>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.

Probab=92.45 E-value=0.15 Score=27.47 Aligned_cols=48 Identities=13% Similarity=0.232 Sum_probs=27.7 Q ss_pred EEEEEECCCCCHHHHHHHHHHHHCCCC----------CCCCCHHHHHHCCCCCCCEEE Q ss_conf 699990798657899999999857977----------564331333102445741278 Q gi|254780640|r 52 LTIVNGQNGYGKSSLSEAIEWLFYGYT----------QRRKHGDSIKKRSIKTPMPMC 99 (110) Q Consensus 52 ~~~i~G~Ng~GKStil~ai~~~l~g~~----------~~~~~~d~i~~~s~~~pi~l~ 99 (110) T Consensus 2 Vi~lvGptGvGKTTTiaKLA~~~~~~~~kV~lit~Dt~R~gA~eQL~~~a~~l~v~~~ 59 (173) T cd03115 2 VILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGEQVGVPVF 59 (173) T ss_pred EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEE T ss_conf 9999899999889999999999997699289997488757799999999997498599

HHsearch alignment for GI: 254780640 and conserved domain: cd03115