>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.

Probab=99.38 E-value=9.8e-13 Score=83.46 Aligned_cols=74 Identities=27% Similarity=0.500 Sum_probs=55.6 Q ss_pred EEEEEECEECCCCCEEEECCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCH-----HHHHHCCCCCCCEEEEEEC Q ss_conf 8999954013683179986898699990798657899999999857977564331-----3331024457412789962 Q gi|254780640|r 30 LDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKHG-----DSIKKRSIKTPMPMCMAVP 103 (110) Q Consensus 30 ~~i~i~nFr~f~~~~~i~f~~~~~~i~G~Ng~GKStil~ai~~~l~g~~~~~~~~-----d~i~~~s~~~pi~l~~~v~ 103 (110) T Consensus 2 ~~~~~~~~~~~~~~~~i~f~~~itaivG~NGaGKSTLl~~i~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (204) T cd03240 2 DKLSIRNIRSFHERSEIEFFSPLTLIVGQNGAGKTTIIEALKYALTGELPPNSKGGAHDPKLIREGEVRAQVKLAFENA 80 (204) T ss_pred CEEEEECCEECCCCCEEEEECCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHEEEEEEECC T ss_conf 6389947260277735885088899998999999999999863047722666762231603555676633056775305

HHsearch alignment for GI: 254780640 and conserved domain: cd03240