 85  DIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADD 144
           D+ V   +FG    P+  T++ +          G    + E L + + K++  +DW A  
Sbjct: 60  DLEVFQNSFGCLPYPMVDTQLMAAFLGHGL-STGFAALVNEYLNVELDKSESRTDWLARP 118

Query: 145 LSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL---------MDRAELDL 195
           L+D+QL+YAA+DV +L  L  Q  E + + G    A    + +          +RA LD+
Sbjct: 119 LTDKQLEYAAADVYYLLPLYEQLFENITQAGWWQAAQQESDLIASKRIKTVNPERAYLDV 178

Query: 196 LG 197
            G
Sbjct: 179 KG 180


>gi|319953575|ref|YP_004164842.1| DNA polymerase i [Cellulophaga algicola DSM 14237]
 gi|319422235|gb|ADV49344.1| DNA polymerase I [Cellulophaga algicola DSM 14237]
          Length = 945

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/203 (22%), Positives = 67/203 (33%), Gaps = 11/203 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----NLVGMLV 71
                 ++  DTET GL P    L  +  S        I   A +  A      L     
Sbjct: 367 NLLKQTSVCFDTETTGLNPLTAELVGIAFSWEASKGFYIPFPADKTEAQEIIEQLRPFFE 426

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
           DE  EKI    ++DI VL           F T +A  L       +         +    
Sbjct: 427 DEAIEKIGQNLKYDIKVLDKYNVKVKGKCFDTMLAHYLINPDMRHNMEVLAETYLNYTPV 486

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++     D     Q +YAA D    + L  QF  +L+     +L T    
Sbjct: 487 SITELIGKKGKNQLNMRDVPLPNQTEYAAEDADITYQLAQQFKPELEEAKTQELFTDIEI 546

Query: 185 NFLMDRAELDLLGWENVDIFSHS 207
             L   A+++L G      F +S
Sbjct: 547 PLLHVLADMELEGINLDTKFLNS 569


>gi|89889486|ref|ZP_01200997.1| DNA polymerase I [Flavobacteria bacterium BBFL7]
 gi|89517759|gb|EAS20415.1| DNA  polymerase I [Flavobacteria bacterium BBFL7]
          Length = 946

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 66/194 (34%), Gaps = 11/194 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----NLVGMLV 71
           +     ++  DTET GL P    L  +  S   G    + I   ++ A      L     
Sbjct: 368 SLMQQSSVCFDTETTGLDPLTAELVGIAFSWEKGKGFYLPIPEDREAAQVIVDQLKPFFE 427

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
               EK+    ++DI VL         P+F T +A  L       +         +   +
Sbjct: 428 SASIEKVGQNLKYDIKVLDKYGVDVKGPMFDTMLAHYLINPDMRHNMDVLAETYLNYTPQ 487

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++     D   ++Q +YA  D      L+  FT +L   G   L      
Sbjct: 488 SIVELIGKKGKNQLSMRDVDLEKQKEYAVEDADITLQLKEHFTPELASAGTDKLFKDIEM 547

Query: 185 NFLMDRAELDLLGW 198
             L   A +++ G 
Sbjct: 548 PLLDVLAAMEIEGI 561


>gi|294138859|ref|YP_003554837.1| DNA polymerase I [Shewanella violacea DSS12]
 gi|293325328|dbj|BAJ00059.1| DNA polymerase I [Shewanella violacea DSS12]
          Length = 917

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 77/215 (35%), Gaps = 20/215 (9%)

Query: 2   TTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           TTI  HE  +          D IA+DTET  L     +L  +  +   G    + +    
Sbjct: 319 TTIYTHEE-LDLWIDKLANADLIAIDTETTSLNYMDAKLVGISFAIEAGKAAYLPLGHDY 377

Query: 61  KNAP----------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT 110
            +AP           L  +L + + +K+    ++DI++            F T + S + 
Sbjct: 378 LDAPEQLDQAEALAKLKPLLENPELKKVGQNLKYDISIFANVGIKLQGIAFDTMLESYVF 437

Query: 111 RTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALR 164
            +   +H + D   + LG      ++ +      L+  Q+       YAA D      L 
Sbjct: 438 NSVATKHNMDDLALKYLGHKNISFEEIAGKGVKQLTFNQIDLETAAPYAAEDADITLRLH 497

Query: 165 LQFTEKLQRL-GRSDLATS-CCNFLMDRAELDLLG 197
                +L++    + + T      +   ++++  G
Sbjct: 498 QHLWPRLEKEPELASVFTDIELPLIQVLSDIERGG 532


>gi|115396098|ref|XP_001213688.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114193257|gb|EAU34957.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 761

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 57/158 (36%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +      + ++Q+S  +    +  +   ++    L  +  D    
Sbjct: 241 LKAAKEIAIDLEHHDVHSYHGLVSLMQISTREKDWVVDTLKPWREELQMLNEVFTDPSIL 300

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ +  +F T  A+           LK  L++ +     K  Q
Sbjct: 301 KVLHGSSMDIIWLQRDLGLYIVGMFDTYHAACALNYPKRS--LKYLLQKFVNFEADKRYQ 358

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            +DW    L      YA SD  +L  +      +L R 
Sbjct: 359 MADWRIRPLPSGMFDYARSDTHYLLHIYDHLRNELIRN 396


>gi|27363618|ref|NP_759146.1| ribonuclease D [Vibrio vulnificus CMCP6]
 gi|27359734|gb|AAO08673.1| ribonuclease D [Vibrio vulnificus CMCP6]
          Length = 390

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 70/170 (41%), Gaps = 3/170 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  GD    I        +      +L D    
Sbjct: 38  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGDTLSLIDPTVL--TDMSAFTELLNDASVM 95

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V     G    P+  T+I +          G    +++ L + + K++ 
Sbjct: 96  KVLHACGEDLEVFHNALGAIPVPMVDTQIMAAFLGHGL-STGFAALVEQYLNVELDKSES 154

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            +DW A  LSD+QL+YAA+DV +L  L     EK+   G    A      
Sbjct: 155 RTDWLARPLSDKQLEYAAADVHYLLPLYEILLEKVMEAGWWQAAQQESEL 204


>gi|71032543|ref|XP_765913.1| hypothetical protein [Theileria parva strain Muguga]
 gi|68352870|gb|EAN33630.1| hypothetical protein TP01_0386 [Theileria parva]
          Length = 1786

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 54/198 (27%), Positives = 85/198 (42%), Gaps = 17/198 (8%)

Query: 18   RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKN--------------- 62
            +   A+ VD ET GL    +++ +VQLS  +    II +     N               
Sbjct: 1217 KDPKAVGVDIETTGLDHNTNQIRLVQLSVPNQPSLIIDLFKLSTNNPDAESVVPGRNELI 1276

Query: 63   -APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTR-TYTNQHGLK 120
                L  +   ++  K+FH G+FDI  L         P+F T +AS+L   +      L 
Sbjct: 1277 KCEWLKKLFKSKETVKVFHNGKFDINFLRVYGFEFEGPIFDTMVASKLLVASRYISCKLT 1336

Query: 121  DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
               +  L I + K QQ SDWS   L +EQL Y+A D   L  L +     L+    SD+A
Sbjct: 1337 HVSERYLNIVLDKTQQYSDWSTLQLFEEQLLYSARDSFVLLPLYVILEHLLKINNLSDIA 1396

Query: 181  TSCCNFLMDRAELDLLGW 198
            +     ++  ++++L G 
Sbjct: 1397 SVENKCILATSDMELNGI 1414


>gi|288928711|ref|ZP_06422557.1| DNA polymerase type I [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329695|gb|EFC68280.1| DNA polymerase type I [Prevotella sp. oral taxon 317 str. F0108]
          Length = 927

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 62/203 (30%), Gaps = 14/203 (6%)

Query: 8   EGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN- 65
           E DI A        D I++DTET        +L  +  +  +     + +      A N 
Sbjct: 341 EADIQALVNLLSAADVISLDTETTSTNAIDAQLVGLSFAVEEKKAYYVPVPEQANEAQNI 400

Query: 66  ---LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY-TNQHGLKD 121
                 +  +    K+    ++D+ VL     +   P+F T IA  L +    +      
Sbjct: 401 VDKFKAIYENPNTLKVGQNIKYDLEVLRNYGIMLQGPLFDTMIAHYLLQPELRHNMDFMA 460

Query: 122 NLKELLGINIS------KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            +               K +   +      S+    YA  D      L+     KL   G
Sbjct: 461 EVYLNYETVHIDALIGAKGKTQKNMRELAPSEVY-AYACEDADITLQLKNVLQPKLVEAG 519

Query: 176 RSDLATS-CCNFLMDRAELDLLG 197
              L        +   AE++  G
Sbjct: 520 VERLFNEVEMPLIPVLAEMECNG 542


>gi|219870644|ref|YP_002475019.1| ribonuclease D [Haemophilus parasuis SH0165]
 gi|219690848|gb|ACL32071.1| ribonuclease D [Haemophilus parasuis SH0165]
          Length = 375

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 72/193 (37%), Gaps = 9/193 (4%)

Query: 1   MTTIRVHE--GDIPAE----CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDII 54
           M     ++   D P+             IA+DTE +       +L ++QL  G     I 
Sbjct: 1   MNKYIEYQWVDDNPSLAQMCLQVAEQSVIALDTEFVRTRTYYPKLGLIQLFDGKQVYLID 60

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
            ++    +      +L +E   K+ H    D+ V  + F    +P+  T++ +       
Sbjct: 61  PLS--ITDFSPFTALLANENVLKVLHACGEDLEVFQHYFKQLPQPMLDTQVMAGFVG-LG 117

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
              G        L + + K    +DW +  LS+ QLQYA +DV +L  +  +  E L + 
Sbjct: 118 ISIGFAKLALHYLEVELDKGASRTDWLSHPLSEIQLQYACADVWYLLPIYHKLAEDLAKT 177

Query: 175 GRSDLATSCCNFL 187
                    C  L
Sbjct: 178 PWQTAVVEECATL 190


>gi|260599983|ref|YP_003212554.1| DNA polymerase I [Cronobacter turicensis z3032]
 gi|260219160|emb|CBA34515.1| DNA polymerase I [Cronobacter turicensis z3032]
          Length = 966

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 72/201 (35%), Gaps = 18/201 (8%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
            +    +AVDTET  L      L  +  +   G    I +A    +AP+          L
Sbjct: 384 IKTAPVVAVDTETDSLDNLTANLVGISFATEPGLAAYIPVAHDYLDAPDQLPRDRVLELL 443

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L DE   K+    +FD  +L          VF T + S +  + + +H +       
Sbjct: 444 KPLLEDESLVKVGQNLKFDRGILQNYGIELRGIVFDTMLESYILDSVSGRHDMDSLSSRW 503

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRL-GRSDL 179
           L       +Q +    + L+  Q+       YAA D      L L+   KLQ+  G  ++
Sbjct: 504 LKHTTITFEQIAGKGKNQLTFNQIDLEQAGRYAAEDADVTLQLHLKMWPKLQQHKGPLNI 563

Query: 180 AT-SCCNFLMDRAELDLLGWE 199
                   +   + ++  G +
Sbjct: 564 FEHIEMPLVPVLSRIERNGVK 584


>gi|189425854|ref|YP_001953031.1| DNA polymerase I [Geobacter lovleyi SZ]
 gi|189422113|gb|ACD96511.1| DNA polymerase I [Geobacter lovleyi SZ]
          Length = 888

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 62/210 (29%), Gaps = 18/210 (8%)

Query: 6   VHEGDIPAE-CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP 64
           +   D+           A A DTET GL PR   L  + +S        I +       P
Sbjct: 295 LTNEDLEKLALRLEAAPAFAFDTETTGLDPRTAELVGISISLQAHEAFYIPVGHRYLGMP 354

Query: 65  ----------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
                      L     +    K+    +FD+ +L             T + S L     
Sbjct: 355 DQLPRETVLERLRPAFGNPAIRKVGQNLKFDLQILAVAGLEVQGSWCDTMLCSYLLNPSR 414

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLS------DEQLQYAASDVVHLHALRLQFT 168
             HGL    +E L   +    + +    + +       ++  +YAA D      L  +  
Sbjct: 415 GGHGLDALAQEHLNHKMISYDEVTGSGKNRICFSEVEVEKATRYAAEDADATWLLHEKLL 474

Query: 169 EKLQRLGRSD-LATSCCNFLMDRAELDLLG 197
             L+  G    L       +     ++  G
Sbjct: 475 PMLKEQGLEKLLFELEMPLMEIMTRMEQHG 504


>gi|288800530|ref|ZP_06405988.1| DNA polymerase type I [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332743|gb|EFC71223.1| DNA polymerase type I [Prevotella sp. oral taxon 299 str. F0039]
          Length = 921

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/212 (20%), Positives = 70/212 (33%), Gaps = 16/212 (7%)

Query: 3   TIRVHE--GDIPAECAARYVD-AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++ E   DI   C        +++DTET  L      L  +  S        + I   
Sbjct: 328 NYKLIEKEEDINNLCDLLLTKRIVSLDTETTSLNALEAELVGLSFSVSPQEAFYVPIPNE 387

Query: 60  QKNAPN----LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
           Q+ A         +  +E+ EK+    ++DI VL         P+F T IA         
Sbjct: 388 QQKAQKIVNAFQPLYENEEIEKVGQNIKYDIEVLRNYGITMKGPLFDTMIA-HYLLQPEL 446

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADD-------LSDEQLQYAASDVVHLHALRLQFT 168
           +H + D  +  L        Q       D         ++ + YA  D      L+  F 
Sbjct: 447 RHNMDDMAETYLRYKTIHIDQLIGAKGKDQLNMRSLAPEQIVDYACEDADITLQLKNIFE 506

Query: 169 EKLQRLGRSDLATS-CCNFLMDRAELDLLGWE 199
            KL+  G   L        +   AE++  G +
Sbjct: 507 PKLKEAGLYPLFKEVEMPLIYVLAEMECNGVK 538


>gi|152978783|ref|YP_001344412.1| ribonuclease D [Actinobacillus succinogenes 130Z]
 gi|150840506|gb|ABR74477.1| ribonuclease D [Actinobacillus succinogenes 130Z]
          Length = 383

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 72/171 (42%), Gaps = 3/171 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A+   A+A+DTE + +     +L ++QL  G+    I        +      +L D    
Sbjct: 27  AQQKSAVALDTEFIRIRSYYPKLGLIQLYDGERVSLIDPTT--ITDFSPFTALLADINVI 84

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + F     P+  T++ +          GL   ++  L + I K   
Sbjct: 85  KVLHACYEDLEVFSHYFQQLPEPIMDTQVMAGFLAFPH-STGLASLIRHYLALEIDKGAS 143

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
            +DW A  LS++QLQYAA+DV +L  L  +   +L +          C  L
Sbjct: 144 RTDWLARPLSEKQLQYAAADVWYLLPLYEKMAVELAKTRWQSAVEFDCGLL 194


>gi|221134772|ref|ZP_03561075.1| ribonuclease D [Glaciecola sp. HTCC2999]
          Length = 382

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 75/176 (42%), Gaps = 3/176 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A     IAVDTE +        + +VQ+  G     I  IA    +   L  ++ + +  
Sbjct: 21  AAQQSVIAVDTEFVRTRTFYPHIGLVQIYDGVDIALIDPIA--IDDLSPLSQLMTNPQVI 78

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+    +  GV   P+F T++A++      N  G    ++ L  I + K + 
Sbjct: 79  KVLHACSEDLETFEFALGVMPEPLFDTQVAAQ-LAGLGNSVGYGRLVELLQDITLEKGES 137

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            +DW    LS EQL YAA DV++L     +  EKL+   +        N L+ R  
Sbjct: 138 RTDWIRRPLSPEQLIYAAEDVLYLLPCYFKLAEKLEASQQLHWVYDEVNQLIRRKR 193


>gi|325286748|ref|YP_004262538.1| DNA polymerase I [Cellulophaga lytica DSM 7489]
 gi|324322202|gb|ADY29667.1| DNA polymerase I [Cellulophaga lytica DSM 7489]
          Length = 946

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 66/199 (33%), Gaps = 12/199 (6%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----NLVGMLV 71
                 ++  DTET GL P    L  +  S        I     Q  A      L     
Sbjct: 368 NLMKQTSVCFDTETTGLNPLTAELVGIAFSWEASKGFYIPFPEDQDQAQELIEQLRPFFE 427

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
           DEK EKI    ++DI VL     +     F T +A  L       +         +    
Sbjct: 428 DEKIEKIGQNLKYDIKVLRKYNLIIKGAYFDTMLAHYLINPDMRHNMDVLAETYLNYTPI 487

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++         ++Q +YA  D    + L   F  +L+     +L      
Sbjct: 488 SITELIGKKGKNQLSMRQVPIEKQTEYAVEDADITYQLASHFKPELKDAKTEELFNDIEI 547

Query: 185 NFLMDRAELDLLGWE-NVD 202
             L   A+++L G   +VD
Sbjct: 548 PLLSVLADMELEGINLDVD 566


>gi|68171541|ref|ZP_00544920.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999046|gb|EAM85718.1| 3'-5' exonuclease [Ehrlichia chaffeensis str. Sapulpa]
          Length = 387

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 3/179 (1%)

Query: 11  IPAECAARYVDAIAVDTETLGLMP-RRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +  +        IAVDTE +        +LC++Q++ G     +I + A   +   L  +
Sbjct: 12  LCNQLLVLQPKFIAVDTEFVRSSSEYYPKLCLIQIAYGKEQ-FVIDVLAKDMDLSVLGHI 70

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
             +E   K+FH  R DI  L   F     P+F T+IA+     Y N  G    +++ LGI
Sbjct: 71  FYNESIIKVFHDCRQDIDALLTKFPEIPSPIFDTQIAAMFCCCYDNAVGYSKLVEQFLGI 130

Query: 130 NISK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           ++ K + + S+W+   LS +++QYA +DV++L+ L       L   G+        N +
Sbjct: 131 SLDKLSLKRSNWALRPLSADKIQYALNDVIYLYELYQILYNNLLDAGKLPWFLEEMNNI 189


>gi|238895380|ref|YP_002920115.1| ribonuclease D [Klebsiella pneumoniae NTUH-K2044]
 gi|238547697|dbj|BAH64048.1| ribonuclease D [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 375

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + A C AA    A+A+DTE +       +L ++QL  G   V +I    
Sbjct: 1   MNYQMITTDNGLRAVCEAASTASAVALDTEFVRTRTYYPQLGLLQLFDG-QQVSLIDPLT 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
               AP    +L+++   K  H G  D+ V    F +  +P+  T+I +          G
Sbjct: 60  INDWAPM-RDLLLNQDVTKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  Q   +  R G   
Sbjct: 118 FASMVEEYSGVALDKSESRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRVMQQR 189


>gi|270262203|ref|ZP_06190475.1| hypothetical protein SOD_b04110 [Serratia odorifera 4Rx13]
 gi|270044079|gb|EFA17171.1| hypothetical protein SOD_b04110 [Serratia odorifera 4Rx13]
          Length = 373

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  AR    IA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITTDAGLQQVCEQARNHAQIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPI 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
            Q      + +L D +  K  H G  D+ V    F     P+  T+I +          G
Sbjct: 61  KQ--WQPFIDLLSDTQIVKFLHAGSEDLEVFLNAFKTLPTPMVDTQILAAF-TGRPLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E + +++ K++  +DW A  L+++Q  YAA+DV +L  +  Q  ++ +  G + 
Sbjct: 118 FATLVTEYMQVDLDKSESRTDWLARPLTEKQCVYAAADVFYLLPMAQQLVQETEDAGWTA 177

Query: 179 LATSCCNFLMDR 190
            A + C  L  R
Sbjct: 178 AAANECLLLCQR 189


>gi|88658362|ref|YP_507121.1| putative ribonuclease D [Ehrlichia chaffeensis str. Arkansas]
 gi|88599819|gb|ABD45288.1| putative ribonuclease D [Ehrlichia chaffeensis str. Arkansas]
          Length = 387

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 3/179 (1%)

Query: 11  IPAECAARYVDAIAVDTETLGLMP-RRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +  +        IAVDTE +        +LC++Q++ G     +I + A   +   L  +
Sbjct: 12  LCNQLLVLQPKFIAVDTEFVRSSSEYYPKLCLIQIAYGKEQ-FVIDVLAKDMDLSVLGHI 70

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
             +E   K+FH  R DI  L   F     P+F T+IA+     Y N  G    +++ LGI
Sbjct: 71  FYNESIIKVFHDCRQDIDALLTKFPEIPSPIFDTQIAAMFCCCYDNAVGYSKLVEQFLGI 130

Query: 130 NISK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           ++ K + + S+W+   LS +++QYA +DV++L+ L       L   G+        N +
Sbjct: 131 SLDKLSLKRSNWALRPLSADKIQYALNDVIYLYELYQILYNNLLDAGKLPWFLEEMNNI 189


>gi|90411623|ref|ZP_01219633.1| hypothetical ribonuclease D [Photobacterium profundum 3TCK]
 gi|90327513|gb|EAS43866.1| hypothetical ribonuclease D [Photobacterium profundum 3TCK]
          Length = 374

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 81/184 (44%), Gaps = 7/184 (3%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    + +DTE +       +L ++Q+  GD  V I  I    ++      +L D+   
Sbjct: 19  ARTYSVVMLDTEFVRTRTLYPKLGLIQMFDGDNLVLIDPIE--IEDLTPFWDLLRDQSVI 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  +  G    P+  T++ +          G    + E +G+++ K + 
Sbjct: 77  KVLHACGEDLEVFQHHAGCLPTPMIDTQLMAAFLGHGV-SAGFGSLVSEYVGVDLEKGEA 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR----AE 192
            ++W A  L+D+QL YAA+DV +L  L     EK++  G  D     C  LM +     +
Sbjct: 136 RTNWLARPLTDKQLDYAAADVFYLLPLYETLLEKVKAKGWMDALELECTALMQKRTQGVD 195

Query: 193 LDLL 196
           LD  
Sbjct: 196 LDKA 199


>gi|74311884|ref|YP_310303.1| ribonuclease D [Shigella sonnei Ss046]
 gi|73855361|gb|AAZ88068.1| RNase D [Shigella sonnei Ss046]
          Length = 375

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 82/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  + + C A R   AIA DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQMITTDDALASLCEAVRVFPAIAQDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL-- 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
           G  +   L  +L D    K  H G  D+ V    FG   +P+  T+I +          G
Sbjct: 59  GITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               ++E  G+ + K++  +DW A  L++ Q +YAA+DV +L  +  +   + +  G   
Sbjct: 118 FASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLP 177

Query: 179 LATSCCNFLMDR 190
            A   C  +  R
Sbjct: 178 AALDECRLMQMR 189


>gi|330000265|ref|ZP_08303673.1| ribonuclease D [Klebsiella sp. MS 92-3]
 gi|328538027|gb|EGF64198.1| ribonuclease D [Klebsiella sp. MS 92-3]
          Length = 372

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA    A+A+DTE +       +L ++QL  G   V +I        AP    +L+++  
Sbjct: 15  AASTASAVALDTEFVRTRTYYPQLGLLQLFDG-QQVSLIDPLTINDWAPM-RDLLLNQDV 72

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    F +  +P+  T+I +          G    ++E  G+ + K++
Sbjct: 73  TKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVALDKSE 131

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 132 SRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLPAALDECRVMQQR 186


>gi|262041917|ref|ZP_06015100.1| ribonuclease D [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040723|gb|EEW41811.1| ribonuclease D [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 371

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA    A+A+DTE +       +L ++QL  G   V +I        AP    +L+++  
Sbjct: 14  AASTASAVALDTEFVRTRTYYPQLGLLQLFDG-QQVSLIDPLTINDWAPM-RDLLLNQDV 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    F +  +P+  T+I +          G    ++E  G+ + K++
Sbjct: 72  TKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVALDKSE 130

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 131 SRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLPAALDECRVMQQR 185


>gi|85059311|ref|YP_455013.1| ribonuclease D [Sodalis glossinidius str. 'morsitans']
 gi|84779831|dbj|BAE74608.1| ribonuclease D [Sodalis glossinidius str. 'morsitans']
          Length = 380

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/193 (23%), Positives = 82/193 (42%), Gaps = 6/193 (3%)

Query: 1   MTTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M   ++   D  +   C   R    +AVDTE +       +L ++Q+  G+    I  +A
Sbjct: 1   MLDYQLITTDQALHDRCQQVRQHPWVAVDTEFVRTCTYYPQLGLIQMFDGEALTLIDPLA 60

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               +    + +L DE+  K+ H    D+ V +++FG    P+  T++ +          
Sbjct: 61  --ITDWQPFIALLADEQVTKLLHACSEDLEVFWHSFGQMPVPMIDTQVLAAF-TGRALSC 117

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    + E L + + K +  +DW A  LS  Q  YAA+DV  L  +  +   + Q+ G  
Sbjct: 118 GFAALVAETLDVTLDKTESRTDWLARPLSKRQCDYAAADVYWLLPMAHKLIAQTQQAGWW 177

Query: 178 DLATSCCNFLMDR 190
             A+  C  +  R
Sbjct: 178 SQASQECEAICQR 190


>gi|304312978|ref|YP_003812576.1| Ribonuclease D [gamma proteobacterium HdN1]
 gi|301798711|emb|CBL46944.1| Ribonuclease D [gamma proteobacterium HdN1]
          Length = 377

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/176 (23%), Positives = 74/176 (42%), Gaps = 1/176 (0%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A+DTE +        L ++Q++  D  + I  I A   +    + +  +++  
Sbjct: 20  LSQQSVVALDTEFMRSDTFYPILGLLQVASQDTVLLIDGIDAVCMSIAAEMLLNENQQPT 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
            + H    D+ V    +      +  T++A+     +  Q  L++ L   LG+++ K + 
Sbjct: 80  WVLHSCAEDLEVALNQWDALPNRLVDTQLAAAHLG-HPRQMSLQNLLAVELGVHLPKDET 138

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            SDW    LS  QL YAA DV HL  L  + +  L    R    T  C  L+ +A 
Sbjct: 139 RSDWCKRPLSSAQLSYAAGDVAHLLPLWEKLSHTLHERDRMSWFTEDCAKLIAKAR 194


>gi|269138811|ref|YP_003295512.1| ribonuclease D [Edwardsiella tarda EIB202]
 gi|267984472|gb|ACY84301.1| ribonuclease D [Edwardsiella tarda EIB202]
 gi|304558803|gb|ADM41467.1| Ribonuclease D [Edwardsiella tarda FL6-60]
          Length = 371

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 75/174 (43%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A     IA+DTE +       +L +VQL  G+    I  +     +    V +L + +  
Sbjct: 20  ASACPYIALDTEFVRTRTYYPQLGLVQLYDGETLSLIDPLP--ISDWQPFVDLLRNPQVV 77

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H G  D+ V  + F    +P+  T+I +          G    +   L +++ K++ 
Sbjct: 78  KLLHAGSEDLEVFLHDFQTLPQPLIDTQILAAF-TGRPLSSGFAAMVSAYLQVDLDKSES 136

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS+ Q  YAA+DV +L  +  +   +++  G    A   C  L  R
Sbjct: 137 RTDWLARPLSERQCDYAAADVYYLLPMAHKLLAEVEACGWLPAALDECQALCRR 190


>gi|152970868|ref|YP_001335977.1| ribonuclease D [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|150955717|gb|ABR77747.1| RNase D, processes tRNA precursor [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 371

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA    A+A+DTE +       +L ++QL  G   V +I        AP    +L+++  
Sbjct: 14  AASTASAVALDTEFVRTRTYYPQLGLLQLFDG-QQVSLIDPLTINDWAPM-RDLLLNQDV 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V    F +  +P+  T+I +          G    ++E  G+ + K++
Sbjct: 72  TKYLHAGSEDLEVFLNAFNLMPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVALDKSE 130

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L++ Q +YAA+DV +L  +  Q   +  R G    A   C  +  R
Sbjct: 131 SRTDWLARPLTERQCEYAAADVWYLLPIASQLMAETDRAGWLPAALDECRVMQQR 185


>gi|332291323|ref|YP_004429932.1| DNA polymerase I [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169409|gb|AEE18664.1| DNA polymerase I [Krokinobacter diaphorus 4H-3-7-5]
          Length = 949

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 67/199 (33%), Gaps = 12/199 (6%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----NLVGMLV 71
                 ++  DTET GL P    L  +  S   G    I     ++ A      L     
Sbjct: 372 NLNKQSSVCFDTETTGLDPLVAELVGIAFSWEAGKGYYIPFPESKEEAQALIEELRPFFE 431

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
           +   EKI    ++DI VL          +F T +A  L       +         +    
Sbjct: 432 NTAIEKIGQNLKYDIKVLAKYNVKVKGKLFDTMLAHYLINPDMRHNMDVLAETYLNYTPV 491

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++     D   D+Q +YA  D      L+  F ++L   G   L      
Sbjct: 492 SITELIGKKGKNQKSMRDVSVDDQTEYAVEDADITLQLKQHFEKELDEAGTRKLFDDIEI 551

Query: 185 NFLMDRAELDLLGWENVDI 203
             L   A +++ G  N+D+
Sbjct: 552 PLLRVLAAMEVEGI-NLDV 569


>gi|325924432|ref|ZP_08185961.1| ribonuclease D [Xanthomonas gardneri ATCC 19865]
 gi|325545080|gb|EGD16405.1| ribonuclease D [Xanthomonas gardneri ATCC 19865]
          Length = 364

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 79/188 (42%), Gaps = 3/188 (1%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++     A     I +DTE +       +L +VQ++ G+  + I  +  G   A  L
Sbjct: 7   HPSELTQRLHAARPSRIGLDTEFIRERTYWPQLALVQMAIGEEILLIDPLIPGMNAA--L 64

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L      K+ H    D+       GV  RP+F T+IA+ L          K  ++E+
Sbjct: 65  GEWLTATDIVKVMHSASEDLVTFKCACGVLPRPLFDTQIAAALAGVGGGMGYQK-LVQEV 123

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            G  ++K +  SDW    LS  QL+YAA DV +L A+  + + +L    R          
Sbjct: 124 TGTLLTKGETRSDWMRRPLSPAQLEYAADDVRYLFAIHDELSRRLTEQDRLGWLAEDAER 183

Query: 187 LMDRAELD 194
           L+   E D
Sbjct: 184 LLATVEHD 191


>gi|255534870|ref|YP_003095241.1| DNA polymerase I [Flavobacteriaceae bacterium 3519-10]
 gi|255341066|gb|ACU07179.1| DNA polymerase I [Flavobacteriaceae bacterium 3519-10]
          Length = 949

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 61/194 (31%), Gaps = 11/194 (5%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA----PNLVGML 70
                  A+A DTET  L      L  +  S   G    I ++  +  A           
Sbjct: 371 WNLMSQKAVAFDTETTTLNEMDAELVGLSFSYRKGLAYYIPLSEDRSEAIQTLEIFREFF 430

Query: 71  VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY--TNQHGLKDNLKELLG 128
             E   K+ H  +FD  +L          +F T IA  L           L +       
Sbjct: 431 EKEDVSKVAHNLKFDYKILQQYGFSLKGLLFDTMIAHYLLNPDGKHVIDYLSEIYLNYKP 490

Query: 129 INIS----KAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL-ATSC 183
           + +     K  ++         +EQ  YAA D      L   F  +L++    DL     
Sbjct: 491 VALESLIGKKGKNQLTFRSLTVEEQTNYAAEDADITWQLYEVFAPQLKKENLEDLFYKVE 550

Query: 184 CNFLMDRAELDLLG 197
              L   A+++L G
Sbjct: 551 MPLLRVLAKMELEG 564


>gi|157370999|ref|YP_001478988.1| ribonuclease D [Serratia proteamaculans 568]
 gi|157322763|gb|ABV41860.1| ribonuclease D [Serratia proteamaculans 568]
          Length = 390

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 82/191 (42%), Gaps = 6/191 (3%)

Query: 3   TIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++   D  +   C  A+    IA+DTE +       +L ++QL  G+    I  +   
Sbjct: 19  NYQLITTDAGLQQVCDQAKKHAQIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPIK 78

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
           Q      + +L + +  K  H G  D+ V    F     P+  T+I +          G 
Sbjct: 79  Q--WQPFIELLSNTQVVKFLHAGSEDLEVFLNAFKTLPTPMVDTQILAAF-TGRPMSCGF 135

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + E + + + K++  +DW A  L+++Q  YAA+DV +L  +  +  ++ +  G +  
Sbjct: 136 ATLVAEYMEVELDKSEARTDWLARPLTEKQCVYAAADVFYLLPMAKRLVQETEEAGWTAA 195

Query: 180 ATSCCNFLMDR 190
           A++ C  L  R
Sbjct: 196 ASNECLLLCQR 206


>gi|242239440|ref|YP_002987621.1| ribonuclease D [Dickeya dadantii Ech703]
 gi|242131497|gb|ACS85799.1| ribonuclease D [Dickeya dadantii Ech703]
          Length = 403

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/193 (23%), Positives = 84/193 (43%), Gaps = 6/193 (3%)

Query: 3   TIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++   D  +   C+ AR +  +A+DTE +       +L ++QL  G+    I  ++  
Sbjct: 31  NYQLITTDDGLSEVCSQARRMPQVALDTEFVRTRTYYPQLGLIQLFDGERLSLIDPLS-- 88

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                    +L+D    K  H G  D+ V    FG+   P   T+I           +G 
Sbjct: 89  ITVWQPFCDLLLDPAVTKYLHAGSEDLEVFLNAFGLLPTPFVDTQILVAFLGKPL-SYGF 147

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + + + + + K++  +DW A  LS++Q QYAA+DV +L  + ++  E+    G  + 
Sbjct: 148 AALVADYMQVTLDKSESRTDWLARPLSEKQCQYAAADVYYLLPMAIRLVEETTSAGWWEA 207

Query: 180 ATSCCNFLMDRAE 192
           A   C  L  R +
Sbjct: 208 ALDECRQLCQRKQ 220


>gi|227327782|ref|ZP_03831806.1| ribonuclease D [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 374

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/194 (23%), Positives = 82/194 (42%), Gaps = 6/194 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C+ AR    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITSDIGLQQVCSQARRFPQVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLT- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L DE+  K  H G  D+ V    F     P   T+I +         +G
Sbjct: 60  -ITDWAPFQALLRDEQVTKFLHAGSEDLEVFLNAFETLPTPFIDTQILAAFLGKPL-SYG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + + +G+ + K++  +DW A  LS++Q  YAA+DV +L  + +Q     +  G  +
Sbjct: 118 FAALVADYMGVTLDKSESRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVADTEAAGWMN 177

Query: 179 LATSCCNFLMDRAE 192
            A   C  L  R +
Sbjct: 178 AALDECLLLCQRKQ 191


>gi|226228424|ref|YP_002762530.1| putative ribonuclease [Gemmatimonas aurantiaca T-27]
 gi|226091615|dbj|BAH40060.1| putative ribonuclease [Gemmatimonas aurantiaca T-27]
          Length = 388

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 56/176 (31%), Positives = 83/176 (47%), Gaps = 8/176 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
              V AIA+DTE        DR+ ++QLS  D    I  +  G      L  +L D + E
Sbjct: 22  LNGVRAIALDTEGASFHRFVDRIYLLQLSTADHEAVIDPLPIGT--PTRLGVLLEDPQVE 79

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
            + H   +D+ +L   +G RV  +F T++A++L        GL   L++  GI + K  Q
Sbjct: 80  VVLHDADYDLRLLRQDYGWRVTHLFDTRVAAQLLGIRAF--GLAALLEQFFGIKLDKKHQ 137

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            +DWS   L+ + L YAA D  HL  LR +  ++L + GR   A         RAE
Sbjct: 138 RADWSMRPLTADMLDYAAHDTRHLLGLRDRLHDELVQKGRWSWAQEEF----TRAE 189


>gi|238788499|ref|ZP_04632292.1| Ribonuclease D [Yersinia frederiksenii ATCC 33641]
 gi|238723412|gb|EEQ15059.1| Ribonuclease D [Yersinia frederiksenii ATCC 33641]
          Length = 394

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/191 (24%), Positives = 77/191 (40%), Gaps = 6/191 (3%)

Query: 3   TIRVHEGD--IPAECAA-RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++   D  +   C   R    +A+DTE +       +L ++QL  G+    I  +   
Sbjct: 23  NYQLITTDSALQQVCELARKHAHVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLP-- 80

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                    +L D    K  H G  D+ V    FG+   P+  T++ +      T   G 
Sbjct: 81  ITEWQPFRELLQDLNVVKYLHAGSEDLEVFLNAFGLMPTPMIDTQVLAAF-SGRTLSCGF 139

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + E  G+ + K++  +DW A  LS++Q  YAA+DV +L  L  +     +   R D 
Sbjct: 140 AMLVNEFEGVELDKSESRTDWIARPLSEKQCDYAAADVFYLLPLATKLVAATEAAERMDA 199

Query: 180 ATSCCNFLMDR 190
           A   C  L  R
Sbjct: 200 AIDECQLLCRR 210


>gi|87307951|ref|ZP_01090094.1| ribonuclease D [Blastopirellula marina DSM 3645]
 gi|87289565|gb|EAQ81456.1| ribonuclease D [Blastopirellula marina DSM 3645]
          Length = 392

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 65/186 (34%), Gaps = 6/186 (3%)

Query: 2   TTIRVH--EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
                   +  +   C   R    I  DTE +        LC+VQ++ G+    +     
Sbjct: 1   MNYEYVESQSQLTELCDRLRSESHIYFDTEFVSEDVYLPDLCLVQIAAGEILAIVDP--K 58

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      ++       + H GR +    +   G     +F T+IA            
Sbjct: 59  RIDDMNVFWELIAGGDHVSVVHSGREEFLFCYRATGKAPANLFDTQIA-GGLIGMEYPAS 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
             + +  LL   + K +  +DW    LS  Q++YA +DV +L     +  ++L +L R+ 
Sbjct: 118 FGNLILRLLDEKLPKGETRTDWRVRPLSSRQIEYALNDVAYLGPAAQELEKELTKLDRTS 177

Query: 179 LATSCC 184
                 
Sbjct: 178 WLQEEM 183


>gi|332519119|ref|ZP_08395586.1| DNA polymerase I [Lacinutrix algicola 5H-3-7-4]
 gi|332044967|gb|EGI81160.1| DNA polymerase I [Lacinutrix algicola 5H-3-7-4]
          Length = 953

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/200 (20%), Positives = 64/200 (32%), Gaps = 11/200 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----NLVGMLV 71
                 ++  DTET GL P    L  +  S   G    +     ++ A      L     
Sbjct: 375 NLMNQTSVCFDTETTGLNPLTAELVGIAFSWETGKGFYLPFPEDKQEAQAIIEALRCFFE 434

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
            E  +KI    ++DI VL         P+F T +A  L       +         +    
Sbjct: 435 AENIQKIGQNLKYDIKVLAKYNVEVKGPLFDTMLAHYLINPDMRHNMDVLAETYLNYTPV 494

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++     D   D+Q +YA  D      L+  F ++L       L      
Sbjct: 495 SITELIGKKGKNQLSMRDVPLDKQTEYAVEDADITLQLKEHFEKELGEANTQKLFDDIEV 554

Query: 185 NFLMDRAELDLLGWENVDIF 204
             L   A ++L G      F
Sbjct: 555 PLLRVLAAMELEGINLDKDF 574


>gi|157124837|ref|XP_001660547.1| hypothetical protein AaeL_AAEL010007 [Aedes aegypti]
 gi|108873835|gb|EAT38060.1| conserved hypothetical protein [Aedes aegypti]
          Length = 949

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 67/169 (39%), Gaps = 4/169 (2%)

Query: 8   EGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           E  +P      +    +A+D E       +   C++Q+S       II   A ++    L
Sbjct: 277 ESQLPGLLKELKAAKELAIDLEHHSYRTYQGFTCLMQISTRSKD-YIIDTLALREELHIL 335

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +  + K  K+ H    DI  L     + +  +F T  A+++      + GL+  LK  
Sbjct: 336 NEVFTNPKVVKVLHGAISDIEWLQRDLSLYIVNMFDTGEAAKVLEFS--RIGLQFLLKHY 393

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
             I+  KA Q +DW    +    ++YA  D  +L  +  +   +L   G
Sbjct: 394 CNIDTDKAYQLADWRIRPIPHNFIEYARKDTHYLLYIYDRMRNELIAKG 442


>gi|327312866|ref|YP_004328303.1| DNA-directed DNA polymerase [Prevotella denticola F0289]
 gi|326945701|gb|AEA21586.1| DNA-directed DNA polymerase [Prevotella denticola F0289]
          Length = 920

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/189 (19%), Positives = 70/189 (37%), Gaps = 11/189 (5%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA----PNLVGMLVDEKR 75
            + +++DTET      R  L  +  S  +     + + A ++ A         +  ++  
Sbjct: 347 KEFVSIDTETTSTDAIRAELVGLSFSVEENKAFYVPLPANREEALKYVRIFKPLYENDNI 406

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--YTNQHGLKDNLKELLGINISK 133
            KI    ++D  VL          +F T IA  L +   + N   + + L     I+I +
Sbjct: 407 LKIGQNIKYDYEVLNNYGVTLQGKMFDTMIAHYLIQPELHHNMDYMAETLLGYRTIHIEE 466

Query: 134 AQQSSDWSADDLSD----EQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA-TSCCNFLM 188
                     ++ D    +  +YAA D      L+     +L+ LG  +L        + 
Sbjct: 467 LIGPKGKKQKNMRDLSPTDICEYAAEDADITLRLKHLLEPRLKELGLEELFWNIEMPLVR 526

Query: 189 DRAELDLLG 197
             A+++L G
Sbjct: 527 VLADMELNG 535


>gi|301062352|ref|ZP_07203015.1| DNA-directed DNA polymerase [delta proteobacterium NaphS2]
 gi|300443556|gb|EFK07658.1| DNA-directed DNA polymerase [delta proteobacterium NaphS2]
          Length = 893

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/208 (17%), Positives = 67/208 (32%), Gaps = 18/208 (8%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------N 65
             R    +A+DTET G  P R  L  V     +G    + +       P           
Sbjct: 310 DMRSAGLLAIDTETTGTDPMRADLVGVSFCLKEGKAFYLPVGHHYLGVPAQVSWPDARDV 369

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L D+   K+    ++D  VL           F T IAS +      QH L    + 
Sbjct: 370 LKDVLEDDAVLKVGQNIKYDACVLKRHGVSLSGISFDTMIASYVINPGLRQHNLDALAQR 429

Query: 126 LLGINISKAQQSSDWSA------DDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
            L   +   +             +   ++  +Y+  D      LR    ++++      L
Sbjct: 430 YLNHKMISYKDVVGKGKNARGFEEVSLEKACEYSCEDADMTFRLRRILAKQIRDEKNEAL 489

Query: 180 ATS-CCNFLMDRAELDLLGWE-NVDIFS 205
                   L    ++++ G + +  +F 
Sbjct: 490 FNELEMKLLPVLLDMEMTGIKIDTALFE 517


>gi|269468831|gb|EEZ80435.1| ribonuclease D [uncultured SUP05 cluster bacterium]
          Length = 345

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/188 (25%), Positives = 76/188 (40%), Gaps = 9/188 (4%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           + +    +A+DTE   +      LC+VQ++    T  I  +     +   L   L  +  
Sbjct: 14  SIKDETELAIDTEFKRVNTYYPVLCLVQIATKKNTDCIDVLTL--DDLSPLFDKLYQDDC 71

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
             I H  R DI  L Y      + +F T+IA+     Y  Q   +   + L  +++ KA 
Sbjct: 72  LWIVHSARQDIEALHYLSKQLPKQLFDTQIAA-SLVNYPAQISYQALTESLQNVHLEKAY 130

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
              DW+   L DE ++YA  DV +L     Q   +L+   +S         L     LD+
Sbjct: 131 TRLDWTIRPLPDEAIEYALDDVRYLLKNYRQLKTQLEVEEKSTWIEEEGKSL-----LDI 185

Query: 196 LGWENVDI 203
             + N DI
Sbjct: 186 NLY-NPDI 192


>gi|83648986|ref|YP_437421.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
 gi|83637029|gb|ABC32996.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
          Length = 911

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 63/200 (31%), Gaps = 18/200 (9%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN---------- 65
           A       + DTET  L      +  V  +   G    + +A     AP           
Sbjct: 327 ALTDAKTFSFDTETTSLNYMEAEIVGVSFAVEPGKAAYVPVAHDYMGAPEQLERDKVLAA 386

Query: 66  LVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKE 125
           L  +L D    KI    ++D  VL             T + S +  +  N+H +     +
Sbjct: 387 LKPLLEDPAYRKIGQNLKYDAHVLANHGVQLNGIAEDTMLESYVLNSTANRHDMDTLASK 446

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSD- 178
            LG      +  +   A  L+  Q+       YAA D      L      KL++ GR + 
Sbjct: 447 HLGRETIHFEDIAGKGAKQLTFNQISLEQAGPYAAEDADITLQLHHALNPKLKKEGRLEQ 506

Query: 179 LATS-CCNFLMDRAELDLLG 197
           +        +     ++  G
Sbjct: 507 VYRDIELPLVPVLMRMEHRG 526


>gi|167855622|ref|ZP_02478381.1| ribonuclease D [Haemophilus parasuis 29755]
 gi|167853249|gb|EDS24504.1| ribonuclease D [Haemophilus parasuis 29755]
          Length = 388

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 72/193 (37%), Gaps = 9/193 (4%)

Query: 1   MTTIRVHE--GDIPAE----CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDII 54
           M     ++   D P+             IA+DTE +       +L ++QL  G     I 
Sbjct: 14  MNKYIEYQWVDDNPSLAQMCLQVAEQSVIALDTEFVRTRTYYPKLGLIQLFDGKQVYLID 73

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
            ++    +      +L +E   K+ H    D+ V  + F    +P+  T++ +       
Sbjct: 74  PLS--ITDFSPFTALLTNENVLKVLHACSEDLEVFQHYFKQLPQPMLDTQVMAGFVG-IG 130

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
              G        L + + K    +DW +  LS+ QLQYA +DV +L  +  +  E L + 
Sbjct: 131 ISIGFAKLALHYLEVELDKGASRTDWLSRPLSEIQLQYACADVWYLLPIYHKLAEDLAKT 190

Query: 175 GRSDLATSCCNFL 187
                    C  L
Sbjct: 191 LWQTAVVEECATL 203


>gi|40063040|gb|AAR37896.1| ribonuclease D, putative [uncultured marine bacterium 560]
          Length = 358

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/183 (21%), Positives = 69/183 (37%), Gaps = 8/183 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                ++A+DTE   +      LC+VQ++       I  ++    +   L   L   K E
Sbjct: 28  INNDSSLAIDTEFKRINTYYPELCLVQIATTQFAECIDVLSIN--DLEPLFEKLYHNKTE 85

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
            I H  R DI  L++        +F T+IA+     Y  Q   +   + L  + + K+  
Sbjct: 86  WIVHSARQDIEALYHLSKRIPVSLFDTQIAA-SLLNYPLQISYQALTEILQDVLLDKSYT 144

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
             DW+   L    ++YA  DV +L     +   +L    +         FL     LD  
Sbjct: 145 RFDWTTRPLPANVVEYALDDVRYLLPNFEKLKHELTISKKIQWLDEETRFL-----LDQE 199

Query: 197 GWE 199
            ++
Sbjct: 200 LYK 202


>gi|323166513|gb|EFZ52276.1| ribonuclease D [Shigella sonnei 53G]
          Length = 371

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 3/170 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
            AIA DTE +       +L ++QL  G+    I  +  G  +   L  +L D    K  H
Sbjct: 19  PAIAQDTEFVRTRTYYPQLGLIQLFDGEHLALIDPL--GITDWSPLKAILRDPSITKFLH 76

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
            G  D+ V    FG   +P+  T+I +          G    ++E  G+ + K++  +DW
Sbjct: 77  AGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPM-SWGFASMVEEYSGVTLDKSESRTDW 135

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            A  L++ Q +YAA+DV +L  +  +   + +  G    A   C  +  R
Sbjct: 136 LARPLTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDECRLMQMR 185


>gi|78484390|ref|YP_390315.1| DNA polymerase I [Thiomicrospira crunogena XCL-2]
 gi|78362676|gb|ABB40641.1| DNA polymerase I [Thiomicrospira crunogena XCL-2]
          Length = 939

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 60/206 (29%), Gaps = 25/206 (12%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGD-------GTVDIIRIAAGQKNAP----- 64
               D  A+DTET  L     ++  V  +  +            + +      AP     
Sbjct: 349 LEASDVFAIDTETTSLNAMEAKIVGVSFAYAEKKDQAWQNFAAYVPLTHDYDGAPEQLPI 408

Query: 65  -----NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                 L  +L +   +K+    ++D  +            + T + S    +   +H +
Sbjct: 409 QEVLAKLKPLLENPAIKKVGQNFKYDWHIFKNAGIEVQGMAYDTMLESYCFNSVATRHNM 468

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQR 173
            D     L  +    +  +       +  Q++      YAA D      L      KLQ 
Sbjct: 469 DDLALTYLNHSTIHFKDIAGTGKKQKTFNQIELETASPYAAEDADITLQLHQTLLPKLQA 528

Query: 174 LG-RSDLATS-CCNFLMDRAELDLLG 197
                 +        +   A+++  G
Sbjct: 529 EPTLYKVFEEIEMPLMPVLAKMERNG 554


>gi|50121299|ref|YP_050466.1| ribonuclease D [Pectobacterium atrosepticum SCRI1043]
 gi|49611825|emb|CAG75274.1| ribonuclease D [Pectobacterium atrosepticum SCRI1043]
          Length = 374

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/194 (24%), Positives = 85/194 (43%), Gaps = 6/194 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C+ AR    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITSDIGLQQVCSQARRFPQVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLT- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L DE+  K  H G  D+ V   TFG    P   T+I +         +G
Sbjct: 60  -ITDWAPFQALLRDEEVTKFLHAGSEDLEVFLNTFGTLPTPFIDTQILAAFLGKPL-SYG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + + +G+++ K++  +DW A  LS++Q  YAA+DV +L  + +Q     +  G  +
Sbjct: 118 FAALVADYMGVSLDKSESRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVADTETAGWMN 177

Query: 179 LATSCCNFLMDRAE 192
            A   C  L  R +
Sbjct: 178 AALDECLLLCQRKQ 191


>gi|227111497|ref|ZP_03825153.1| ribonuclease D [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 374

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/194 (24%), Positives = 82/194 (42%), Gaps = 6/194 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   C  AR    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITSDIGLQQVCTQARRFPQVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLT- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L DE+  K  H G  D+ V    FG    P   T+I +         +G
Sbjct: 60  -ITDWAPFQALLRDEQVTKFLHAGSEDLEVFLNAFGTLPVPFIDTQILAAFLGKPL-SYG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + + +G+ + K++  +DW A  LS++Q  YAA+DV +L  + +Q     +  G  +
Sbjct: 118 FAALVADYMGVTLDKSESRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVADTEAAGWMN 177

Query: 179 LATSCCNFLMDRAE 192
            A   C  L  R +
Sbjct: 178 AALDECLLLCQRKQ 191


>gi|332141837|ref|YP_004427575.1| ribonuclease D [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551859|gb|AEA98577.1| ribonuclease D [Alteromonas macleodii str. 'Deep ecotype']
          Length = 385

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 50/180 (27%), Positives = 79/180 (43%), Gaps = 5/180 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA+  +A+A+DTE +        L ++QL  G   V I  +A    N    V +L + + 
Sbjct: 18  AAQRQEAVALDTEFVRTKTLTPHLGLIQLYDGHQLVLIDPLA--IDNMQPFVALLENTEV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+      F     PVF T+IA  +        G    ++ L  I++ K +
Sbjct: 76  VKVLHSCSEDLEAFLTAFDTVPTPVFDTQIAGSILDMGP-SLGYAKLVELLCEISLDKGE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL--MDRAEL 193
             +DW A  L + QL YAA+DV++L     Q    +Q LG+          L    RA++
Sbjct: 135 SRTDWLARPLREAQLSYAANDVLYLLPCYQQLASNVQALGKVHWIYEEVALLVEKKRAQM 194


>gi|260580546|ref|ZP_05848374.1| ribonuclease D [Haemophilus influenzae RdAW]
 gi|260092888|gb|EEW76823.1| ribonuclease D [Haemophilus influenzae RdAW]
          Length = 399

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 74/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 45  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGEHVSLIDPLA--ITDFSPFVALLANPKV 102

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R         GL    ++ L + I K  
Sbjct: 103 LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLG-LGTSAGLAKLAQQYLNVEIDKGA 161

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 162 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 213


>gi|16272339|ref|NP_438552.1| ribonuclease D [Haemophilus influenzae Rd KW20]
 gi|1173094|sp|P44442|RND_HAEIN RecName: Full=Ribonuclease D; Short=RNase D
 gi|1573361|gb|AAC22048.1| ribonuclease D (rnd) [Haemophilus influenzae Rd KW20]
          Length = 399

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 74/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 45  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGEHVSLIDPLA--ITDFSPFVALLANPKV 102

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R         GL    ++ L + I K  
Sbjct: 103 LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLG-LGTSAGLAKLAQQYLNVEIDKGA 161

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 162 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 213


>gi|145638698|ref|ZP_01794307.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittII]
 gi|145272293|gb|EDK12201.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittII]
 gi|309750190|gb|ADO80174.1| Ribonuclease D [Haemophilus influenzae R2866]
          Length = 380

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    + +L + K 
Sbjct: 26  LAQQQSAVALDTEFMRVSTYFPKLGLIQLYDGEHVSLIDPLA--ITDFSPFIALLANPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V    F    RP+  T+I +R         GL    ++ L + I K  
Sbjct: 84  LKVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLG-LGTSAGLAKLAQQYLNVEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LS+ QLQYAA DV +L  L     ++L +          C  +
Sbjct: 143 TRTNWIKRPLSNIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 194


>gi|325859715|ref|ZP_08172845.1| DNA-directed DNA polymerase [Prevotella denticola CRIS 18C-A]
 gi|325482641|gb|EGC85644.1| DNA-directed DNA polymerase [Prevotella denticola CRIS 18C-A]
          Length = 920

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 37/189 (19%), Positives = 71/189 (37%), Gaps = 11/189 (5%)

Query: 20  VDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA----PNLVGMLVDEKR 75
            + +++DTET      R  L  +  S  +     + + A ++ A         +  ++K 
Sbjct: 347 KEFVSIDTETTSTDAIRAELVGLSFSVEENKAFYVPLPANREEALKYIRIFKPLYENDKI 406

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--YTNQHGLKDNLKELLGINISK 133
            KI    ++D  VL          +F T IA  L +   + N   + + L     I+I +
Sbjct: 407 LKIGQNIKYDYKVLNNYGVTLQGEMFDTMIAHYLIQPELHHNMDYMAETLLGYRTIHIEE 466

Query: 134 AQQSSDWSADDLSD----EQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA-TSCCNFLM 188
                     ++ D    +  +YAA D      L+     +L+ LG  +L        + 
Sbjct: 467 LIGPKGKKQKNMRDLSPTDICEYAAEDADITLRLKHLLEPRLKELGLEELFWNIEMPLVR 526

Query: 189 DRAELDLLG 197
             A+++L G
Sbjct: 527 VLADMELNG 535


>gi|293395838|ref|ZP_06640120.1| ribonuclease D [Serratia odorifera DSM 4582]
 gi|291421775|gb|EFE95022.1| ribonuclease D [Serratia odorifera DSM 4582]
          Length = 373

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 80/192 (41%), Gaps = 6/192 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               +   D  +   C  AR    IA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYTLITTDAGLQQVCEQARKHAQIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPI 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
            Q      V +L D    K  H G  D+ V    F     P+  T+I +          G
Sbjct: 61  KQ--WQPFVDLLADSAVVKFLHAGSEDLEVFLNAFNTLPTPLVDTQILAAF-TGKPLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + + + + + K++  +DW A  L++ Q  YAA+DV +L  +  Q  ++ ++ G + 
Sbjct: 118 FATLVAQYMQVELDKSESRTDWLARPLTERQCVYAAADVFYLLPMARQLVQETEQAGWTA 177

Query: 179 LATSCCNFLMDR 190
            A+S C  L  R
Sbjct: 178 AASSECLLLCQR 189


>gi|148978262|ref|ZP_01814780.1| ribonuclease D [Vibrionales bacterium SWAT-3]
 gi|145962563|gb|EDK27840.1| ribonuclease D [Vibrionales bacterium SWAT-3]
          Length = 372

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 53/208 (25%), Positives = 87/208 (41%), Gaps = 15/208 (7%)

Query: 2   TTIRVHE--GDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++     D+   C  AR  D + +DTE +       +L ++QL  G+    I  IA 
Sbjct: 1   MDYQIITQLKDLERVCQQAREADVVMLDTEFVRTRTYYPQLGLIQLFDGETLSLIDPIAL 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                   VG+L D    K+ H    D+ V    F     P+  T+I +          G
Sbjct: 61  --DEMTPFVGLLKDASVLKVLHACGEDLEVFQNAFDCTPTPMVDTQIMAAFLGHGL-STG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E +G+++ K++  +DW A  LS +QL YAA+DV +L  +  +  EK+   G  +
Sbjct: 118 FAALVSEFVGVDLDKSESRTDWLARPLSQKQLDYAAADVHYLMPMYNKLLEKVMEAGWWE 177

Query: 179 LATSCCNFLMDR---------AELDLLG 197
            A    +  + R         A LD+ G
Sbjct: 178 AAQQESDLQVARRIRKVNPDTAYLDIKG 205


>gi|90416003|ref|ZP_01223936.1| ribonuclease D [marine gamma proteobacterium HTCC2207]
 gi|90332377|gb|EAS47574.1| ribonuclease D [marine gamma proteobacterium HTCC2207]
          Length = 374

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 51/189 (26%), Positives = 81/189 (42%), Gaps = 9/189 (4%)

Query: 1   MTTIRVHEGDIPAECA-----ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIR 55
           MTTI  H  D   + A      +    +A+DTE +       +L ++QLS G+    I  
Sbjct: 1   MTTIN-HWIDNSQQLAELCEQLQDATELAIDTEFMRSDTFFAKLALIQLSDGEQCWLIDT 59

Query: 56  IAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN 115
            A  Q     L  +L   +   +FH    D+ VL     VR + +F +++A+ +      
Sbjct: 60  PAIEQ--LQPLTALLNGPQLTLVFHSCGEDLEVLDQVLSVRPKKLFDSQVAAGIVNIGY- 116

Query: 116 QHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
             G    ++ +L I + K    SDW A  LSD Q +YAA DV++L  +     E L++  
Sbjct: 117 SMGYARLVENMLQIELGKEDTRSDWLARPLSDRQKRYAADDVLYLFRIYKLLLELLEQQQ 176

Query: 176 RSDLATSCC 184
           R        
Sbjct: 177 RQSWFAEEM 185


>gi|78224579|ref|YP_386326.1| 3'-5' exonuclease [Geobacter metallireducens GS-15]
 gi|78195834|gb|ABB33601.1| 3'-5' exonuclease [Geobacter metallireducens GS-15]
          Length = 382

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/176 (26%), Positives = 73/176 (41%), Gaps = 5/176 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A D E   +   ++++C++Q     G   I+   A    AP L  +  +    
Sbjct: 24  LSREPYVACDLEADSMHHYQEKVCLIQF-TVPGLAAIVDPLAVADLAP-LAPVFANPSIR 81

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH   +DI  L   FG+ V  +F T IA +         GL   L++  G+ + K  Q
Sbjct: 82  KVFHGADYDIRSLHRDFGIEVNNLFDTMIACQFLGEREF--GLAAVLRKRFGVELDKQYQ 139

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-MDRA 191
            +DWS   L+   ++YAA D   L  L  +   +L+  GR       C  L   R 
Sbjct: 140 RADWSRRPLTAGMIEYAAKDTTLLIELCGRLEAELREKGRIGWVEEECALLARVRV 195


>gi|192361069|ref|YP_001982899.1| ribonuclease D [Cellvibrio japonicus Ueda107]
 gi|190687234|gb|ACE84912.1| ribonuclease D [Cellvibrio japonicus Ueda107]
          Length = 378

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 51/170 (30%), Positives = 75/170 (44%), Gaps = 3/170 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIAVDTE +          ++Q+  G G   I  +A    +   L  +L+D K  K
Sbjct: 24  RQQGAIAVDTEFMRTDTFYPIAGLLQIGDGKGCYLIDPLA--IADWQPLRELLLDGKVIK 81

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           + H    D+ V      +   P+F T+I +          G  + +K LLGI I K +  
Sbjct: 82  VLHSCSEDLEVFQRWLDLVPSPLFDTQIGAAFANLGFG-LGYANLVKTLLGIEIPKDETR 140

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           SDW    LS  QL+YAA DV H+  +  +  + L+   R +   S C  L
Sbjct: 141 SDWLQRPLSQSQLKYAALDVAHMLVVYGKLLQILKTSQRLEWVKSDCADL 190


>gi|163748902|ref|ZP_02156154.1| DNA polymerase I [Shewanella benthica KT99]
 gi|161331676|gb|EDQ02481.1| DNA polymerase I [Shewanella benthica KT99]
          Length = 917

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 75/215 (34%), Gaps = 20/215 (9%)

Query: 2   TTIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
           TTI  HE  +          D IA+DTET  L     +L  +  +   G    + +    
Sbjct: 319 TTIYTHEE-LDLWIDKLTNADLIAIDTETTSLNYMEAKLVGISFAIEAGKAAYLPLGHDY 377

Query: 61  KNAP----------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLT 110
            +AP           L  +L + + +K+    ++DI++            F T + S + 
Sbjct: 378 LDAPKQLDQAEALAKLKPLLENPELKKVGQNLKYDISIFANVGIKLQGIAFDTMLESYVF 437

Query: 111 RTYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALR 164
            +   +H + D   + LG      ++ +      L+  Q+       YAA D      L 
Sbjct: 438 NSVATKHNMDDLALKYLGHKNISFEEIAGKGVKQLTFNQIDLEIAAPYAAEDADITLRLH 497

Query: 165 LQFTEKLQRLGRSDLA--TSCCNFLMDRAELDLLG 197
                +L++  +            +   ++++  G
Sbjct: 498 QHLWPRLEKEPQLAAVFTDIELPLIQILSDIERGG 532


>gi|28199772|ref|NP_780086.1| ribonuclease D [Xylella fastidiosa Temecula1]
 gi|182682522|ref|YP_001830682.1| ribonuclease D [Xylella fastidiosa M23]
 gi|28057893|gb|AAO29735.1| ribonuclease D [Xylella fastidiosa Temecula1]
 gi|182632632|gb|ACB93408.1| ribonuclease D [Xylella fastidiosa M23]
          Length = 362

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 83/189 (43%), Gaps = 4/189 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R    I +DTE +        L +VQ++ GD  + +  +  G  +A  L   L      K
Sbjct: 17  RKPTRIGMDTEFIREGTFWPELALVQIAIGDEILLVDPLVPGMTDALGLW--LAAPNVIK 74

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           I H    D+    Y  GV  RP+F T+I + LT         K  + ++  + + K +  
Sbjct: 75  IMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGMGYQK-LVAKVTNVELGKGETR 133

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL-DLL 196
           SDW    L+  QL YAA+DV +L AL    TE+L  + RS      C  L D  E  +  
Sbjct: 134 SDWMHRPLTPAQLDYAANDVRYLFALHDTLTERLAEMSRSAWLEEDCTRLTDNIEQNENE 193

Query: 197 GWENVDIFS 205
            W ++ I S
Sbjct: 194 RWPHLAIRS 202


>gi|145299067|ref|YP_001141908.1| ribonuclease D [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851839|gb|ABO90160.1| ribonuclease D [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 379

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 77/193 (39%), Gaps = 6/193 (3%)

Query: 2   TTIRVH--EGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              ++   + ++    A+     +A+DTE +       +L + Q+  G+    +      
Sbjct: 10  MHYQLITQQAELEQYLASLADVPLAIDTEFVRTRTYYPQLGLFQIYDGEHLALLDP---L 66

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             +   L   L    +  I H    D+ ++ +  G     +  T++A+          G 
Sbjct: 67  TLDLAPLWQRLGRAGQIAILHASGEDLELIQHEAGHLPNQMHDTQLATAFLGYGV-SVGF 125

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
               KE LG+++ K Q  +DW A  L++ QL+YAA+DV++L  L  +   KL   G+   
Sbjct: 126 GALAKEFLGVDLVKDQARTDWLARPLTERQLEYAAADVLYLMPLYEKVMAKLHESGKFAW 185

Query: 180 ATSCCNFLMDRAE 192
               C     R  
Sbjct: 186 FEQECQNHSARKT 198


>gi|15837353|ref|NP_298041.1| ribonuclease D [Xylella fastidiosa 9a5c]
 gi|9105641|gb|AAF83561.1|AE003916_15 ribonuclease D [Xylella fastidiosa 9a5c]
          Length = 362

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 56/191 (29%), Positives = 82/191 (42%), Gaps = 6/191 (3%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R    I +DTE +        L +VQ++  D  + +  +  G  +A  L   L      K
Sbjct: 17  RKPTRIGMDTEFIRERTFWPELALVQIAIEDEILLVDPLVPGMTDALGLW--LAAPNVIK 74

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           I H    D+    Y  GV  RP+F T+I + LT         K  +  +  + + K +  
Sbjct: 75  IMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGMGYQK-LVATVTNVALEKGETR 133

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL-DLL 196
           SDW    L+  QL YAA+DV +L AL    TE+L  + RS      C  L D  E  +  
Sbjct: 134 SDWMHRPLTPAQLDYAANDVRYLFALHDTLTERLAEMSRSAWLEEDCTRLTDNIEQNENE 193

Query: 197 GWENVDIFSHS 207
            W ++ I  HS
Sbjct: 194 RWPHLAI--HS 202


>gi|260910758|ref|ZP_05917412.1| DNA-directed DNA polymerase I [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635119|gb|EEX53155.1| DNA-directed DNA polymerase I [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 927

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 58/194 (29%), Gaps = 13/194 (6%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----LVGMLV 71
                D I++DTET        +L  +  +  +     + +      A N       +  
Sbjct: 350 LLSTADVISLDTETTSTNAIEAQLVGLSFAIEEKKAYYVPVPEQADEAQNIVNRFKAIYE 409

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTY-TNQHGLKDNLKELLGIN 130
           + K  K+    ++D+ VL         P+F T +A  L +    +       +       
Sbjct: 410 NPKTLKVGQNIKYDLEVLRNYGIALQGPLFDTMVAHYLLQPELRHNMDFMAEVYLNYETV 469

Query: 131 I------SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-C 183
                   K +   +      S+    YA  D      L+     KL   G   L     
Sbjct: 470 HIDALIGPKGKAQKNMRELAPSEVY-NYACEDADITLQLKNVLQPKLVEAGVERLFNEVE 528

Query: 184 CNFLMDRAELDLLG 197
              +   AE++  G
Sbjct: 529 MPLIPVLAEMECNG 542


>gi|86131451|ref|ZP_01050049.1| DNA-directed DNA polymerase [Dokdonia donghaensis MED134]
 gi|85817896|gb|EAQ39064.1| DNA-directed DNA polymerase [Dokdonia donghaensis MED134]
          Length = 949

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 65/199 (32%), Gaps = 12/199 (6%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----NLVGMLV 71
                 ++  DTET GL P    L  V  S   G    I     +  A      L     
Sbjct: 372 NLLKQTSVCFDTETTGLDPLVAELVGVAFSWEAGKGYYIPFPESKDEAQALIEELRPFFE 431

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
               EKI    ++DI VL          +F T +A  L       +         +    
Sbjct: 432 HTGIEKIGQNLKYDIKVLAKYDVKVKGKLFDTMLAHYLINPDMRHNMDVLAETYLNYTPV 491

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++     D   D+Q +YA  D      L+  F ++L   G   L      
Sbjct: 492 SITELIGKKGKNQKSMRDVPLDQQTEYAVEDADITLQLKQHFEKELDEAGTRKLFNDIEI 551

Query: 185 NFLMDRAELDLLGWENVDI 203
             L   A +++ G  N+D+
Sbjct: 552 PLLRVLAAMEVEGI-NLDV 569


>gi|145252306|ref|XP_001397666.1| exosome complex exonuclease Rrp6 [Aspergillus niger CBS 513.88]
 gi|134083214|emb|CAK42852.1| unnamed protein product [Aspergillus niger]
          Length = 782

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 59/162 (36%), Gaps = 2/162 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +   +  + ++Q+S  D    +  +   ++    L  +  D    
Sbjct: 244 LKAAKEIAIDLEHHDVHSYQGLVSLMQISTRDKDWVVDTLKPWREELQVLNEVFTDPNIL 303

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ V  +F T  A+           LK  L++ +     K  Q
Sbjct: 304 KVLHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRS--LKFLLQKFVNFEADKRYQ 361

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
            +DW    + +    YA SD  +L  +      +L      D
Sbjct: 362 MADWRIRPIPEGMFDYARSDTHYLLHIYDHIRNELVENSLPD 403


>gi|167628093|ref|YP_001678593.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25017]
 gi|167598094|gb|ABZ88092.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 366

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 69/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQ++  +    I        +   L  +  D   +
Sbjct: 16  LKSTSQIAVDTEFYWMRTYYPELCLVQIATENEIFLID--TLEDLDFSKLKDIFEDTNIQ 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+       +Q  LK  LK++L I + K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFDCEVNNIFDTQLAASFLG-TQSQISLKALLKDILDIEMEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    LS +Q  YA  DV HL  ++     KL +           
Sbjct: 133 FSDWRKRPLSQKQFDYALKDVKHLIEIKYHLESKLNQTDYKQYFYEEL 180


>gi|326795603|ref|YP_004313423.1| ribonuclease D [Marinomonas mediterranea MMB-1]
 gi|326546367|gb|ADZ91587.1| ribonuclease D [Marinomonas mediterranea MMB-1]
          Length = 383

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 47/168 (27%), Positives = 72/168 (42%), Gaps = 3/168 (1%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFH 80
           + IAVDTE L          ++Q+S G+  V I            L  ++V+    K+FH
Sbjct: 30  NVIAVDTEFLRRTTYYPITGLIQISEGEKAVLIDPQT--ITEWAPLKDLMVNLDVMKVFH 87

Query: 81  YGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDW 140
               D+ V     GV   P + T+I                 ++  L I ++K +  SDW
Sbjct: 88  ACSEDLDVFDRLLGVLPTPFYDTQIGEAYANGQW-SVSYVKLIQAYLSIEVAKDETRSDW 146

Query: 141 SADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           +   L++ Q +YAA DVV+L  +  Q  E LQ+    D A   C+ L 
Sbjct: 147 TVRPLTEAQKRYAALDVVYLAKVYPQQIEMLQKKNMLDWALEDCDTLK 194


>gi|241668633|ref|ZP_04756211.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254877166|ref|ZP_05249876.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254843187|gb|EET21601.1| ribonuclease D [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 364

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 69/168 (41%), Gaps = 3/168 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVDTE   +      LC+VQ++  +    I        +   L  +  D   +
Sbjct: 16  LKSTSQIAVDTEFYWMRTYYPELCLVQIATENEIFLID--TLEDLDFSKLKDIFEDTNIQ 73

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KI H    DI ++   F   V  +F T++A+       +Q  LK  LK++L I + K  Q
Sbjct: 74  KIIHSATNDIPIIKRFFDCEVNNIFDTQLAASFLG-TQSQISLKALLKDILDIEMEKESQ 132

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCC 184
            SDW    LS +Q  YA  DV HL  ++     KL +           
Sbjct: 133 FSDWRKRPLSQKQFDYALKDVEHLIEIKYHLESKLNQTDYKQYFYEEL 180


>gi|261855126|ref|YP_003262409.1| ribonuclease D [Halothiobacillus neapolitanus c2]
 gi|261835595|gb|ACX95362.1| ribonuclease D [Halothiobacillus neapolitanus c2]
          Length = 374

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 68/163 (41%), Gaps = 4/163 (2%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRF 84
           +DTE +       +LC+VQ++  D    I  +A        L   L       +FH    
Sbjct: 37  IDTEFMRESTYFPQLCLVQIATPDAIWLIDPLAVP---LAPLWHELNRTSSPLVFHAAEQ 93

Query: 85  DIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADD 144
           D+ +++   G   + +  ++IA+        Q G  + +  LL + + K+Q  ++W+   
Sbjct: 94  DLELIYLDSGALPQTLRDSQIAAAFLGLGE-QIGYANLVNRLLHVELDKSQSRTNWAQRP 152

Query: 145 LSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           L+ EQ  YAA DV  L ++     E+L    R       C  L
Sbjct: 153 LTAEQQHYAADDVRFLRSMYPLLREQLATKNRLAWFDEECAAL 195


>gi|15602571|ref|NP_245643.1| ribonuclease D [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720994|gb|AAK02790.1| Rnd [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 383

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 80/187 (42%), Gaps = 6/187 (3%)

Query: 4   IRVHEGDIP-AEC--AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQ 60
            +V   D+  AE   +A+    IA+DTE + +     +L ++QL  G+    I       
Sbjct: 14  FQVITSDLALAEICYSAQQKAVIALDTEFVRIKTLYPQLGLIQLYDGERVSLIDPTT--I 71

Query: 61  KNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLK 120
           ++    + +L +    K+ H    D+ V  ++F     P+  T+I +          GL 
Sbjct: 72  QDFSPFIALLANTAVLKVLHACSEDLEVFQHSFNQLPTPMLDTQIMANFLGFPN-STGLA 130

Query: 121 DNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
             ++    + I K    +DW A  LSD QL YAA+DV +L  L  +  E L +    + A
Sbjct: 131 TLVQHYFQLEIDKGASRTDWLARPLSDNQLIYAAADVWYLLPLYQRMQEALAQTRWQEAA 190

Query: 181 TSCCNFL 187
              C  L
Sbjct: 191 QQDCEAL 197


>gi|319775680|ref|YP_004138168.1| ribonuclease D [Haemophilus influenzae F3047]
 gi|317450271|emb|CBY86487.1| ribonuclease D [Haemophilus influenzae F3047]
          Length = 380

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/172 (27%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 26  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFVALLSNPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V    F    RP+  T+I +R     T   GL    ++ L I I K  
Sbjct: 84  LKVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGT-SAGLAKLAQQYLNIEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 194


>gi|326793522|ref|YP_004311342.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
 gi|326544286|gb|ADZ89506.1| DNA polymerase I [Marinomonas mediterranea MMB-1]
          Length = 919

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 71/199 (35%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
               + +A DTET  L   +  L  V ++   G    I +A   ++AP           L
Sbjct: 338 LNQAELVAFDTETTSLNYMQAELVGVSVAIEAGKAAYIPVAHDYEDAPEQLDRDWVLEQL 397

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L DE + K+  + ++D  VL           F T + S +  +   +H +     + 
Sbjct: 398 KPWLEDEGKAKVGQHLKYDANVLNNYDITLRGIKFDTMLESYVFNSTGTRHDMDSLSSKF 457

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRL-GRSDL 179
           LG +  K +  +   A   +  Q+       YAA D      L      KL++      +
Sbjct: 458 LGHSTVKFEDIAGKGAKQKTFNQIDLEQAAFYAAEDADITLRLHQAILPKLEKTPELVSV 517

Query: 180 ATS-CCNFLMDRAELDLLG 197
            +      +   A+++  G
Sbjct: 518 FSDIELPLVPVLAKMEQTG 536


>gi|121705450|ref|XP_001270988.1| exosome complex exonuclease Rrp6, putative [Aspergillus clavatus
           NRRL 1]
 gi|119399134|gb|EAW09562.1| exosome complex exonuclease Rrp6, putative [Aspergillus clavatus
           NRRL 1]
          Length = 778

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 57/158 (36%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +      + ++Q+S  D    +  +   +++   L  +  D    
Sbjct: 246 LKSAKEIAIDLEHHDMHSYHGLVSLMQISTRDKDWVVDTLKPWREDLQILNDVFADPAIL 305

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ V  +F T  A+           LK  L++ +     K  Q
Sbjct: 306 KVLHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRS--LKFLLQKFVNFEADKRYQ 363

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            +DW    L      YA SD  +L  +      +L   
Sbjct: 364 MADWRIRPLPSGMFDYARSDTHYLLYIYDHLRNELLEN 401


>gi|261821503|ref|YP_003259609.1| ribonuclease D [Pectobacterium wasabiae WPP163]
 gi|261605516|gb|ACX88002.1| ribonuclease D [Pectobacterium wasabiae WPP163]
          Length = 374

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 48/194 (24%), Positives = 84/194 (43%), Gaps = 6/194 (3%)

Query: 2   TTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              ++   D  +   CA A+    +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYQLITSDIGLQQICAQAQRFPQVALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLT- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L DE+  K  H G  D+ V   TFG    P   T+I +         +G
Sbjct: 60  -ITDWAPFQALLRDEQVTKFLHAGSEDLEVFLNTFGTLPTPFIDTQILAAFLGKPL-SYG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + + +G+ + K++  +DW A  LS++Q  YAA+DV +L  + +Q     +  G  +
Sbjct: 118 FAALVADYMGVTLDKSESRTDWLARPLSEKQCDYAAADVFYLLPMAIQLVTDTEAAGWMN 177

Query: 179 LATSCCNFLMDRAE 192
            A   C  L  R +
Sbjct: 178 AALDECLLLCQRKQ 191


>gi|260582345|ref|ZP_05850138.1| ribonuclease D [Haemophilus influenzae NT127]
 gi|260094713|gb|EEW78608.1| ribonuclease D [Haemophilus influenzae NT127]
          Length = 380

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 74/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G     I  +A    +    V +L + K 
Sbjct: 26  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGKHVSLIDPLA--ITDFSPFVALLANPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R     T   GL    ++ L I I K  
Sbjct: 84  LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGT-SAGLAKLAQQYLNIEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 194


>gi|254456142|ref|ZP_05069571.1| DNA polymerase I [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083144|gb|EDZ60570.1| DNA polymerase I [Candidatus Pelagibacter sp. HTCC7211]
          Length = 924

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 79/217 (36%), Gaps = 18/217 (8%)

Query: 2   TTIRVHEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA--- 58
           T I+  +  I     A     +AVDTET  L P +  L  + LS   G    I I     
Sbjct: 328 TDIKQIDEWIKE---AEETGELAVDTETNSLDPHQADLVGISLSSKVGKACYIPIGHKSS 384

Query: 59  ----GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
                      L  +L D   +KI    +FD  VLF   G+ +  +  T + S +     
Sbjct: 385 KCINKNDVIKKLKPLLEDPSVKKIGQNIKFDFIVLFK-QGIEMTSMEDTMLMSYVLDAGK 443

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLS------DEQLQYAASDVVHLHALRLQFT 168
           N+H +    +  LG      ++       +++      +    YAA D      L  +F+
Sbjct: 444 NRHNMDTLSEIHLGHKTISFKEIVGTGKKEINFSDVEIERAKDYAAEDADITFRLYKKFS 503

Query: 169 EKLQRLGRSDLATS-CCNFLMDRAELDLLGWENVDIF 204
           + L+     ++        +   A +++ G E  + F
Sbjct: 504 KNLKLEKMINIYEIFEKPLIKILAFMEMEGVEVDNKF 540


>gi|285018846|ref|YP_003376557.1| ribonuclease d protein [Xanthomonas albilineans GPE PC73]
 gi|283474064|emb|CBA16565.1| probable ribonuclease d protein [Xanthomonas albilineans]
          Length = 361

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 53/177 (29%), Positives = 77/177 (43%), Gaps = 4/177 (2%)

Query: 7   HEGDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           H  ++    A R    I +DTE +       +L +VQ++  +  + I  +  G   A  L
Sbjct: 7   HPNELAERLAQRPA-RIGLDTEFVRERTYWPQLALVQMAVAEEILLIDPLIPGMPQA--L 63

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L D    KI H    D+       G   RP+F T+IA+ L          K  + ++
Sbjct: 64  APWLSDPGILKIMHSASEDLVTFKCACGTLPRPLFDTQIAAGLAGIGAGMGYQK-LVLDI 122

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            GI+++K +  SDW    LS  QL+YAA DV HL AL      +LQ L RS      
Sbjct: 123 TGIHLTKGETRSDWLRRPLSPAQLEYAADDVRHLFALHDTLHARLQALDRSTWLQED 179


>gi|262273193|ref|ZP_06051009.1| DNA polymerase I [Grimontia hollisae CIP 101886]
 gi|262222771|gb|EEY74080.1| DNA polymerase I [Grimontia hollisae CIP 101886]
          Length = 931

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 63/199 (31%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
            +  D +A DTET  L      L  +  +  +G    + +A    +AP           +
Sbjct: 348 LKNADVVAFDTETDSLDYMEANLVGISFAVAEGEAAYLPLAHDYLDAPKQLDRDWVLAEM 407

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
              L D    K+    ++D +VL           + T + S +  +   +H +       
Sbjct: 408 KLWLEDAGALKVGQNLKYDASVLARYDIAMRGIAYDTMLESYVFNSVAGKHDMDSLALRY 467

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSD-L 179
           L       ++ +      L+  Q++      YAA D      L      +L    +   +
Sbjct: 468 LQHQCISFEEIAGKGKKQLTFNQIELDQAAPYAAEDADVTLRLHNALMAQLNNDEKLKVI 527

Query: 180 ATS-CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 528 FEQYEMPLVPVLSRMERHG 546


>gi|254361720|ref|ZP_04977856.1| ribonuclease D [Mannheimia haemolytica PHL213]
 gi|261492043|ref|ZP_05988618.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495020|ref|ZP_05991488.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153093246|gb|EDN74252.1| ribonuclease D [Mannheimia haemolytica PHL213]
 gi|261309336|gb|EEY10571.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261312326|gb|EEY13454.1| ribonuclease D [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 372

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 71/176 (40%), Gaps = 3/176 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR    +A+DTE +        L ++QL  G     I        +    V +L D+   
Sbjct: 23  ARKTKVVALDTEFIRTRTYYPILGLIQLFDGQQVSLIDPNT--ISDFSPFVSLLADKNII 80

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  Y F     P+  T++ +          G    +   L I + K   
Sbjct: 81  KVLHACSEDLEVFEYQFKQLPEPMLDTQVMAAFAGIGI-SMGFAKLVSHYLNIELDKGAS 139

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAE 192
            +DW A  LS EQLQYAA+DV +L  +  +  + L +          C  L+ +A+
Sbjct: 140 RTDWLARPLSAEQLQYAAADVWYLLPVYEKLAQALTKSTWQSAVAEECVALLKKAK 195


>gi|159127645|gb|EDP52760.1| exosome complex exonuclease Rrp6, putative [Aspergillus fumigatus
           A1163]
          Length = 764

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 55/158 (34%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +      + ++Q+S  D    +  +   ++    L  +  D    
Sbjct: 241 LKSAKEIAIDLEHHDVHSYHGLVSLMQISTRDKDWVVDTLKPWREELQILNEVFADPGIL 300

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ V  +F T  A+           LK  L + +     K  Q
Sbjct: 301 KVLHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRS--LKFLLHKFVNFEADKRYQ 358

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            +DW    L      YA SD  +L  +      +L   
Sbjct: 359 MADWRIRPLPSGMFDYARSDTHYLLYIYDHLRNELLEN 396


>gi|70999828|ref|XP_754631.1| exosome complex exonuclease Rrp6 [Aspergillus fumigatus Af293]
 gi|66852268|gb|EAL92593.1| exosome complex exonuclease Rrp6, putative [Aspergillus fumigatus
           Af293]
          Length = 764

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 55/158 (34%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +      + ++Q+S  D    +  +   ++    L  +  D    
Sbjct: 241 LKSAKEIAIDLEHHDVHSYHGLVSLMQISTRDKDWVVDTLKPWREELQILNEVFADPGIL 300

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ V  +F T  A+           LK  L + +     K  Q
Sbjct: 301 KVLHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRS--LKFLLHKFVNFEADKRYQ 358

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            +DW    L      YA SD  +L  +      +L   
Sbjct: 359 MADWRIRPLPSGMFDYARSDTHYLLYIYDHLRNELLEN 396


>gi|238921711|ref|YP_002935226.1| DNA polymerase I [Edwardsiella ictaluri 93-146]
 gi|238871280|gb|ACR70991.1| DNA polymerase I [Edwardsiella ictaluri 93-146]
          Length = 930

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 65/199 (32%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
            R   + A DTET  L      L  +  +   G    I +A    +AP+          L
Sbjct: 347 LRQAGSFAFDTETDSLDVLSANLVGISCADKPGQACYIPLAHDYLDAPHQLDRQYVLARL 406

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L DE   KI    ++DI V+           F T + S +  +   +H +       
Sbjct: 407 QPLLEDEGIAKIGQNLKYDIGVMARYGITLRGVAFDTMLESYVLNSVAGRHDMDSLSARH 466

Query: 127 LGINISKAQQSSDWSADDLSDEQL------QYAASDVVHLHALRLQFTEKLQ-RLGRSDL 179
           L       ++ +      L+  Q+      +YAA D      L       L+   G S +
Sbjct: 467 LDHKTITFEEIAGKGKGQLTFNQIPLEQASEYAAEDADVTLQLHQHLWPMLEGESGPSHI 526

Query: 180 ATS-CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 527 FRDIDMPLVPVLSRMERTG 545


>gi|227355430|ref|ZP_03839826.1| ribonuclease D [Proteus mirabilis ATCC 29906]
 gi|227164417|gb|EEI49301.1| ribonuclease D [Proteus mirabilis ATCC 29906]
          Length = 399

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/175 (24%), Positives = 74/175 (42%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA  V  IA+DTE + +      L ++Q+  G     I  +          V +L +   
Sbjct: 45  AASEVSQIALDTEFVRIRTYYPHLGLIQMYDGKQISLIDPLT--ITEWTPFVELLTNPAV 102

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V  + FG    P+  T++ +          G    +++   I + K++
Sbjct: 103 LKYLHAGSEDLEVFSHQFGCVPTPMIDTQVVAAFLGYPI-SCGFATLVEKYEHIALDKSE 161

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L+++Q QYA+ DV +L  L  +   + Q  G  D     C  + +R
Sbjct: 162 SRTDWLARPLTEKQCQYASGDVFYLLPLAKKLIAQAQEAGYMDAIVDECEMIAER 216


>gi|255934162|ref|XP_002558362.1| Pc12g15620 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582981|emb|CAP81189.1| Pc12g15620 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 756

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 59/156 (37%), Gaps = 2/156 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +      + ++Q+S  D    +  +   +++   L  +  D K  
Sbjct: 238 LKQAKEIAIDLEHHDVHSYHGLVSLMQISTRDKDWVVDTLQPWREDLQMLNEVFADPKIL 297

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ V  +F T  A+           LK  L + +     K  Q
Sbjct: 298 KVLHGSTMDIIWLQRDLGLYVVGMFDTFHAASALGFPKRS--LKFLLSKFVNFEADKRYQ 355

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQ 172
           ++DW A  L      YA SD  +L  +  +    L 
Sbjct: 356 TADWRARPLPPAMFDYARSDTHYLLYIYDRLRNDLI 391


>gi|305665261|ref|YP_003861548.1| DNA polymerase I [Maribacter sp. HTCC2170]
 gi|88710015|gb|EAR02247.1| DNA polymerase I [Maribacter sp. HTCC2170]
          Length = 944

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/200 (20%), Positives = 62/200 (31%), Gaps = 11/200 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----NLVGMLV 71
                +++  DTET GL P    L  +  S   G    I     +  A      L     
Sbjct: 366 NLMKQNSVCFDTETTGLNPLTAELVGIAFSWEAGKGFYIPFPEDKNQAQEIIETLRPFFE 425

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTN------QHGLKDNLKE 125
            E  EKI    ++DI VL           F + +A  L                 +    
Sbjct: 426 SEMIEKIGQNLKYDIKVLHKYNIQVKGKFFDSMLAHYLINPDMRHNMDVLSETYLNYTPV 485

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLAT-SCC 184
            +   I K  ++     D   ++Q +YA  D    + L   F  +L      +L      
Sbjct: 486 SITELIGKKGKNQLSMRDVPLEKQTEYAVEDADITYQLAQHFRPELAEASTEELFNTIEI 545

Query: 185 NFLMDRAELDLLGWENVDIF 204
             L   A+++L G      F
Sbjct: 546 PLLHVLADMELEGINLDKEF 565


>gi|145636341|ref|ZP_01792010.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittHH]
 gi|145270506|gb|EDK10440.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittHH]
          Length = 382

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/172 (26%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    + +L + K 
Sbjct: 26  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFIALLANPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V    F    RP+  T+I +R     T   GL    ++ L + I K  
Sbjct: 84  LKVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGT-SAGLAKLAQQYLNVEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 194


>gi|330831571|ref|YP_004394523.1| DNA polymerase I [Aeromonas veronii B565]
 gi|328806707|gb|AEB51906.1| DNA polymerase I [Aeromonas veronii B565]
          Length = 921

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 67/199 (33%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +     A DTET  L     R+  V  +   G    +        AP           L
Sbjct: 338 LKAAPLFAFDTETTSLDYMEARIVGVSFAVEAGKAAYVPFGHDYLGAPVQLSEAVVLGKL 397

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D    K+    ++D  VL           + T + S +  +  ++H +    K  
Sbjct: 398 KPLLEDPTCLKVGQNLKYDRNVLLNHDIDLQGIAYDTMLESYVLNSTASRHDMDSLAKRY 457

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRL-GRSDL 179
           LG+  +  +  +      L+  Q++      YAA D      L      +L+ + G + +
Sbjct: 458 LGVETTSFEDIAGKGVKQLTFNQIELEQAAPYAAEDADITLRLHQTLWGQLEAVPGLAKV 517

Query: 180 A-TSCCNFLMDRAELDLLG 197
                   L   A ++LLG
Sbjct: 518 FSEIELPLLPVLARMELLG 536


>gi|158291195|ref|XP_312669.4| AGAP002300-PA [Anopheles gambiae str. PEST]
 gi|157018260|gb|EAA07463.4| AGAP002300-PA [Anopheles gambiae str. PEST]
          Length = 969

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 67/159 (42%), Gaps = 3/159 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E       +   C++QLS       I+   A +     L  +  D K+ 
Sbjct: 284 LQAAKEIAIDLEHHSYRSYQGFTCLMQLSTRTKD-YIVDALALRDELHVLNEVFTDPKKL 342

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ +  +F T  A+R+ +    + GL+  LK    I+  KA Q
Sbjct: 343 KVLHGSVSDIEWLQRDLGLYLVNMFDTGEAARVLQFS--RIGLQFLLKHYCNIDTDKAFQ 400

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            +DW    + +  ++YA  D  +L  +  +   +L   G
Sbjct: 401 LADWRIRPIPENFIEYARKDTHYLLYIYDRMRNELLEKG 439


>gi|253688324|ref|YP_003017514.1| ribonuclease D [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754902|gb|ACT12978.1| ribonuclease D [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 374

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 80/198 (40%), Gaps = 14/198 (7%)

Query: 2   TTIRVHEGDIPAECAARYV-------DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDII 54
              ++    I +    + V         +A+DTE +       +L ++QL  G+    I 
Sbjct: 1   MNYQL----ITSNIGLQQVCAQARRFPQVALDTEFVRTRTYYPQLGLIQLYDGEQLSLID 56

Query: 55  RIAAGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYT 114
            +     +      +L DE+  K  H G  D+ V    FG    P   T+I +       
Sbjct: 57  PLT--ITDWAPFQALLRDEQVTKFLHAGSEDLEVFLNAFGTLPVPFIDTQILAAFLGKPL 114

Query: 115 NQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
             +G    + + +G+ + K++  +DW A  LS++Q  YAA+DV +L  +  Q     +  
Sbjct: 115 -SYGFAALVADYMGVTLDKSESRTDWLARPLSEKQCDYAAADVFYLLPMAAQLVADTEAA 173

Query: 175 GRSDLATSCCNFLMDRAE 192
           G  + A   C  L  R +
Sbjct: 174 GWMNAALDECLLLCQRKQ 191


>gi|84393455|ref|ZP_00992211.1| ribonuclease D [Vibrio splendidus 12B01]
 gi|84375883|gb|EAP92774.1| ribonuclease D [Vibrio splendidus 12B01]
          Length = 313

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/170 (27%), Positives = 76/170 (44%), Gaps = 3/170 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+    I  IA         VG+L D    
Sbjct: 44  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGETLSLIDPIAL--DEMTPFVGLLKDTSVL 101

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V    FG    P+  T+I +          G    + E +G+++ K++ 
Sbjct: 102 KVLHACGEDLEVFQNAFGCTPTPMVDTQIMAAFLGHGL-STGFAALVSEFVGVDLDKSES 160

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            +DW A  LS +QL YAA+DV +L  +  +  EK+   G  + A    + 
Sbjct: 161 RTDWLARPLSQKQLDYAAADVHYLMPMYNKLLEKVMEAGWWEAAQQESDL 210


>gi|218710187|ref|YP_002417808.1| Ribonuclease D [Vibrio splendidus LGP32]
 gi|218323206|emb|CAV19383.1| Ribonuclease D [Vibrio splendidus LGP32]
          Length = 397

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/170 (27%), Positives = 76/170 (44%), Gaps = 3/170 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           AR  D + +DTE +       +L ++QL  G+    I  IA         VG+L D    
Sbjct: 44  AREADVVMLDTEFVRTRTYYPQLGLIQLFDGETLSLIDPIAL--DEMTPFVGLLKDTSVL 101

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V    FG    P+  T+I +          G    + E +G+++ K++ 
Sbjct: 102 KVLHACGEDLEVFQNAFGCTPTPMVDTQIMAAFLGHGL-STGFAALVSEFVGVDLDKSES 160

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
            +DW A  LS +QL YAA+DV +L  +  +  EK+   G  + A    + 
Sbjct: 161 RTDWLARPLSQKQLDYAAADVHYLMPMYNKLLEKVMEAGWWEAAQQESDL 210


>gi|260913969|ref|ZP_05920443.1| ribonuclease D [Pasteurella dagmatis ATCC 43325]
 gi|260632056|gb|EEX50233.1| ribonuclease D [Pasteurella dagmatis ATCC 43325]
          Length = 383

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 3/173 (1%)

Query: 15  CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEK 74
             A+    +A+DTE + +     +L ++QL  G+    I  ++   ++    + +L ++ 
Sbjct: 28  VFAQQKSVVALDTEFVRIRTLYPQLGLIQLYDGERVSLIDPLS--IQDFSPFIALLANQN 85

Query: 75  REKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKA 134
             K+ H    D+ V  + +     P+  T+I +          GL   ++    + I K 
Sbjct: 86  VLKVLHACSEDLEVFQHYYQQMPTPMIDTQIMASFLSFPN-STGLATLIQHYFQLEIDKG 144

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
              +DW A  LSD+QL YAA+DV +L  L  +  + LQ+        + C  L
Sbjct: 145 ASRTDWLARPLSDKQLVYAAADVWYLLPLYQRMQQDLQQTPWQSAVENDCEML 197


>gi|71901132|ref|ZP_00683238.1| Ribonuclease D [Xylella fastidiosa Ann-1]
 gi|71729096|gb|EAO31221.1| Ribonuclease D [Xylella fastidiosa Ann-1]
          Length = 362

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 55/189 (29%), Positives = 82/189 (43%), Gaps = 4/189 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R    I +DTE +        L +VQ++  D  + +  +  G  +A  L   L      K
Sbjct: 17  RKPTRIGMDTEFIREGTFWPELALVQIAIEDEILLVDPLVPGMTDALGLW--LAAPNVIK 74

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           I H    D+    Y  GV  RP+F T+I + LT         K  + ++  + + K +  
Sbjct: 75  IMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGMGYQK-LVTKVTNVELGKGETR 133

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL-DLL 196
           SDW    L+  QL YAA+DV +L AL    TE+L  + RS      C  L D  E  +  
Sbjct: 134 SDWMHRPLTPAQLDYAANDVRYLFALHDTLTERLAEMSRSAWLEEDCTRLTDNIEQNENE 193

Query: 197 GWENVDIFS 205
            W ++ I S
Sbjct: 194 RWPHLAIRS 202


>gi|219815956|gb|ACL37078.1| DNA polymerase I [uncultured bacterium]
          Length = 927

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/205 (20%), Positives = 71/205 (34%), Gaps = 19/205 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +     AVDTET  +  R  R+  V  +        I I      AP           L
Sbjct: 345 LKAAPRFAVDTETTSVDYRLARIVGVSFALQASEAFYIPIGHDYMGAPEQLDAKFVLDTL 404

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L +    KI  + ++D  V            F T +AS +      +HG+ D  +  
Sbjct: 405 KPILENPAIGKIGQHMKYDAHVFNNHGISLAGWAFDTMLASYVLNPTATRHGMDDLAQYY 464

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSD-- 178
           L    +  +Q +   A  L+  Q++      YAA D      L   F + L ++ + +  
Sbjct: 465 LDYTTTTFEQIAGKGAKQLTFNQIELEKAAPYAAEDADITWRLYEYFAQALAKIPKLEKL 524

Query: 179 LATSCCNFLMDRAELDLLGWENVDI 203
           L            E++  G   +DI
Sbjct: 525 LLEIEMPAAQVLYEMENNGI-RLDI 548


>gi|148827593|ref|YP_001292346.1| ribonuclease D [Haemophilus influenzae PittGG]
 gi|148718835|gb|ABQ99962.1| ribonuclease D [Haemophilus influenzae PittGG]
          Length = 401

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 45  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFVALLANPKV 102

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R     T   GL    ++ L I I K  
Sbjct: 103 LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGT-SAGLAKLAQQYLNIEIDKGA 161

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 162 TLTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELI 213


>gi|298504558|gb|ADI83281.1| ribonuclease D, putative [Geobacter sulfurreducens KN400]
          Length = 381

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/176 (25%), Positives = 72/176 (40%), Gaps = 5/176 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
                 +A D E   +   ++++C++Q +       +  +AA   +   L  +  +    
Sbjct: 24  LGREPIVACDLEADSMHHYQEKVCLIQFAVPGYAAIVDPLAA--PDISPLAPLFANAAIR 81

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH   +DI  L   FG+ V  +F T IA +L        GL   L++  G+ + K  Q
Sbjct: 82  KVFHGADYDIRSLHRDFGMEVNNLFDTMIACQLLGEREF--GLAAQLRKRFGVELDKQYQ 139

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL-MDRA 191
            +DWS   L+   ++YA  D   L  L  Q    L+  GR       C  L   R 
Sbjct: 140 RADWSRRPLTPGMIEYAVKDTTLLIELCWQLATDLEAKGRRGWVEEECELLSRVRV 195


>gi|301169093|emb|CBW28690.1| ribonuclease D [Haemophilus influenzae 10810]
          Length = 382

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 26  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFVALLSNPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V    F    RP+  T+I +R     T   GL    ++ L + I K  
Sbjct: 84  LKVLHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGT-SAGLAKLAQQYLNVEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 194


>gi|57239422|ref|YP_180558.1| ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|58579394|ref|YP_197606.1| ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
 gi|57161501|emb|CAH58427.1| putative exonuclease [Ehrlichia ruminantium str. Welgevonden]
 gi|58418020|emb|CAI27224.1| Ribonuclease D [Ehrlichia ruminantium str. Welgevonden]
          Length = 389

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 81/180 (45%), Gaps = 3/180 (1%)

Query: 10  DIPAECAARYVDAIAVDTETLGL-MPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+  +        IAVDTE +        RL ++Q++  +G   +I + A   +   L  
Sbjct: 14  DVCNQLLMSCPKFIAVDTEFIRNCNEYYPRLSLIQIAWSEGKC-VIDVLADDIDLSVLES 72

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +  +++  KIFH  + DI  L   F     P+F ++IA+     Y N  G    + + L 
Sbjct: 73  IFYNKEIVKIFHDCKQDIDALLTKFPRIPYPIFDSQIAAMFCAYYDNAVGYSKLVAQFLD 132

Query: 129 INISK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +++ K   + S+W    LSD+++QYA  DVV+L+ L     + L    R        + +
Sbjct: 133 VSLDKLTLKRSNWLMRPLSDDKIQYALDDVVYLYELYQVLYDNLISSKRLLWFLEEMSNI 192


>gi|67537662|ref|XP_662605.1| hypothetical protein AN5001.2 [Aspergillus nidulans FGSC A4]
 gi|40741889|gb|EAA61079.1| hypothetical protein AN5001.2 [Aspergillus nidulans FGSC A4]
 gi|259482125|tpe|CBF76306.1| TPA: exosome complex exonuclease Rrp6, putative (Eurofung)
           [Aspergillus nidulans FGSC A4]
          Length = 1297

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 56/155 (36%), Gaps = 2/155 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +      + ++Q+S  +    +  +   ++    L  +  D    
Sbjct: 246 LKSAREIAIDLEHHDVHSYHGLVSLMQISTREKDWVVDTLKPWREELQMLNEVFADPNIL 305

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH    DI  L    G+ V  +F T  A+           LK  L + +     K  Q
Sbjct: 306 KLFHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKKS--LKYLLHKFVNFEADKQYQ 363

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
            +DW    L      YA SD  +L  +      +L
Sbjct: 364 MADWRIRPLPSGMFNYARSDTHYLLYIYDNLRNEL 398


>gi|330444881|ref|ZP_08308536.1| DNA polymerase I, 3' -- 5' polymerase, 5' -- 3' and 3' -- 5'
           exonuclease [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489191|dbj|GAA03033.1| DNA polymerase I, 3' -- 5' polymerase, 5' -- 3' and 3' -- 5'
           exonuclease [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 923

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 65/199 (32%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +   A A DTET GL      +  V  +  +G    + +A    +AP           L
Sbjct: 340 LKAAKAFAFDTETDGLDYMTANVVGVSFAIEEGKAAYVPVAHDYLDAPAQLDRDWVLAQL 399

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D  + KI    +FD +++          VF T + S +  +   +H +       
Sbjct: 400 KPLLEDPNQAKIGQNLKFDASIVARYGIEMQGIVFDTMLESYVFNSVVGRHDMDSLALRY 459

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQR-LGRSDL 179
           L       ++ +      L+  Q+       YAA D      L      K++       +
Sbjct: 460 LEHKNISFEEIAGKGKKQLTFNQIDLAQAGPYAAEDADITLRLHNALYPKVEADEKLKHV 519

Query: 180 AT-SCCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 520 FETIEMPLVPVLSRMERTG 538


>gi|325107025|ref|YP_004268093.1| ribonuclease D [Planctomyces brasiliensis DSM 5305]
 gi|324967293|gb|ADY58071.1| Ribonuclease D [Planctomyces brasiliensis DSM 5305]
          Length = 401

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 77/185 (41%), Gaps = 6/185 (3%)

Query: 9   GDIPAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
            D+     A     +A DTE +     R RLC++Q    +  V +        +      
Sbjct: 13  EDLCDRLHAS--GQVAFDTEFVSEFTFRPRLCLLQFGTSEEKVAVDPFQL--TDLTPWWE 68

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           ++ DE+ E I H GR +I   ++  G + + +   +I   L             +++++ 
Sbjct: 69  IMADEQTEVIIHGGREEILFCWHAIGKKPQNLIDVQIVQGLLSRGFPLSH-SALVQKVVR 127

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN-FL 187
             +   +  +DWS   L+ +Q+ YA  DVVHL  +  +   +L++  R+  A   C  F+
Sbjct: 128 KKVHGKETRTDWSKRPLTTKQINYAIEDVVHLIDIAEKQKVRLKKTKRTTWADEECRQFV 187

Query: 188 MDRAE 192
               E
Sbjct: 188 DGLVE 192


>gi|148976539|ref|ZP_01813235.1| DNA polymerase I [Vibrionales bacterium SWAT-3]
 gi|145964115|gb|EDK29372.1| DNA polymerase I [Vibrionales bacterium SWAT-3]
          Length = 932

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 69/199 (34%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +  +  A DTET  L      L  +  +  +G    + +A    +AP           L
Sbjct: 349 LKAAEVFAFDTETDSLDYMVANLVGLSFATEEGVAAYVPVAHDYLDAPQQLDRDWVLEQL 408

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D+ + K+    ++D++VL             T +AS +  +   +H +       
Sbjct: 409 KPILEDDAQAKVGQNLKYDMSVLARYGIEMKGIKHDTMLASYVFNSVGGKHDMDSLALRF 468

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQR-LGRSDL 179
           L  +    +Q +      L+  Q++      YAA D      L  +  E +++      +
Sbjct: 469 LQHSCISFEQIAGKGKKQLTFNQIELGEASPYAAEDADVTLRLHNRLMENIEQDEKLKAI 528

Query: 180 ATS-CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 529 YEEIEVPLIPVMSRIERTG 547


>gi|58617449|ref|YP_196648.1| ribonuclease D [Ehrlichia ruminantium str. Gardel]
 gi|58417061|emb|CAI28174.1| Ribonuclease D [Ehrlichia ruminantium str. Gardel]
          Length = 389

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 81/180 (45%), Gaps = 3/180 (1%)

Query: 10  DIPAECAARYVDAIAVDTETLGL-MPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           D+ ++        IAVDTE +        RL ++Q++   G   +I + A   +   L  
Sbjct: 14  DVCSQLLMSCPKFIAVDTEFIRNCNEYYPRLSLIQIAWSKGKC-VIDVLADDIDLSVLES 72

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +  +++  KIFH  + DI  L   F     P+F ++IA+     Y N  G    + + L 
Sbjct: 73  IFYNKEIVKIFHDCKQDIDALLTKFPRIPYPIFDSQIAAMFCAYYDNAVGYSKLVAQFLD 132

Query: 129 INISK-AQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           +++ K   + S+W    LSD+++QYA  DVV+L+ L     + L    R        + +
Sbjct: 133 VSLDKLTLKRSNWLMRPLSDDKIQYALDDVVYLYELYQVLYDNLISSKRLLWFLEEMSNI 192


>gi|95928412|ref|ZP_01311160.1| 3'-5' exonuclease [Desulfuromonas acetoxidans DSM 684]
 gi|95135683|gb|EAT17334.1| 3'-5' exonuclease [Desulfuromonas acetoxidans DSM 684]
          Length = 374

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 77/187 (41%), Gaps = 10/187 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
                   AVD E   +   ++++C++Q +  D TV +  +AAG  +   L  +L D   
Sbjct: 19  DLETCAVFAVDLEADSMHSYQEKVCLLQFTYHDTTVLLDPLAAG--DLAPLKPVLADSSI 76

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KIFH   +DI  L   F + +R +F T IAS+       + GL D L +   + + K  
Sbjct: 77  RKIFHAADYDIRCLARDFDIEIRGLFDTMIASQFLGEE--KVGLADVLGKYFDVTLDKRF 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDL 195
           Q +DWS   LS E   YAA D  HL  L       L+   R          L      + 
Sbjct: 135 QRADWSKRPLSPEMCHYAAEDTRHLEKLVAILEPALKEKDRLWWVEEEFRLL------EQ 188

Query: 196 LGWENVD 202
             +   D
Sbjct: 189 AKFRVHD 195


>gi|301060312|ref|ZP_07201175.1| putative ribonuclease D [delta proteobacterium NaphS2]
 gi|300445508|gb|EFK09410.1| putative ribonuclease D [delta proteobacterium NaphS2]
          Length = 381

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/170 (28%), Positives = 72/170 (42%), Gaps = 4/170 (2%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +   AIAVD E   +   ++++C++Q S     + +  +A    +   L  +       
Sbjct: 24  LQKETAIAVDLEADSMFHYQEKVCLLQFSTPSKNILVDPLAVK--DLSPLAPIFKSFGIC 81

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           KIFH   +DI  L+  F + V  +F T+IA+R         GL   L+  L I + K  Q
Sbjct: 82  KIFHGADYDIRSLYRDFKIEVNALFDTQIAARFLGLTDI--GLASLLQGKLNITLKKKYQ 139

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
             DWS   L    LQYA  D  HL  L     E+L + GR       C  
Sbjct: 140 KKDWSQRPLPAPMLQYAVHDTCHLIPLAQNLREELVKTGRLPFVEEECQL 189


>gi|52425412|ref|YP_088549.1| ribonuclease D [Mannheimia succiniciproducens MBEL55E]
 gi|52307464|gb|AAU37964.1| Rnd protein [Mannheimia succiniciproducens MBEL55E]
          Length = 380

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 77/187 (41%), Gaps = 9/187 (4%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A    AIA+DTE + +     +L ++QL  G+    I       ++      +L D K  
Sbjct: 30  ASTKSAIALDTEFVRIRSYYPKLGLIQLYDGEQVSLIDPQE--IQDFSPFKQLLADPKIL 87

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + +     P+  T+I +          GL   +K    + I K   
Sbjct: 88  KVLHACHEDLEVFQHYYQQLPAPMLDTQIMANFLGFQN-SMGLASLIKHYFNLEIDKGAS 146

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAELDLL 196
            +DW A  LS+ QL YAA+DV +L  L  +    L++          CN L     L+  
Sbjct: 147 RTDWLARPLSNRQLAYAAADVWYLLPLYCKMQNALEQTRWQSAVEFDCNLL-----LEKH 201

Query: 197 GW-ENVD 202
              +N+D
Sbjct: 202 RIVKNID 208


>gi|119491955|ref|XP_001263472.1| exosome complex exonuclease Rrp6, putative [Neosartorya fischeri
           NRRL 181]
 gi|119411632|gb|EAW21575.1| exosome complex exonuclease Rrp6, putative [Neosartorya fischeri
           NRRL 181]
          Length = 765

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 56/158 (35%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +      + ++Q+S  D    +  +   ++    L  +  D    
Sbjct: 241 LKSAKEIAIDLEHHDVHSYHGLVSLMQISTRDKDWVVDTLKPWREELQILNEVFADPGIL 300

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    DI  L    G+ V  +F T  A+           LK  L++ +     K  Q
Sbjct: 301 KVLHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRS--LKFLLQKFVNFEADKRYQ 358

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            +DW    L      YA SD  +L  +      +L   
Sbjct: 359 MADWRIRPLPSGMFDYARSDTHYLLYIYDHLRNELLEN 396


>gi|238919524|ref|YP_002933039.1| ribonuclease D [Edwardsiella ictaluri 93-146]
 gi|238869093|gb|ACR68804.1| ribonuclease D, putative [Edwardsiella ictaluri 93-146]
          Length = 371

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 74/174 (42%), Gaps = 3/174 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A     IA+DTE +       +L +VQL  G+    I  +     +    V +L + +  
Sbjct: 20  ASACPYIALDTEFVRTRTYYPQLGLVQLYDGEMLSLIDPLT--ISDWQPFVDLLRNPQVV 77

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  + F    +P+  T+I +          G    +   L +++ K++ 
Sbjct: 78  KLLHASSEDLEVFLHDFQTLPQPLIDTQILAAF-SGRPLSSGFAAMVSAYLQVDLDKSES 136

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
            +DW A  LS+ Q  YAA+DV +L  +  +   +++  G    A   C  L  R
Sbjct: 137 RTDWLARPLSERQCDYAAADVYYLLPMAHKLLAEVEACGWLPSALDECQALCRR 190


>gi|284006971|emb|CBA72245.1| ribonuclease D [Arsenophonus nasoniae]
          Length = 386

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/191 (28%), Positives = 84/191 (43%), Gaps = 6/191 (3%)

Query: 3   TIRVHEGD--IPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
              +   D  +   C AA     IA+DTE + +     +L ++QL  G+    I  IA  
Sbjct: 14  NYHLITTDAQLKEVCQAASKASKIALDTEFVRVKTYYPQLSLIQLYDGEQLSLIDPIA-- 71

Query: 60  QKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
             N      +L D K  KI H G  DI V F+      +P+  T+I +     +    G 
Sbjct: 72  ITNMEPFKNLLTDGKVTKILHAGSEDIEVFFHHLACVPQPMLDTQIMAAFVG-HPISSGF 130

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
              + + L I + K++  +DW    LSD+Q QYAA+DV  L  L  +  + + +LG    
Sbjct: 131 ASLVNKYLTIALDKSESRTDWLVRPLSDKQCQYAAADVFFLLPLAEKLQQLVDKLGYLPA 190

Query: 180 ATSCCNFLMDR 190
            T  C  ++ R
Sbjct: 191 VTDECQRILLR 201


>gi|150951537|ref|XP_001387875.2| ribosomal RNA processing 3'-5' exonuclease [Scheffersomyces
           stipitis CBS 6054]
 gi|149388676|gb|EAZ63852.2| ribosomal RNA processing 3'-5' exonuclease [Pichia stipitis CBS
           6054]
          Length = 792

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/163 (26%), Positives = 62/163 (38%), Gaps = 3/163 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVD E          +C++Q+S  D    II   A + +   L  +  +    
Sbjct: 249 LKKSSEIAVDLEHHDYRSYYGIVCLMQISNRDQDW-IIDTLALRDDLECLNTVFTNPHIV 307

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH    DI  L    G+ +  +F T  AS+          L   L+       SK  Q
Sbjct: 308 KVFHGAFMDIIWLQRDLGLYIVSLFDTYHASKSLGFPKFS--LAYLLETFAHFKTSKKYQ 365

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL 179
            +DW    LS   + YA SD   L ++  Q   KL   G   L
Sbjct: 366 LADWRIRPLSPPMMAYARSDTHFLLSIFDQLKNKLIDAGNEKL 408


>gi|39973915|ref|XP_368348.1| hypothetical protein MGG_00896 [Magnaporthe oryzae 70-15]
 gi|145018155|gb|EDK02434.1| hypothetical protein MGG_00896 [Magnaporthe oryzae 70-15]
          Length = 854

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/159 (23%), Positives = 60/159 (37%), Gaps = 2/159 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
             +    IAVD E          L ++Q+S  +    +  +   ++    L  +  D   
Sbjct: 272 DLKQAKEIAVDLEHHDFRTYHGLLSLMQISTREKDWIVDTLKPWRQQLEILNEVFADPSI 331

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH    DI  L    G+ V  +F T  A+           L   LK+ +     K  
Sbjct: 332 VKVFHGAFMDIVWLQRDLGLYVVGLFDTFHAAEAL--MYPSKSLAYLLKKFVDFEADKRY 389

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           Q++DW    L +E L YA SD  +L  +      +L R 
Sbjct: 390 QTADWRIRPLPEEMLYYARSDTHYLLYVYDMMRNELLRQ 428


>gi|296105609|ref|YP_003617309.1| DNA polymerase I [Legionella pneumophila 2300/99 Alcoy]
 gi|295647510|gb|ADG23357.1| DNA polymerase I [Legionella pneumophila 2300/99 Alcoy]
          Length = 896

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 66/195 (33%), Gaps = 14/195 (7%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA--------GQKNAPNLVG 68
                   +DTET  L   +  L  + L+  +     I +A          ++    L  
Sbjct: 317 LEQSQQFCIDTETTNLDVMQAELVGISLAVEEDNASYIPLAHTDGSTQLVKEEVLTALKP 376

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +L +    KI    ++D +VL           + T + S +  +   +H +     + LG
Sbjct: 377 ILENPAIGKIGQNIKYDYSVLKNYGITLQGIRYDTMLESYVLNSGAGRHDMDSLALKYLG 436

Query: 129 INISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
                 +  +   A  L  +Q+       YAA D      L  +    L +  R+ L   
Sbjct: 437 YKTISYEDVAGKGAKQLRFDQIPVEKAGIYAAEDADITLRLHHKLYPMLDKPLRNVLHDI 496

Query: 183 CCNFLMDRAELDLLG 197
               L   A++++ G
Sbjct: 497 EMPLLTVLADMEMHG 511


>gi|170724430|ref|YP_001758456.1| DNA polymerase I [Shewanella woodyi ATCC 51908]
 gi|169809777|gb|ACA84361.1| DNA polymerase I [Shewanella woodyi ATCC 51908]
          Length = 945

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 79/214 (36%), Gaps = 20/214 (9%)

Query: 3   TIRVHEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK 61
           TI  HE  +          D IA+DTET  L     +L  +  +   G    + +A    
Sbjct: 348 TILTHEA-LDKWIEQLTKADLIAIDTETTSLDYMTAKLVGISFAVEVGKAAYLPLAHDYL 406

Query: 62  NAP----------NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTR 111
           +AP           L  +L D K +K+    ++DI++            F T + S +  
Sbjct: 407 DAPEQLDFDEAIAKLKPLLEDPKLKKVGQNLKYDISIFANVGIKLQGVAFDTMLESYVFN 466

Query: 112 TYTNQHGLKDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRL 165
           +  ++H + D   + LG      ++ +   A  L+  Q+       YAA D      L  
Sbjct: 467 SVASKHNMDDLALKYLGHKNISFEEIAGKGAKQLTFNQIDLETAAPYAAEDADITLRLHQ 526

Query: 166 QFTEKLQRL-GRSDLATS-CCNFLMDRAELDLLG 197
               +L++    + + T      +   ++++  G
Sbjct: 527 HLWARLEKEPKLASVFTDIELPLVQVLSKIERQG 560


>gi|270295031|ref|ZP_06201232.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270274278|gb|EFA20139.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 951

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 73/209 (34%), Gaps = 14/209 (6%)

Query: 3   TIRVHE-GDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++ +  D  AE        + +++DTET G  P    L  +  S  +     + + A 
Sbjct: 358 DYQLIDTEDKRAEIIQKLLTSEILSIDTETTGTEPMDAELVGMSFSDAENRAYYVPVPAE 417

Query: 60  QKN----APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--Y 113
           ++           +  +EK  K+    ++D+ +L          +F T +A  + +    
Sbjct: 418 REEVLKIVNEFRPLFENEKSMKVGQNIKYDMIILQNYGVQVKGKLFDTMLAHYVLQPELR 477

Query: 114 TNQHGLKDNLKELLGINISKAQQSSDWSADDL----SDEQLQYAASDVVHLHALRLQFTE 169
            N   L +       I+I +   +   +  ++     ++  +YA  D      L+    +
Sbjct: 478 HNMDYLAEIYLHYQTIHIDELIGARGKNQKNMRDLPPEDVYRYACEDADVTLKLKNVLEK 537

Query: 170 KLQRLGRSDL-ATSCCNFLMDRAELDLLG 197
           +L+  G   L        +     ++  G
Sbjct: 538 ELKEQGAEHLFYEIEMPLVPVLVNIESNG 566


>gi|92113585|ref|YP_573513.1| ribonuclease D [Chromohalobacter salexigens DSM 3043]
 gi|91796675|gb|ABE58814.1| ribonuclease D [Chromohalobacter salexigens DSM 3043]
          Length = 375

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 72/179 (40%), Gaps = 3/179 (1%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGM 69
           +   C      + +AVDTE            +VQL  G   V ++   A    +P L  +
Sbjct: 16  LDDACDALAGAEWLAVDTEFHRESTFFPIAALVQLYAGGDAVYMVDPRAVS-ASPALQAL 74

Query: 70  LVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGI 129
           L      K+ H    D+ VL     V V P+  T++A +         G +  ++   G 
Sbjct: 75  LSVSGPLKLLHASGEDLEVLESWAEVGVAPIADTQVA-QSLLGTQASLGYQRLVEHWTGD 133

Query: 130 NISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
            + K +  SDW    LSD QLQYAA DVV+L  +     + L R GR       C  L 
Sbjct: 134 VLPKEETRSDWLQRPLSDAQLQYAALDVVYLPRIWEAQRDALMREGRLAWLEEECARLC 192


>gi|160888685|ref|ZP_02069688.1| hypothetical protein BACUNI_01102 [Bacteroides uniformis ATCC 8492]
 gi|156861999|gb|EDO55430.1| hypothetical protein BACUNI_01102 [Bacteroides uniformis ATCC 8492]
          Length = 958

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 73/209 (34%), Gaps = 14/209 (6%)

Query: 3   TIRVHE-GDIPAECA--ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAG 59
             ++ +  D  AE        + +++DTET G  P    L  +  S  +     + + A 
Sbjct: 365 DYQLIDTEDKRAEIIQKLLTSEILSIDTETTGTEPMDAELVGMSFSDAENRAYYVPVPAE 424

Query: 60  QKN----APNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--Y 113
           ++           +  +EK  K+    ++D+ +L          +F T +A  + +    
Sbjct: 425 REEVLKIVNEFRPLFENEKSMKVGQNIKYDMIILQNYGVQVKGKLFDTMLAHYVLQPELR 484

Query: 114 TNQHGLKDNLKELLGINISKAQQSSDWSADDL----SDEQLQYAASDVVHLHALRLQFTE 169
            N   L +       I+I +   +   +  ++     ++  +YA  D      L+    +
Sbjct: 485 HNMDYLAEIYLHYQTIHIDELIGARGKNQKNMRDLPPEDVYRYACEDADVTLKLKNVLEK 544

Query: 170 KLQRLGRSDL-ATSCCNFLMDRAELDLLG 197
           +L+  G   L        +     ++  G
Sbjct: 545 ELKEQGAEHLFYEIEMPLVPVLVNIESNG 573


>gi|121999199|ref|YP_001003986.1| DNA polymerase I [Halorhodospira halophila SL1]
 gi|121590604|gb|ABM63184.1| DNA polymerase I [Halorhodospira halophila SL1]
          Length = 904

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 70/199 (35%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
            R  DA ++D ET  L      +  V L+   G    + +A     AP+          L
Sbjct: 321 LRNADAFSIDLETNSLNYMDAEIVGVSLAVEPGQAAYLPVAHCGPGAPDQLDRDRVLDAL 380

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L  E+ EK+    ++D++VL           + + + S +  +   +H +     + 
Sbjct: 381 RPLLEAEQPEKMGQNLKYDMSVLARYGIELRGVAYDSMLESYVLDSTATRHDMDSLASKY 440

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRL-GRSDL 179
           LG+ ++  +Q        +   ++       YAA D      L      +LQ   G   +
Sbjct: 441 LGVEVTSYEQLCGKGVRQVPFAEIDVERAGHYAAEDADIALRLHQLLYPRLQAESGLLRV 500

Query: 180 A-TSCCNFLMDRAELDLLG 197
                   L   + ++  G
Sbjct: 501 FSQLEMPLLPVLSRMERHG 519


>gi|320163487|gb|EFW40386.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 467

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 79/177 (44%), Gaps = 3/177 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
               + I +DTE L       +LC++QLS       +  ++   +    L   L   ++ 
Sbjct: 155 LAAAETIGLDTEFLSFPRYTPQLCVLQLSTETDLGIVDALSISPEMLKKLC--LRICEKP 212

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
            I H    D A+L+   G     VF T+IA+          G    ++ L  + + K+  
Sbjct: 213 VIVHSCSSDCAILYDIAGTLPAKVFDTQIAAAFCYPIMM-MGYGQLVETLFEVQVDKSLT 271

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
            +DWS   L  +++ YA SDVVHLHA+R +   ++  LGR++   S     +  A+L
Sbjct: 272 LTDWSLRPLKKDEVAYAISDVVHLHAIRDKLNARIAELGRTEWFESEMASAVSPAKL 328


>gi|54296094|ref|YP_122463.1| DNA polymerase I [Legionella pneumophila str. Paris]
 gi|53749879|emb|CAH11261.1| DNA polymerase I [Legionella pneumophila str. Paris]
          Length = 896

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 66/195 (33%), Gaps = 14/195 (7%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA--------GQKNAPNLVG 68
                   +DTET  L   +  L  + L+  +     I +A          ++    L  
Sbjct: 317 LEQSQQFCIDTETTNLDVMQAELVGISLAVEEDNASYIPLAHTDGSTQLVKEEVLTALKP 376

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +L +    KI    ++D +VL           + T + S +  +   +H +     + LG
Sbjct: 377 ILENPAIGKIGQNIKYDYSVLKNYGITLKGIRYDTMLESYVLNSGAGRHDMDSLALKYLG 436

Query: 129 INISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
                 +  +   A  L  +Q+       YAA D      L  +    L +  R+ L   
Sbjct: 437 YKTISYEDVAGKGAKQLRFDQIPVEKAGIYAAEDADITLRLHHKLYPMLDKPLRNVLHDI 496

Query: 183 CCNFLMDRAELDLLG 197
               L   A++++ G
Sbjct: 497 EMPLLTVLADMEMHG 511


>gi|148358256|ref|YP_001249463.1| DNA polymerase I [Legionella pneumophila str. Corby]
 gi|148280029|gb|ABQ54117.1| DNA polymerase I [Legionella pneumophila str. Corby]
          Length = 896

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 65/195 (33%), Gaps = 14/195 (7%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA--------GQKNAPNLVG 68
                   +DTET  L   +  L  + L+  +     I +A          ++    L  
Sbjct: 317 LEQSQQFCIDTETTNLDVMQAELVGISLAVEEENASYIPLAHTDGSTQLVKEEVLTALKP 376

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +L +    KI    ++D +VL           + T + S +  +   +H +     + LG
Sbjct: 377 ILENPAIGKIGQNIKYDYSVLKNYGITLKGIRYDTMLESYVLNSGAGRHDMDSLALKYLG 436

Query: 129 INISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
                 +  +   A  L  +Q+       YAA D      L  +    L    R+ L   
Sbjct: 437 YKTISYEDVAGKGAKQLRFDQIPVEKAGIYAAEDADITLRLHHKLYPMLDEPLRNVLHDI 496

Query: 183 CCNFLMDRAELDLLG 197
               L   A++++ G
Sbjct: 497 EMPLLTVLADMEIHG 511


>gi|170731148|ref|YP_001776581.1| ribonuclease D [Xylella fastidiosa M12]
 gi|167965941|gb|ACA12951.1| ribonuclease D [Xylella fastidiosa M12]
          Length = 362

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 81/189 (42%), Gaps = 4/189 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R    I +DTE +        L +VQ++  D  + +  +  G  +A  L   L      K
Sbjct: 17  RKPTRIGMDTEFIREGTFWPELALVQIAIEDEILLVDPLVPGMTDALGLW--LAAPNVIK 74

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           I H    D+    Y  GV  RP+F T+I + LT         K  + ++  + + K +  
Sbjct: 75  IMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGMGYQK-LVAKVTNVELGKGETR 133

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL-DLL 196
           SDW    L+  QL YAA+DV +L  L    TE+L  + RS      C  L D  E  +  
Sbjct: 134 SDWMHRPLTPAQLDYAANDVRYLFVLHDTLTERLAEMSRSAWLEEDCTRLTDNIEQNENE 193

Query: 197 GWENVDIFS 205
            W ++ I S
Sbjct: 194 RWPHLAIRS 202


>gi|54293062|ref|YP_125477.1| DNA polymerase I [Legionella pneumophila str. Lens]
 gi|53752894|emb|CAH14329.1| DNA polymerase I [Legionella pneumophila str. Lens]
          Length = 896

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 66/195 (33%), Gaps = 14/195 (7%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA--------GQKNAPNLVG 68
                   +DTET  L   +  L  + L+  +     I +A          ++    L  
Sbjct: 317 LEQSQQFCIDTETTNLDVMQAELVGISLAVEEENASYIPLAHTDGSTQLVKEEVLTALKP 376

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
           +L +    KI    ++D +VL           + T + S +  +   +H +     + LG
Sbjct: 377 ILENPAIGKIGQNIKYDYSVLKNYGITLKGIRYDTMLESYVLNSGAGRHDMDSLALKYLG 436

Query: 129 INISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSDLATS 182
                 +  +   A  L  +Q+       YAA D      L  +    L +  R+ L   
Sbjct: 437 YKTISYEDVAGKGAKQLRFDQIPVEKAGIYAAEDADITLRLHHKLYPMLDKPLRNVLHDI 496

Query: 183 CCNFLMDRAELDLLG 197
               L   A++++ G
Sbjct: 497 EMPLLTVLADMEMHG 511


>gi|229846478|ref|ZP_04466586.1| ribonuclease D [Haemophilus influenzae 7P49H1]
 gi|229810571|gb|EEP46289.1| ribonuclease D [Haemophilus influenzae 7P49H1]
          Length = 380

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 26  LAQQQSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFVALLSNPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R     T   GL    ++ L I I K  
Sbjct: 84  LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFIGLGT-SAGLAKLAQQYLNIEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 194


>gi|114775667|ref|ZP_01451235.1| ribonuclease D [Mariprofundus ferrooxydans PV-1]
 gi|114553778|gb|EAU56159.1| ribonuclease D [Mariprofundus ferrooxydans PV-1]
          Length = 398

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 74/172 (43%), Gaps = 3/172 (1%)

Query: 22  AIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
            + VDTE            ++Q+  G+G   +I     +  AP    ++++    K+FH 
Sbjct: 27  VLCVDTEFHRESTFYPEFALLQIY-GNGQCWVIDPITIKDLAPV-WDIMLNPAILKVFHA 84

Query: 82  GRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWS 141
            R DI ++F   G    P+F T++A+     Y  Q G  + ++ +    + K +  +DW 
Sbjct: 85  ARQDIEIIFNEAGGLPLPLFDTQVAA-ALLGYGQQVGFGNLVQRITKKLLPKGESFTDWK 143

Query: 142 ADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL 193
           A  L+ +Q+ YAA DV+ L  +     E+L+   R+         L      
Sbjct: 144 ARPLTKKQMAYAADDVIWLMPVFQHLKERLEAAKRTQWLQEEQQTLCSPETY 195


>gi|145632638|ref|ZP_01788372.1| ribonuclease D [Haemophilus influenzae 3655]
 gi|144986833|gb|EDJ93385.1| ribonuclease D [Haemophilus influenzae 3655]
 gi|309972450|gb|ADO95651.1| Ribonuclease D [Haemophilus influenzae R2846]
          Length = 380

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 72/171 (42%), Gaps = 3/171 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    + +L + K 
Sbjct: 26  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFIALLANPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F     P+  T+I +R         GL    ++ L I I K  
Sbjct: 84  LKILHSCSEDLLVFLQEFDQLPHPMIDTQIMARFIGLGA-SAGLAKLAQQYLNIEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
             ++W    LSD QLQYAA DV +L  L     ++L +          C  
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCEL 193


>gi|149196457|ref|ZP_01873512.1| hypothetical protein LNTAR_14907 [Lentisphaera araneosa HTCC2155]
 gi|149140718|gb|EDM29116.1| hypothetical protein LNTAR_14907 [Lentisphaera araneosa HTCC2155]
          Length = 372

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/169 (26%), Positives = 66/169 (39%), Gaps = 2/169 (1%)

Query: 19  YVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
               IA+DTE +          ++Q+    G + +I +         L  +L      KI
Sbjct: 19  SEKDIALDTEFVWTKTFHPIPGLLQIKSA-GEIHLIDLLIENFPKEILKELLESRDVCKI 77

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSS 138
            H    D+ +         + +F T+  +        Q  L     E++ I ISK QQ S
Sbjct: 78  LHSPDQDLKLFKLFCDAEAKNIFDTQ-LAYAFTGAPKQVSLAKLCLEMMDIEISKTQQVS 136

Query: 139 DWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
           DW+   L D QL YAA DV +L  +     EKL+  GR D        +
Sbjct: 137 DWTKRPLKDSQLNYAAEDVRYLIEITETLREKLKENGRYDWFLEENKSI 185


>gi|145634613|ref|ZP_01790322.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittAA]
 gi|145268158|gb|EDK08153.1| peptidyl-tRNA hydrolase [Haemophilus influenzae PittAA]
          Length = 362

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 74/171 (43%), Gaps = 3/171 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 8   LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFVALLANPKV 65

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R         GL    ++ L + I K  
Sbjct: 66  LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFIGLGA-SAGLAKLAQQYLNVEIDKGA 124

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
             ++W    LSD QLQYAA DV +L  L     ++L +       +  C  
Sbjct: 125 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEKAVSDDCEL 175


>gi|197285028|ref|YP_002150900.1| ribonuclease D [Proteus mirabilis HI4320]
 gi|194682515|emb|CAR42495.1| ribonuclease D [Proteus mirabilis HI4320]
          Length = 372

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/175 (24%), Positives = 74/175 (42%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AA  V  IA+DTE + +      L ++Q+  G     I  +          V +L +   
Sbjct: 18  AASEVSQIALDTEFVRIRTYYPHLGLIQMYDGKQISLIDPLT--ITEWTPFVELLTNPAV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K  H G  D+ V  + FG    P+  T++ +          G    +++   I + K++
Sbjct: 76  LKYLHAGSEDLEVFSHQFGCVPTPMIDTQVVAAFLGYPI-SCGFATLVEKYEHIALDKSE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             +DW A  L+++Q QYA+ DV +L  L  +   + Q  G  D     C  + +R
Sbjct: 135 SRTDWLARPLTEKQCQYASGDVFYLLPLAKKLIAQAQEAGYMDAIVDECEMIAER 189


>gi|146312020|ref|YP_001177094.1| ribonuclease D [Enterobacter sp. 638]
 gi|145318896|gb|ABP61043.1| ribonuclease D [Enterobacter sp. 638]
          Length = 384

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 79/173 (45%), Gaps = 3/173 (1%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R   AIA+DTE +       +L ++Q+  G     I  +  G  +   +  +L++    K
Sbjct: 29  RDFPAIALDTEFVRTRTYYPQLGLIQMYDGKNVSLIDPL--GITDWSPMRELLLNTAITK 86

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
             H G  D+ V   TFG+   P+  T+I +          G    ++E  GI + K++  
Sbjct: 87  YLHAGSEDLEVFLNTFGIMPEPLIDTQILAAF-SGRPLSWGFAAMVEEYTGIALDKSESR 145

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +DW A  L++ QL YAA+DV +L  +  Q  ++ +  G  D A + C     R
Sbjct: 146 TDWLARPLTERQLDYAAADVFYLLPIAGQLMKEAEAAGWLDAALNECRMTQQR 198


>gi|71275157|ref|ZP_00651444.1| Ribonuclease D [Xylella fastidiosa Dixon]
 gi|71163966|gb|EAO13681.1| Ribonuclease D [Xylella fastidiosa Dixon]
          Length = 362

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 81/189 (42%), Gaps = 4/189 (2%)

Query: 18  RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREK 77
           R    I +DTE +        L +VQ++  D  + +  +  G  +A  L   L      K
Sbjct: 17  RKPTRIGMDTEFIREGTFWPELALVQIAIEDEILLVDPLVPGMTDALGLW--LAAPNVIK 74

Query: 78  IFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQS 137
           I H    D+    Y  GV  RP+F T+I + LT         K  + ++  + + K +  
Sbjct: 75  IMHSASEDLIAFKYACGVLPRPLFDTQIGAALTGLGGGMGYQK-LVAKVTNVELGKGETR 133

Query: 138 SDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDRAEL-DLL 196
           SDW    L+  QL YAA+DV +L  L    TE+L  + RS      C  L D  E  +  
Sbjct: 134 SDWMHRPLTPAQLDYAANDVRYLFVLHDTLTERLAEMSRSAWLEEDCTRLTDNIEQNENE 193

Query: 197 GWENVDIFS 205
            W ++ I S
Sbjct: 194 RWPHLAIRS 202


>gi|148825327|ref|YP_001290080.1| ribonuclease D [Haemophilus influenzae PittEE]
 gi|148715487|gb|ABQ97697.1| translation-associated GTPase [Haemophilus influenzae PittEE]
          Length = 380

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 74/171 (43%), Gaps = 3/171 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    + +L + K 
Sbjct: 26  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFIALLANPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R         GL    ++ L I I K  
Sbjct: 84  LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFIGLGA-SAGLAKLAQQYLNIEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
             ++W    LSD QLQYAA DV +L  L     ++L +       +  C  
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEKAVSDDCEL 193


>gi|114322007|ref|YP_743690.1| DNA polymerase I [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228401|gb|ABI58200.1| DNA polymerase I [Alkalilimnicola ehrlichii MLHE-1]
          Length = 912

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 67/201 (33%), Gaps = 18/201 (8%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
               +  A D ET  L      +  V L+ G G    + +A    + P           L
Sbjct: 329 LESAELFAFDLETSSLNYMDAEIVGVALAVGAGEAAYVPLAHEGPDTPTQLDRDRVLAAL 388

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D  R K+    ++D++VL           + T + S +  +  ++H +     + 
Sbjct: 389 KPLLEDPDRAKVGQNLKYDMSVLARYDIHLEGVAYDTMLESYVLDSTASRHDMDSLALKY 448

Query: 127 LGINISKAQQSSDWSADDLS------DEQLQYAASDVVHLHALRLQFTEKLQRLGRS-DL 179
           LG    K +      A  +       +   +YA  D      L      +L+  GR   +
Sbjct: 449 LGRATVKYEDVCGKGAKQIPFAQVAVETATRYAGEDADITLRLHQTLYPRLEAEGRLVQV 508

Query: 180 ATS-CCNFLMDRAELDLLGWE 199
             +     L   + ++  G +
Sbjct: 509 FHAIEMPLLPVLSRMERHGVK 529


>gi|260775065|ref|ZP_05883964.1| DNA polymerase I [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608982|gb|EEX35142.1| DNA polymerase I [Vibrio coralliilyticus ATCC BAA-450]
          Length = 931

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 67/199 (33%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +  D  A DTET  L      L  V  +  +G    + +A    +AP           L
Sbjct: 348 LKAADVFAFDTETDSLDYMVANLVGVSFATEEGVAAYVPVAHDYLDAPEQLDRDWVLEQL 407

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D+ + K+    ++D +VL             T +AS +  +   +H +       
Sbjct: 408 KPILEDDAQAKVGQNLKYDASVLARYGIEMKGIKHDTMLASYVYNSVGGKHDMDSLALRF 467

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQR-LGRSDL 179
           L  +    +Q +      L+  Q++      YAA D      L  +    +++      +
Sbjct: 468 LQHSCISFEQIAGKGKKQLTFNQIELEQASPYAAEDADVTLRLHNRLLANIEQDEKLKTI 527

Query: 180 ATS-CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 528 YEEVEVPLVPVLSRIERTG 546


>gi|90414265|ref|ZP_01222245.1| DNA polymerase I [Photobacterium profundum 3TCK]
 gi|90324712|gb|EAS41253.1| DNA polymerase I [Photobacterium profundum 3TCK]
          Length = 922

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 66/199 (33%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
               D +A DTET GL      L  V  +  +G    + +A    +AP           L
Sbjct: 339 LTAADVVAFDTETDGLDYMTANLVGVSFAVEEGKAAYVPVAHDYLDAPEQLDRDWVLAQL 398

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D  + K+    +FD+++L           + T + S +  +   +H +       
Sbjct: 399 KPLLEDPAQNKVGQNLKFDMSILARYDINMQGIKYDTMLESYVFNSVVGRHDMDSLALRY 458

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQR-LGRSDL 179
           L       ++ +      L+  Q+       YAA D      L     EK++       +
Sbjct: 459 LEHKNISFEEVAGKGKKQLTFNQIDLDVAGPYAAEDADITLRLHNLLNEKVESDEQLKSV 518

Query: 180 ATS-CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 519 FEDIEMPLVPVLSRIERTG 537


>gi|284046840|ref|YP_003397180.1| ribonuclease D [Conexibacter woesei DSM 14684]
 gi|283951061|gb|ADB53805.1| Ribonuclease D [Conexibacter woesei DSM 14684]
          Length = 396

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 78/175 (44%), Gaps = 6/175 (3%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLS-----PGDGTVDIIRIAAGQKNAPNLVGML 70
            AR    + +DTE +     R  LC+VQ++       +G    +     + +   L  +L
Sbjct: 21  LARAAGRLGIDTEFMSEGRYRALLCLVQVAVDDADAPNGVRIALFDPFDKLDFAPLAAVL 80

Query: 71  VDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGIN 130
            D + E + H  R D+A++   +   VR VF T++A+        Q G  + L   LG  
Sbjct: 81  ADPEIEIVLHAARQDVAIMRRAWRTDVREVFDTQVAAGFAGYGA-QTGYGNLLGAALGQR 139

Query: 131 ISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + K    + W A  L++EQL YAA DV+HL  L     +KL   GR   A   C 
Sbjct: 140 VGKTASYTRWDARPLTEEQLSYAAEDVLHLLQLSDALHDKLSAHGRLQWAQEECR 194


>gi|110597086|ref|ZP_01385375.1| DNA polymerase I [Chlorobium ferrooxidans DSM 13031]
 gi|110341277|gb|EAT59742.1| DNA polymerase I [Chlorobium ferrooxidans DSM 13031]
          Length = 944

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 60/194 (30%), Gaps = 11/194 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----LVGMLV 71
           + +    IAVDTET  L      L  + +S        I +A    N  +    L  +L 
Sbjct: 366 SLQDAPRIAVDTETTSLNTFEAELAGISISTEARKARFIALANSSLNPQSALELLRPLLE 425

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           + +  K     ++DI VL           F T +AS +       +      + L     
Sbjct: 426 NPELPKTGQNLKYDILVLKKYGIDLTPVGFDTMLASYVLDPEEKHNLDDLAARHLGYKTT 485

Query: 132 SKAQQSSDWSADDL-----SDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS--CC 184
           +  + +    A         ++   YA  D      L   F +KL+              
Sbjct: 486 TFEELTGTGKAKLHIFDVEPEQLSDYACQDADLALQLEEIFRKKLEGEKELLWLCEHIEF 545

Query: 185 NFLMDRAELDLLGW 198
             +   A ++  G 
Sbjct: 546 PLVSVLAAMEHAGI 559


>gi|282879100|ref|ZP_06287860.1| DNA-directed DNA polymerase [Prevotella buccalis ATCC 35310]
 gi|281298834|gb|EFA91243.1| DNA-directed DNA polymerase [Prevotella buccalis ATCC 35310]
          Length = 920

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 68/188 (36%), Gaps = 11/188 (5%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA----PNLVGMLVDEKRE 76
             +++DTET    P    L  +  +        + + A  ++A         +  +E+  
Sbjct: 348 KILSLDTETTSTNPMEAELVGLSFAVEPKKAFYVPVPAKHEDAVNLVKIFKPLYENEEIV 407

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--YTNQHGLKDNLKELLGINISKA 134
           K+    ++D+ VL         P+F T IA  + +     N   + +       I+I K 
Sbjct: 408 KVGQNIKYDMEVLRNYGIELKGPMFDTMIAHYVLQPELRHNMDYMAEVYLNYQTIHIEKL 467

Query: 135 QQSSDWSADDLSD----EQLQYAASDVVHLHALRLQFTEKLQRLGRSDL-ATSCCNFLMD 189
                 +  ++ D    +   YA  D      L+     KL+  G +DL        +  
Sbjct: 468 IGERGKNQKNMRDLSPTDVYLYACEDADITLQLKNALEPKLKEAGVADLFYQMEMPLVNV 527

Query: 190 RAELDLLG 197
            AE+++ G
Sbjct: 528 LAEMEMNG 535


>gi|320352875|ref|YP_004194214.1| DNA polymerase I [Desulfobulbus propionicus DSM 2032]
 gi|320121377|gb|ADW16923.1| DNA polymerase I [Desulfobulbus propionicus DSM 2032]
          Length = 894

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/216 (20%), Positives = 68/216 (31%), Gaps = 23/216 (10%)

Query: 7   HEGDIPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQK---- 61
           H+  + A          +AVDTET  L P + RL  V L   DG    +      +    
Sbjct: 298 HQEQLAALAERLAGASLVAVDTETDSLDPLKARLVGVSLCTEDGEAWYLPCGHRDEAGEL 357

Query: 62  ---------NAPNLVGMLVDEKREKIFHYGRFDIAVL---FYTFGVRVRPVFCTKIASRL 109
                        L  +L      KI H  +FD+AVL            P+  T I + L
Sbjct: 358 VAGQLPLDRLIEFLRPVLEHPGTTKIGHNLKFDLAVLSAPCNGGIQLACPLHDTMIGAWL 417

Query: 110 TRTYTNQHGLKDNL-----KELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALR 164
                  + L D       +      ++ A +S D       +    Y+  DV     L 
Sbjct: 418 LAPDRRTYKLDDLCGEINLRMTSYEEVTHADKSEDAFCRVPLEAAKNYSCEDVYGALRLY 477

Query: 165 LQFTEKLQRLGRSDLATS-CCNFLMDRAELDLLGWE 199
            +   +L+R     L        +   A ++  G  
Sbjct: 478 QEQLPQLERADLLALLREVEGPLVPVLAAMEREGIR 513


>gi|320034794|gb|EFW16737.1| exosome complex exonuclease Rrp6 [Coccidioides posadasii str.
           Silveira]
          Length = 772

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 58/158 (36%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVD E          +C++Q+S  +    +  +   ++    L  +  D +  
Sbjct: 244 LKSAKEIAVDLEHHDAHSYHGLVCLMQISTREKDWIVDTLLPWREELQILNEVFADPRIL 303

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+  L    G+ +  +F T  AS           LK  L + + +   K  Q
Sbjct: 304 KVLHGSSMDVIWLQRDLGLYLVGLFDTYHASVALNYPKKS--LKFLLDKFVNLEAEKQYQ 361

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           ++DW    L      YA SD  +L  +      +L   
Sbjct: 362 TADWRLRPLLPGMFDYARSDTHYLLYIYDNLRNELIEK 399


>gi|303310683|ref|XP_003065353.1| 3'-5' exonuclease family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240105015|gb|EER23208.1| 3'-5' exonuclease family protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 766

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 58/158 (36%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVD E          +C++Q+S  +    +  +   ++    L  +  D +  
Sbjct: 244 LKSAKEIAVDLEHHDAHSYHGLVCLMQISTREKDWIVDTLLPWREELQILNEVFADPRIL 303

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+  L    G+ +  +F T  AS           LK  L + + +   K  Q
Sbjct: 304 KVLHGSSMDVIWLQRDLGLYLVGLFDTYHASVALNYPKKS--LKFLLDKFVNLEAEKQYQ 361

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           ++DW    L      YA SD  +L  +      +L   
Sbjct: 362 TADWRLRPLLPGMFDYARSDTHYLLYIYDNLRNELIEK 399


>gi|170035413|ref|XP_001845564.1| exosome component 10 [Culex quinquefasciatus]
 gi|167877380|gb|EDS40763.1| exosome component 10 [Culex quinquefasciatus]
          Length = 796

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 3/164 (1%)

Query: 12  PAECAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLV 71
           P     R    +A+D E       +   C++Q+S       II   A ++    L  +  
Sbjct: 272 PLLEELRQAKELAIDLEHHSYRTFQGFTCLMQISTRTKD-YIIDTLALREELHVLNEVFT 330

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINI 131
           D K  K+ H    DI  L     + V  +F T  A+++      + GL+  LK    I  
Sbjct: 331 DTKVVKVLHGSISDIEWLQRDLALYVVNMFDTGEAAKVLEFS--RIGLQFLLKHYCNIET 388

Query: 132 SKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLG 175
            KA Q +DW    +    ++YA  D  +L  +  +   +L   G
Sbjct: 389 DKAYQLADWRIRPIPKNFIEYARKDTHYLLYIYDRMRNELIEKG 432


>gi|119195137|ref|XP_001248172.1| hypothetical protein CIMG_01943 [Coccidioides immitis RS]
          Length = 766

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 58/158 (36%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IAVD E          +C++Q+S  +    +  +   ++    L  +  D +  
Sbjct: 244 LKSAKEIAVDLEHHDAHSYHGLVCLMQISTREKDWIVDTLLPWREELQILNEVFADPRIL 303

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+  L    G+ +  +F T  AS           LK  L + + +   K  Q
Sbjct: 304 KVLHGSSMDVIWLQRDLGLYLVGLFDTYHASVALNYPKKS--LKFLLDKFVNLEAEKQYQ 361

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
           ++DW    L      YA SD  +L  +      +L   
Sbjct: 362 TADWRLRPLLPGMFDYARSDTHYLLYIYDNLRNELIEK 399


>gi|209694623|ref|YP_002262551.1| ribonuclease D (rnase d) [Aliivibrio salmonicida LFI1238]
 gi|208008574|emb|CAQ78749.1| ribonuclease D (rnase d) [Aliivibrio salmonicida LFI1238]
          Length = 374

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 3/167 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
           A     + +DTE +       RL ++Q+  G+    +  +     +   L  +L +E   
Sbjct: 19  ASNKPFLMLDTEFVRTRTLYARLGLIQMFDGETLALVDPVE--IDDLTPLWDLLKNESVT 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+ H    D+ V  +  G    P+  T+I +          G    + + LG+++ K + 
Sbjct: 77  KVLHACGEDLEVFQHYAGCMPTPMIDTQIMAAFLGYGL-STGFAKLVSDYLGVDLDKGES 135

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSC 183
            +DW A  LSD+QL YAA+DV +L  L  +   +L +      A   
Sbjct: 136 RTDWMARPLSDKQLDYAAADVHYLLPLFEKLQAELAQTEWEKAAYQE 182


>gi|90580077|ref|ZP_01235885.1| hypothetical ribonuclease D [Vibrio angustum S14]
 gi|90438962|gb|EAS64145.1| hypothetical ribonuclease D [Vibrio angustum S14]
          Length = 375

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 80/175 (45%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           +AR   A+ +DTE +       RL ++QL  G+    I  +    ++   L  +L D+  
Sbjct: 18  SARTHTAVMLDTEFVRTRTLYPRLGLIQLFDGEQLSLIDPLEV--EDMEPLWALLRDQSV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V  +  G    P+F T++ +          G    +KE +G+ + K +
Sbjct: 76  IKVLHACGEDLEVFQHHAGCLPTPMFDTQLMAAFLGHGI-STGFGTLVKEYVGVELDKGE 134

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             ++W A  L+++QL YAA+DV +L  L      K++  G  +     C  +M R
Sbjct: 135 ARTNWLARPLTEKQLDYAAADVYYLKPLFESLLAKVEERGYMEALQQECESVMHR 189


>gi|89075742|ref|ZP_01162130.1| hypothetical ribonuclease D [Photobacterium sp. SKA34]
 gi|89048474|gb|EAR54049.1| hypothetical ribonuclease D [Photobacterium sp. SKA34]
          Length = 363

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 80/175 (45%), Gaps = 3/175 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           +AR   A+ +DTE +       RL ++QL  G+    I  I    ++   L  +L D+  
Sbjct: 6   SARAHSAVMLDTEFVRTRTLYPRLGLIQLFDGEQLSLIDPIEV--EDMEPLWALLRDQSV 63

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+ H    D+ V  +  G    P+F T++ +          G    +KE +G+ + K +
Sbjct: 64  IKVLHACGEDLEVFQHHAGCLPTPMFDTQLMAAFLGHGI-STGFGALVKEYVGVELDKGE 122

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
             ++W A  L+ +QL YAA+DV +L  L      K+++ G  +     C  +M R
Sbjct: 123 ARTNWLARPLTAKQLDYAAADVYYLKPLFETLLAKVEKRGYMEALQQECQSVMQR 177


>gi|145640347|ref|ZP_01795931.1| ribonuclease D [Haemophilus influenzae R3021]
 gi|145274933|gb|EDK14795.1| ribonuclease D [Haemophilus influenzae 22.4-21]
          Length = 380

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 74/171 (43%), Gaps = 3/171 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    + +L + K 
Sbjct: 26  LAQQKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFIALLANPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R         GL    ++ L + I K  
Sbjct: 84  LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFIGLGA-SAGLAKLAQQYLNVEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNF 186
             ++W    LSD QLQYAA DV +L  L     ++L +       +  C  
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEKAVSDDCEL 193


>gi|238484333|ref|XP_002373405.1| exosome complex exonuclease Rrp6, putative [Aspergillus flavus
           NRRL3357]
 gi|220701455|gb|EED57793.1| exosome complex exonuclease Rrp6, putative [Aspergillus flavus
           NRRL3357]
          Length = 434

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/158 (20%), Positives = 59/158 (37%), Gaps = 2/158 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            +    IA+D E   +   +  + ++Q+S  D    +  +   ++    L  +  D    
Sbjct: 236 LKSAKEIAIDLEHHDVHSYQGLVSLMQISTRDKDWVVDTLKPWREELQMLNEVFADPSIL 295

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
           K+FH    DI  L    G+ V  +F T  A+           LK  L++ +     K  Q
Sbjct: 296 KVFHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYPKRS--LKFLLQKFVNFEADKRYQ 353

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRL 174
            +DW    + +    YA SD  +L  +      +L   
Sbjct: 354 MADWRIRPIPEGMFDYARSDTHYLLHIFDHLRNELIEN 391


>gi|322832720|ref|YP_004212747.1| ribonuclease D [Rahnella sp. Y9602]
 gi|321167921|gb|ADW73620.1| ribonuclease D [Rahnella sp. Y9602]
          Length = 373

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 51/192 (26%), Positives = 78/192 (40%), Gaps = 6/192 (3%)

Query: 2   TTIRVHE-GDIPAE--CAARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
               +    D   +    A+    IA+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYELITTNDALEQVCLQAKAHSKIALDTEFVRTRTYYPQLGLIQLFDGERLTLIDPLP- 59

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
                   + +LVD    K  H G  D+ V    FGV   P+  T+I +          G
Sbjct: 60  -ITAWQPFIDLLVDPDVIKFLHAGSEDLEVFLNAFGVMPSPLIDTQILAAF-SGRPLSCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E  G+ + K++  +DW A  LS++Q  YAA+DV +L  L  Q   + Q  G  D
Sbjct: 118 FARLVAETTGVELDKSESRTDWIARPLSEKQCVYAAADVWYLLPLADQLMRETQDAGWMD 177

Query: 179 LATSCCNFLMDR 190
            A   C  L  R
Sbjct: 178 AALDECLALCRR 189


>gi|220933279|ref|YP_002512178.1| DNA polymerase I [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994589|gb|ACL71191.1| DNA polymerase I [Thioalkalivibrio sp. HL-EbGR7]
          Length = 903

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 70/201 (34%), Gaps = 18/201 (8%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPN----------L 66
               +  A DTET  L   + ++  V  +   G    + +A    +AP           L
Sbjct: 321 LETAELFAFDTETTSLDYMQAQVVGVSFAVKTGEAAYLPLAHDYADAPQQLDRDETLKRL 380

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L   + +K+ H+ ++D  VL             T + S +  +  ++H +    ++ 
Sbjct: 381 KPLLESARHKKLGHHLKYDRNVLLNHGIELNGIEHDTMLESYVLNSTASRHDMDSLAQKY 440

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKL-QRLGRSDL 179
           L    +  ++ +   A  +   Q++      YAA D      L      +L    G+  +
Sbjct: 441 LDYRTTHYEEVAGKGAKQIPFSQVRIEDATPYAAEDADITLRLHEHLWPQLSAAEGQCRV 500

Query: 180 ATS-CCNFLMDRAELDLLGWE 199
                   +   + ++  G +
Sbjct: 501 YREIEMPLVPVLSRMERTGVK 521


>gi|329956362|ref|ZP_08296959.1| DNA-directed DNA polymerase [Bacteroides clarus YIT 12056]
 gi|328524259|gb|EGF51329.1| DNA-directed DNA polymerase [Bacteroides clarus YIT 12056]
          Length = 952

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 67/192 (34%), Gaps = 11/192 (5%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA----PNLVGMLVD 72
               + +++DTET G  P    L  +  S  +     + + A +  A      L  +  +
Sbjct: 375 LLTTEILSIDTETTGTEPMEAELVGMSFSDAENRAYYVPVPANRDEALKIVNELRPLYEN 434

Query: 73  EKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRT--YTNQHGLKDNLKELLGIN 130
           E   K+    ++D+ VL          +F T +A  + +     N   L +   +   I+
Sbjct: 435 ENSMKVGQNIKYDMIVLQNYGVQVKGKLFDTMLAHYVLQPELRHNMDYLAEIYLQYQTIH 494

Query: 131 ISKAQQSSDWSADDLS----DEQLQYAASDVVHLHALRLQFTEKLQRLGRSDL-ATSCCN 185
           I +   +   +  ++     ++  +YA  D      L+    ++L+      L       
Sbjct: 495 IDELIGARGKNQKNMRDLPAEDVYRYACEDADVTLKLKNVLEKELKEQSAEHLFYEIEMP 554

Query: 186 FLMDRAELDLLG 197
            +     ++  G
Sbjct: 555 LVPVLVNIESNG 566


>gi|163802211|ref|ZP_02196106.1| DNA polymerase I [Vibrio sp. AND4]
 gi|159174016|gb|EDP58826.1| DNA polymerase I [Vibrio sp. AND4]
          Length = 930

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 67/199 (33%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +  D  A DTET  L      L  V  +  +G    + +A    +AP           L
Sbjct: 347 LKASDLFAFDTETDSLDYMVTNLVGVSFATDEGVAAYVPLAHDYLDAPQQLDRDWVLEQL 406

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D+ + K+    ++D +VL             T +AS +  +   +H +       
Sbjct: 407 KPILEDDAQAKVGQNLKYDASVLARYGIEMKGIKHDTMLASYVYNSVGGKHDMDSLALRF 466

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           L  +    +Q +    + L+  Q+       YAA D      L  +    +++  +    
Sbjct: 467 LQHSCISFEQIAGKGKNQLTFNQIDLNEAAPYAAEDADVTLRLHNRLAANIEQDKKLKAV 526

Query: 181 TS--CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 527 YEEIEMPLVPVLSRIERTG 545


>gi|261343835|ref|ZP_05971480.1| ribonuclease D [Providencia rustigianii DSM 4541]
 gi|282568219|gb|EFB73754.1| ribonuclease D [Providencia rustigianii DSM 4541]
          Length = 373

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 81/192 (42%), Gaps = 6/192 (3%)

Query: 2   TTIRV--HEGDIPAEC-AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAA 58
              R+   + ++   C  A     +A+DTE +       +L ++QL  G+    I  +  
Sbjct: 1   MNYRLVTTDSELAQVCQEASDAPWLALDTEFVRTRTYYPQLGLLQLYDGNQVSLIDPLLM 60

Query: 59  GQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHG 118
              +      +L +  + K  H G  D+ V  + FG    P+  T+I +          G
Sbjct: 61  --TDFSPFKALLTNPNQLKFLHAGSEDLEVFIHDFGCVPEPMIDTQIVAAFLGYPI-SCG 117

Query: 119 LKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSD 178
               + E LGI + K++  +DW A  LS +Q  YA +DV++L  L     EK+   G  D
Sbjct: 118 FATLVVEHLGIELDKSESRTDWLARPLSAKQCDYATADVLYLLPLAKILMEKVTEAGYLD 177

Query: 179 LATSCCNFLMDR 190
            A   C  ++ R
Sbjct: 178 DAKDECQRVVAR 189


>gi|294635861|ref|ZP_06714315.1| ribonuclease D [Edwardsiella tarda ATCC 23685]
 gi|291090794|gb|EFE23355.1| ribonuclease D [Edwardsiella tarda ATCC 23685]
          Length = 376

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/193 (23%), Positives = 81/193 (41%), Gaps = 6/193 (3%)

Query: 1   MTTIRVHEGD--IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA 57
           M   ++   +  +   C  A     +A+DTE +       +L +VQL  G+    I  + 
Sbjct: 5   MLKYQLITSNSALQDVCERASAFPYVALDTEFVRTRTYYPQLGLVQLYDGETLSLIDPLP 64

Query: 58  AGQKNAPNLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH 117
               +    V +L + +  K+ H G  D+ V  + F    +P+  T+I +          
Sbjct: 65  --ISDWQPFVDLLRNPQVVKLLHAGSEDLEVFLHDFQTLPQPLIDTQILAAF-TGRPLSS 121

Query: 118 GLKDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           G    +   LG+ + K++  +DW A  LS+ Q  YAA+DV +L  +  Q   +++  G  
Sbjct: 122 GFAAMVNAYLGVELDKSESRTDWLARPLSERQCDYAAADVYYLLPMAHQLLAEVEGCGWL 181

Query: 178 DLATSCCNFLMDR 190
             A   C  L  R
Sbjct: 182 PAALDECQALCRR 194


>gi|319898087|ref|YP_004136284.1| ribonuclease d [Haemophilus influenzae F3031]
 gi|317433593|emb|CBY81977.1| ribonuclease D [Haemophilus influenzae F3031]
          Length = 380

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
            A+   A+A+DTE + +     +L ++QL  G+    I  +A    +    V +L + K 
Sbjct: 26  LAQMKSAVALDTEFMRVSTYFPKLGLIQLYDGERVSLIDPLA--ITDFSPFVALLSNPKV 83

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            KI H    D+ V    F    RP+  T+I +R     T   GL    ++ L I I K  
Sbjct: 84  LKILHSCSEDLLVFLQEFDQLPRPMIDTQIMARFLGLGT-SAGLAKLAQQYLNIEIDKGA 142

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL 187
             ++W    LSD QLQYAA DV +L  L     ++L +          C  +
Sbjct: 143 TRTNWIKRPLSDIQLQYAAGDVWYLLPLYHILEKELAKTPWEQAVRDDCELV 194


>gi|238790750|ref|ZP_04634510.1| DNA polymerase I [Yersinia frederiksenii ATCC 33641]
 gi|238721148|gb|EEQ12828.1| DNA polymerase I [Yersinia frederiksenii ATCC 33641]
          Length = 932

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 76/218 (34%), Gaps = 21/218 (9%)

Query: 11  IPAECA-ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----- 64
           +       +  +  A DTET GL      L  +  +   G    + +A    +AP     
Sbjct: 342 LADWIERLKKAEVFAFDTETDGLDTLSSNLIGLSFAVAPGEAAYLPVAHDYLDAPAQLDR 401

Query: 65  -----NLVGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGL 119
                 L  +L D+K  K+    +FD ++L           F T + S +  +   +H +
Sbjct: 402 DWVLAQLKPLLEDDKALKVGQNLKFDQSMLARYDINLRGIAFDTMLESYVLNSVAGRHDM 461

Query: 120 KDNLKELLGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQR 173
               +  L       ++ +    + L+  Q+       YAA D      L L    KLQ+
Sbjct: 462 DSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVTLQLHLVLWPKLQQ 521

Query: 174 -LGRSDLATS-CCNFLMDRAELDLLG-WENVDIF-SHS 207
             G   +        L   + ++  G   + +I  +HS
Sbjct: 522 SEGLKQVFQEIEMPLLPVLSRIERTGVLIDQNILAAHS 559


>gi|84386305|ref|ZP_00989333.1| DNA polymerase I [Vibrio splendidus 12B01]
 gi|84378729|gb|EAP95584.1| DNA polymerase I [Vibrio splendidus 12B01]
          Length = 937

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 69/199 (34%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +  +  A DTET  L      L  +  +  +G    + +A    +AP           L
Sbjct: 354 LKAAELFAFDTETDSLDYMVANLVGLSFATEEGVAAYVPVAHDYLDAPQQLDRDWVLEQL 413

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D+ + K+    ++D++VL             T +AS +  +   +H +       
Sbjct: 414 KPILEDDTQAKVGQNLKYDMSVLARYGIEMKGIKHDTMLASYVFNSVGGKHDMDSLALRF 473

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQR-LGRSDL 179
           L  +    +Q +      L+  Q++      YAA D      L  +  E +++      +
Sbjct: 474 LQHSCISFEQIAGKGKKQLTFNQIELGEASPYAAEDADVTLRLHNRLMENIEQDEKLKTI 533

Query: 180 ATS-CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 534 YEEIEVPLIPVMSRIERTG 552


>gi|190575218|ref|YP_001973063.1| putative ribonuclease D [Stenotrophomonas maltophilia K279a]
 gi|190013140|emb|CAQ46772.1| putative ribonuclease D [Stenotrophomonas maltophilia K279a]
          Length = 359

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 58/191 (30%), Positives = 83/191 (43%), Gaps = 6/191 (3%)

Query: 12  PAECAA---RYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVG 68
           PAE  A   +    I +DTE +       +L +VQ++ G   + I  +  G   A  L  
Sbjct: 8   PAELDAYFQQRPTRIGLDTEFIRERTFWPQLALVQMAVGQDILLIDPLIPGMTEA--LAH 65

Query: 69  MLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLG 128
            L DE   K+ H    D+    +  GV  RP+F T+I +          G +  + E+ G
Sbjct: 66  WLADESITKVMHSASEDLVAFRWACGVLPRPLFDTQIGA-SLAGIGGGMGYQKLVAEITG 124

Query: 129 INISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLM 188
           + ++K +  SDW    LS+ QLQYAA DV HL AL      +LQ LGR          L+
Sbjct: 125 VALAKGETRSDWMRRPLSESQLQYAADDVEHLFALHDAIDARLQALGRQQWLHDDGERLL 184

Query: 189 DRAELDLLGWE 199
                D   W 
Sbjct: 185 ASVANDEDRWP 195


>gi|86140808|ref|ZP_01059367.1| putative DNA polymerase I [Leeuwenhoekiella blandensis MED217]
 gi|85832750|gb|EAQ51199.1| putative DNA polymerase I [Leeuwenhoekiella blandensis MED217]
          Length = 948

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 63/194 (32%), Gaps = 11/194 (5%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIA----AGQKNAPNLVGMLV 71
                 ++  DTET  L P +  L  +  S        +         QK    L     
Sbjct: 370 NLMKQTSVCFDTETTDLDPLQAELVGIAFSWEKTKGFYVPFPSEKEEVQKLIEALRPFFE 429

Query: 72  DEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQH------GLKDNLKE 125
            E+ EKI    ++DI VL          +F T IA  L       +         +    
Sbjct: 430 AEEIEKIGQNLKYDIKVLAKYDVEVKGKLFDTMIAHYLINPDMRHNMDVLAETYLNYTPV 489

Query: 126 LLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATS-CC 184
            +   I K  ++    AD   D+Q +YA  D      L+  F ++L       L      
Sbjct: 490 SIEELIGKKGKNQKSMADVPVDQQTEYAVEDADVTLQLKEHFQKELGEANTQKLFDEIEI 549

Query: 185 NFLMDRAELDLLGW 198
             +   A+++L G 
Sbjct: 550 PLVQVLADMELEGI 563


>gi|307717956|ref|YP_003873488.1| DNA polymerase I [Spirochaeta thermophila DSM 6192]
 gi|38146989|gb|AAR11879.1| DNA polymerase I [Spirochaeta thermophila DSM 6578]
 gi|306531681|gb|ADN01215.1| DNA polymerase I [Spirochaeta thermophila DSM 6192]
          Length = 897

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/189 (23%), Positives = 69/189 (36%), Gaps = 11/189 (5%)

Query: 21  DAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNA-------PNLVGMLVDE 73
            A+AVDTET GL P   RL  V  +  +G    + +AA              L  +LV  
Sbjct: 327 GAVAVDTETDGLDPLTCRLVGVSFAVDEGRACYVPLAAPDVRPLPADVVREVLSPLLVST 386

Query: 74  KREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK 133
           +  K+    +FD  VL         P F T +A+ L  +   ++ L    ++ LG     
Sbjct: 387 EVVKVGQNLKFDYHVLRRWGVRPEGPFFDTMVAAWLLESDAGRYNLDRLAEKYLGWRTIH 446

Query: 134 AQQSSDWSADDLSDEQLQ---YAASDVVHLHALRLQFTEKLQRLGRSDLATS-CCNFLMD 189
            +   +  A   +    +   YAA D      L     E+L+  G   +        L  
Sbjct: 447 YKDVVEKGASFETVPVAEAGVYAAEDADIALRLSRVLKERLEAEGLGRVFYEMEMPLLSI 506

Query: 190 RAELDLLGW 198
            A ++  G 
Sbjct: 507 LARMEEWGI 515


>gi|90581061|ref|ZP_01236861.1| DNA polymerase I [Vibrio angustum S14]
 gi|90437757|gb|EAS62948.1| DNA polymerase I [Vibrio angustum S14]
          Length = 923

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 67/199 (33%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
            +   A A DTET GL      +  V  +  +G    + +A    +AP           L
Sbjct: 340 LKAAKAFAFDTETDGLDYMTANVVGVSFAIEEGKAAYVPVAHDYLDAPAQLDRDWVLEQL 399

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +L D K+ KI    +FD +++          VF T + S +  +   +H +       
Sbjct: 400 KPLLEDPKQAKIGQNLKFDASIVARYGIEMQGIVFDTMLESYVFNSVVGRHDMDSLALRY 459

Query: 127 LGINISKAQQSSDWSADDLSDEQLQ------YAASDVVHLHALRLQFTEKLQRLGRSDLA 180
           L       ++ +      L+  Q+       YAA D      L      K++   + +  
Sbjct: 460 LEHKNISFEEVAGKGKKQLTFNQIDLEQAGPYAAEDADITLRLHNTLYPKVEADDKLNHV 519

Query: 181 TS--CCNFLMDRAELDLLG 197
                   +   + ++  G
Sbjct: 520 FETIEMPLVPVLSRMERTG 538


>gi|149174964|ref|ZP_01853588.1| ribonuclease D [Planctomyces maris DSM 8797]
 gi|148846301|gb|EDL60640.1| ribonuclease D [Planctomyces maris DSM 8797]
          Length = 395

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 64/169 (37%), Gaps = 3/169 (1%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKRE 76
            R    +A DTE +     R  L ++Q +     V +        +      ++ D+   
Sbjct: 19  IRDAGIVAFDTEFVSEFTYRPELSLLQFAVNGQAVAVDPYEM--DDLSPWWDIMTDDDTV 76

Query: 77  KIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQ 136
            + H GR ++    +  G + R +   +IA  L              + L     SK  +
Sbjct: 77  IVVHGGREEVRFCRHFSGKKPRKLVDLQIAEGLRSRSFPISYTALVARVLNEKAGSKETR 136

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCN 185
           + DW    L+ +Q++YA  DV  +  +     ++L  LGR D A +   
Sbjct: 137 T-DWRRRPLTQQQIKYALDDVKFVLKIWKIQEKELIDLGRLDWAEAEFQ 184


>gi|170112858|ref|XP_001887630.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164637532|gb|EDR01817.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 854

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 63/165 (38%), Gaps = 8/165 (4%)

Query: 12  PAEC-----AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNL 66
           P E        +    IAVD E          LC++Q+S  +    I+ + A +     L
Sbjct: 248 PDELQAMLAKLKKATEIAVDLEHHSYRSYTGFLCLMQISDRENDW-IVDLLALRDEIEQL 306

Query: 67  VGMLVDEKREKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKEL 126
             +  D K  K+ H    D+  L   F V +  +F T  AS+L      +HGL + L+  
Sbjct: 307 NEIFTDPKIVKVLHGAESDVVWLQQDFNVYIVNLFDTFHASKLLD--FPRHGLANLLEMY 364

Query: 127 LGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKL 171
                 K  Q +DW    L  E L YA SD   L  +       L
Sbjct: 365 CDYIPDKRYQLADWRIRPLPQEMLDYARSDTHFLLFIYDNLRNAL 409


>gi|312882473|ref|ZP_07742214.1| ribonuclease D [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369873|gb|EFP97384.1| ribonuclease D [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 346

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 12/182 (6%)

Query: 25  VDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHYGRF 84
           +DTE +       +L ++QL  G     I        +    + +L D    K+ H    
Sbjct: 2   LDTEFVRTRTYHPQLGLIQLYDGQNLSLIDP--KVIDDMSPFIDLLKDPSVLKVLHACGE 59

Query: 85  DIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQQSSDWSADD 144
           D+ V   +FG    P+  T++ +          G    +++ L + + K++  +DW A  
Sbjct: 60  DLEVFHNSFGCLPHPMVDTQLMAAFLGHGL-STGFAALVEQYLEVELDKSESRTDWLARP 118

Query: 145 LSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFL---------MDRAELDL 195
           L+ +QL YAA+DV +L  L     EK++++G    A      L          D A LD+
Sbjct: 119 LTQKQLDYAAADVFYLKPLFSLLLEKIEQVGWWKAAQQESELLAVKRIKTIEPDLAYLDI 178

Query: 196 LG 197
            G
Sbjct: 179 KG 180


>gi|51013151|gb|AAT92869.1| YOR001W [Saccharomyces cerevisiae]
          Length = 733

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 61/162 (37%), Gaps = 3/162 (1%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
             +    IAVD E          +C++Q+S  +    ++     ++N   L  +  +   
Sbjct: 228 DLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERD-YLVDTLKLRENLHILNEVFTNPSI 286

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISKAQ 135
            K+FH    DI  L    G+ V  +F T  AS+       +H L   L+       SK  
Sbjct: 287 VKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLP--RHSLAYLLENFANFKTSKKY 344

Query: 136 QSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRS 177
           Q +DW    LS     YA +D   L  +  Q   KL    + 
Sbjct: 345 QLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKL 386


>gi|54310556|ref|YP_131576.1| DNA polymerase I [Photobacterium profundum SS9]
 gi|46914999|emb|CAG21774.1| putative DNA polymerase I [Photobacterium profundum SS9]
          Length = 937

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 65/199 (32%), Gaps = 18/199 (9%)

Query: 17  ARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAP----------NL 66
               D +A DTET  L      L  V  +  +G    + +A    +AP           L
Sbjct: 354 LTAADVVAFDTETDSLDYMTANLVGVSFAVEEGKAAYVPVAHDYLDAPEQLDRDWVL