BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780640|ref|YP_003065053.1| hypothetical protein CLIBASIA_02635 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780640|ref|YP_003065053.1| hypothetical protein CLIBASIA_02635 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 231 bits (589), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNG 60 MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNG Sbjct: 1 MTRLRKKNTCACLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIEFADHLTIVNGQNG 60 Query: 61 YGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK 110 YGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK Sbjct: 61 YGKSSLSEAIEWLFYGYTQRRKHGDSIKKRSIKTPMPMCMAVPRCKYQLK 110 >gi|254780766|ref|YP_003065179.1| recombination protein F [Candidatus Liberibacter asiaticus str. psy62] Length = 375 Score = 34.3 bits (77), Expect = 5e-04, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Query: 28 KLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRR 81 K+ + IS FR + ++ + A H TI G NG GK+++ EAI +L G RR Sbjct: 6 KIKFLNISEFRNYASLRLVFDAQH-TIFVGDNGVGKTNILEAISFLSPGRGFRR 58 >gi|255764514|ref|YP_003065586.2| DNA repair protein RecN [Candidatus Liberibacter asiaticus str. psy62] Length = 554 Score = 25.0 bits (53), Expect = 0.36, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 18/25 (72%) Query: 46 IEFADHLTIVNGQNGYGKSSLSEAI 70 I+F+ L+I++G G GKS L +A+ Sbjct: 17 IDFSAGLSILSGDTGSGKSILLDAL 41 >gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Score = 24.6 bits (52), Expect = 0.50, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Query: 28 KLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLS 67 K++D + RG K+E ++ + I+ G NG GKS+LS Sbjct: 10 KIVDTDTEIIRGLN--LKVEPSEVVAIM-GPNGSGKSTLS 46 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 22.7 bits (47), Expect = 1.9, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 18/36 (50%) Query: 12 CLSKSLTSYYARKLIFKLLDIEISHFRGFTEIQKIE 47 CL + LT K+ +L+ ++ F G I+ I+ Sbjct: 91 CLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIK 126 >gi|254780327|ref|YP_003064740.1| preprotein translocase subunit SecA [Candidatus Liberibacter asiaticus str. psy62] Length = 890 Score = 21.2 bits (43), Expect = 4.4, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 15 KSLTSYYARKLIFKLLDIEISHF 37 + L YYA+ + L+ EISH Sbjct: 19 RRLRPYYAKVIAINELEKEISHL 41 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.136 0.413 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,559 Number of Sequences: 1233 Number of extensions: 2426 Number of successful extensions: 10 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 8 length of query: 110 length of database: 328,796 effective HSP length: 63 effective length of query: 47 effective length of database: 251,117 effective search space: 11802499 effective search space used: 11802499 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 32 (16.9 bits)