RPSBLAST alignment for GI: 254780636 and conserved domain: PRK14975

>gnl|CDD|184938 PRK14975, PRK14975, bifunctional 3'-5' exonuclease/DNA polymerase; Provisional. Length = 553
 Score = 52.3 bits (126), Expect = 1e-07
 Identities = 26/86 (30%), Positives = 35/86 (40%), Gaps = 3/86 (3%)

Query: 91  YTFGVRVRPVFCTKIASRLTRTYTN--QHGLKDNLKELLGINISKAQQSSDWSADDLSDE 148
              GVRV       +AS+L           L       LG  + K  Q+S  S D   +E
Sbjct: 63  LAAGVRVERCHDLMLASQLLLGSEGRAGSSLSAAAARALGEGLDKPPQTSALS-DPPDEE 121

Query: 149 QLQYAASDVVHLHALRLQFTEKLQRL 174
           QL YAA+D   L  L     ++L R+
Sbjct: 122 QLLYAAADADVLLELYAVLADQLNRI 147