RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780641|ref|YP_003065054.1| hypothetical protein CLIBASIA_02640 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 39.2 bits (90), Expect = 2e-04 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Query: 89 KTALRELQQSLQ----SRKPNM-VSAAMD 112 K AL++LQ SL+ P + + A M+ Sbjct: 19 KQALKKLQASLKLYADDSAPALAIKATME 47 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 34.9 bits (80), Expect = 0.004 Identities = 20/102 (19%), Positives = 36/102 (35%), Gaps = 42/102 (41%) Query: 23 EKGEGSFT--L-IDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFI-----HITPKNRRD 74 E EG + L I ++ Q+++Q ++ H+ P ++ Sbjct: 329 ENNEGVPSPMLSISNLT---------------------QEQVQDYVNKTNSHL-PAGKQV 366 Query: 75 KLSDILG---F---GEMTSLK---TALRELQQS---LQSRKP 104 ++S + G G SL LR+ + QSR P Sbjct: 367 EISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIP 408 >1ii8_A RAD50 ABC-ATPase; MRE11, DNA double-strand break repair, replication; 3.02A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 195 Score = 30.8 bits (68), Expect = 0.077 Identities = 16/106 (15%), Positives = 39/106 (36%), Gaps = 16/106 (15%) Query: 12 GQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQS---------------LEFFYPVV 56 G KY I R+ + GN++K + S + + Sbjct: 79 GTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYI 138 Query: 57 AQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSR 102 Q ++ + + + + R + ++L + + L EL++++ +R Sbjct: 139 RQGQIDAILE-SDEAREKVVREVLNLDKFETAYKKLSELKKTINNR 183 >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Length = 182 Score = 29.9 bits (66), Expect = 0.13 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Query: 11 DGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFF--YPVVAQKELQSFIHIT 68 D + I R+++ G S+ L + ++ I ++ Y +V Q ++ FI ++ Sbjct: 96 DEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMS 155 Query: 69 PKNRRDKLSDILGFGEMTSLKT-ALRE 94 P RR + DI G E S K AL E Sbjct: 156 PLERRLLIDDISGIAEYDSKKEKALEE 182 >1xew_X SMC protein; structural maintenance of chromosomes, ABC-atpases, condensin, cohesin, cell cycle; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1xex_A* Length = 182 Score = 28.1 bits (61), Expect = 0.49 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Query: 11 DGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFF--YPVVAQKELQSFIHIT 68 D + I R+++ G S+ L + ++ I ++ Y +V Q ++ FI ++ Sbjct: 96 DEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMS 155 Query: 69 PKNRRDKLSDILGFGEMTSLKT-ALRE 94 P RR + DI G E S K AL E Sbjct: 156 PLERRLLIDDISGIAEYDSKKEKALEE 182 >1l8n_A Alpha-D-glucuronidase; hydrolase; HET: GCW XYP; 1.50A {Geobacillus stearothermophilus} SCOP: c.1.8.10 d.92.2.2 PDB: 1k9d_A* 1mqq_A* 1mqp_A 1mqr_A* 1k9f_A* 1k9e_A* Length = 679 Score = 27.4 bits (61), Expect = 0.75 Identities = 12/56 (21%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 69 PKNRRDKLSDILGFGEMTSLKTALRELQQSLQS---RKPNMVSAAMDPLKK-CVGT 120 + R + +I+ + A+ ELQ+ L+S +P +V + +GT Sbjct: 16 DQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGT 71 >1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 1yfd_A 1piy_A 1r65_A 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A 1av8_A 1pfr_A ... Length = 375 Score = 27.0 bits (59), Expect = 1.0 Identities = 9/33 (27%), Positives = 14/33 (42%) Query: 10 LDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFK 42 D QKY I ++ EK F +++ D Sbjct: 28 YDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRI 60 >2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Length = 346 Score = 26.7 bits (58), Expect = 1.5 Identities = 6/33 (18%), Positives = 15/33 (45%) Query: 10 LDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFK 42 D +++ A +++ +F +I +D K Sbjct: 33 WDDVRFSWAYPLYKNMLANFWTPFEINMSHDAK 65 >2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A Length = 125 Score = 26.4 bits (58), Expect = 1.8 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 14/86 (16%) Query: 8 EFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHI 67 ++D M E+G + + +P+ +G + L+ F V KE+ + Sbjct: 24 LWVD----RYLTFMEERG----SPVSSLPA------VGKKPLDLFRLYVCVKEIGGLAQV 69 Query: 68 TPKNRRDKLSDILGFGEMTSLKTALR 93 + +L+ L G +S ++L+ Sbjct: 70 NKNKKWRELATNLNVGTSSSAASSLK 95 >1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Score = 25.7 bits (55), Expect = 2.6 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 54 PVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALREL 95 PVV ++E + F+ P+ RD D +G E+ L+E+ Sbjct: 21 PVVVEREREEFVGFFPQIVRDLTEDGIGHPEVGDAVARLKEV 62 >2gn0_A Threonine dehydratase catabolic; TDCB, biodegradative threonine deaminase, PLP, L-threonine metabolism, alternate conformation lyase; HET: LLP; 1.70A {Salmonella typhimurium} PDB: 2gn1_A* 2gn2_A* Length = 342 Score = 25.7 bits (55), Expect = 2.8 Identities = 7/25 (28%), Positives = 11/25 (44%) Query: 57 AQKELQSFIHITPKNRRDKLSDILG 81 A+K L I+ T R + S+ Sbjct: 30 AKKRLAGKIYKTGMPRSNYFSERCK 54 >3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Length = 346 Score = 24.5 bits (52), Expect = 6.3 Identities = 7/25 (28%), Positives = 12/25 (48%) Query: 57 AQKELQSFIHITPKNRRDKLSDILG 81 A ++ IH+TP L+ + G Sbjct: 15 AHINIRDSIHLTPVLTSSILNQLTG 39 >1tlq_A Hypothetical protein YPJQ; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.40A {Bacillus subtilis} SCOP: a.195.1.1 Length = 189 Score = 24.0 bits (52), Expect = 8.2 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 9 FLDGQKYTIARQMHEKGEGSFTLIDDIPSG 38 +LD +K I +++ E +G T +DDI + Sbjct: 120 YLDKEKIGIIKELDESPDGIHTFLDDIVAA 149 >1slq_A VP4; beta sandwich, greek KEY, alpha helical triple coiled-coil, membrane penetration protein, non-enveloped virus, spike protein; 3.20A {Rhesus rotavirus} SCOP: f.47.1.1 Length = 278 Score = 24.0 bits (52), Expect = 9.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 27 GSFTLIDDIPSGNDFKT 43 G F+LI +PS +D++T Sbjct: 219 GRFSLISLVPSNDDYQT 235 >2wb6_A AFV1-102; archaeal virus, viral protein; 1.95A {Acidianus filamentous virus 1} Length = 130 Score = 23.9 bits (51), Expect = 9.9 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 5/92 (5%) Query: 8 EFLDGQKYTIAR-QMHEKGEGSFTLID-DIPSGNDFKTIGAQSLEFFYPVVAQKELQSFI 65 EFLD I + +H + +GS + + D+K +GA + ++ + L SFI Sbjct: 42 EFLDSMFLVIEKLGVHAEKKGSMIFLSSERVKLADWKQLGAMCSDCYH---CKLPLSSFI 98 Query: 66 HITPKNRRDKLSDILGFGEMTSLKTALRELQQ 97 I + +DK + E+T + ++ +Q+ Sbjct: 99 EIVTRKAKDKFLVMYNEKEVTLVARGVQTIQK 130 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.318 0.134 0.372 Gapped Lambda K H 0.267 0.0456 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 975,494 Number of extensions: 40014 Number of successful extensions: 104 Number of sequences better than 10.0: 1 Number of HSP's gapped: 104 Number of HSP's successfully gapped: 20 Length of query: 121 Length of database: 5,693,230 Length adjustment: 81 Effective length of query: 40 Effective length of database: 3,729,466 Effective search space: 149178640 Effective search space used: 149178640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.7 bits)