RPSBLAST alignment of GI: 254780636 and protein with PDBid: 1x9m

>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A* Length = 698
 Score = 50.1 bits (118), Expect = 4e-07
 Identities = 34/214 (15%), Positives = 58/214 (27%), Gaps = 39/214 (18%)

Query: 23  IAVDTETLGLMPRRDRL-CIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKIFHY 81
           I  D E   L+    +  C V            R +        L   +       +FH 
Sbjct: 2   IVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGG-LIVFHN 60

Query: 82  G-RFDIAVLFYTFGVRVRP--------VFCTKIASRL------------TRTYTNQHGL- 119
           G ++D+  L     +++             T + SRL             R+      L 
Sbjct: 61  GHKYDVPALTKLAKLQLNREFHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALE 120

Query: 120 -------------KDNLKELLGINISKAQQSSDWSADDLSDEQLQYAASDVVHLHALRLQ 166
                        KD+ K +L     +     +W     ++E + Y   DVV   AL  +
Sbjct: 121 AWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWN--FNEEMMDYNVQDVVVTKALLEK 178

Query: 167 FTEKLQRLGRSDLATSCCNFLMDRAELDLLGWEN 200
                         T           L+ +  E+
Sbjct: 179 LLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEH 212