RPSBLAST alignment for GI: 254780640 and conserved domain: cd03242
>gnl|CDD|73001 cd03242, ABC_RecF, RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage. When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task. This CD represents the nucleotide binding domain of RecF. RecF belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 270
Score = 47.1 bits (112), Expect = 1e-06
Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
Query: 29 LLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRRKH 83
L +E+ +FR + E ++EF +T++ G+N GK++L EAI L G + R
Sbjct: 1 LKSLELRNFRNYAE-LELEFEPGVTVLVGENAQGKTNLLEAISLLATGKSHRTSR 54