RPSBLAST alignment of GI: 254780636 and protein with PDBid: 2e6m

>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Length = 208
 Score = 92.7 bits (229), Expect = 6e-20
 Identities = 30/164 (18%), Positives = 60/164 (36%), Gaps = 4/164 (2%)

Query: 21  DAIAVDTETLGL--MPRRDRLCIVQLSPGDGTVDIIRIAAGQKNAPNLVGMLVDEKREKI 78
           D +  D E   +    +R R+ ++QL   +    +  I++       L  +L ++  +K 
Sbjct: 41  DVVGFDMEWPPIYKPGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKMLLENKSIKKA 100

Query: 79  FHYGRFDIAVLFYTFGVRVRPVFCTKIASRLTRTYTNQHGLKDNLKELLGINISK--AQQ 136
                 D   L   F V++         +           L   +K +LG  + K  + +
Sbjct: 101 GVGIEGDQWKLLRDFDVKLESFVELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDKSIR 160

Query: 137 SSDWSADDLSDEQLQYAASDVVHLHALRLQFTEKLQRLGRSDLA 180
            S+WS   L+++Q  YAA+D      +  +       +    L 
Sbjct: 161 CSNWSNFPLTEDQKLYAATDAYAGLIIYQKLGNLGDTVQVFALN 204