RPSBLAST alignment for GI: 254780636 and conserved domain: PRK10829

>gnl|CDD|182762 PRK10829, PRK10829, ribonuclease D; Provisional. Length = 373
 Score = 57.3 bits (139), Expect = 3e-09
 Identities = 50/176 (28%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 16  AARYVDAIAVDTETLGLMPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKR 75
           AAR   AIA+DTE +       +L ++QL  G+  + +I        +P    +L D + 
Sbjct: 18  AARAFPAIALDTEFVRTRTYYPQLGLIQLYDGE-QLSLIDPLGITDWSP-FKALLRDPQV 75

Query: 76  EKIFHYGRFDIAVLFYTFGVRVRPVFCTKI-ASRLTRTYTNQHGLKDNLKELLGINISKA 134
            K  H G  D+ V    FG   +P+  T+I A+   R  +   G    ++E  G+ + K+
Sbjct: 76  TKFLHAGSEDLEVFLNAFGELPQPLIDTQILAAFCGRPLS--CGFASMVEEYTGVTLDKS 133

Query: 135 QQSSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLATSCCNFLMDR 190
           +  +DW A  LS+ Q +YAA+DV +L  +  +   + +  G    A   C  L  R
Sbjct: 134 ESRTDWLARPLSERQCEYAAADVFYLLPIAAKLMAETEAAGWLPAALDECRLLCQR 189