>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt

Probab=97.35  E-value=0.00041  Score=40.35  Aligned_cols=30  Identities=33%  Similarity=0.495  Sum_probs=23.2

Q ss_pred             EEECCC-CEEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             998689-869999079865789999999985
Q gi|254780640|r   45 KIEFAD-HLTIVNGQNGYGKSSLSEAIEWLF   74 (110)
Q Consensus        45 ~i~f~~-~~~~i~G~Ng~GKStil~ai~~~l   74 (110)
T Consensus        21 sl~i~~Ge~v~i~G~sGsGKSTLl~~l~Gl~   51 (166)
T cd03223          21 SFEIKPGDRLLITGPSGTGKSSLFRALAGLW   51 (166)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHCCCC
T ss_conf             8898899999999589998899999986987