RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780641|ref|YP_003065054.1| hypothetical protein CLIBASIA_02640 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) >d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Length = 348 Score = 26.9 bits (58), Expect = 0.54 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 54 PVVAQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALREL 95 PVV ++E + F+ P+ RD D +G E+ L+E+ Sbjct: 2 PVVVEREREEFVGFFPQIVRDLTEDGIGHPEVGDAVARLKEV 43 >d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} Length = 339 Score = 26.3 bits (57), Expect = 0.85 Identities = 9/33 (27%), Positives = 14/33 (42%) Query: 10 LDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFK 42 D QKY I ++ EK F +++ D Sbjct: 28 YDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRI 60 >d1h41a2 d.92.2.2 (A:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa [TaxId: 155077]} Length = 147 Score = 25.3 bits (55), Expect = 1.5 Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 70 KNRRDKLSDILGFGEMTSLKTALRELQQSLQS---RKPNMVSAAMDPLKKCVGT 120 K + ++ + G+ ++ A ELQ+ L + + +GT Sbjct: 20 KTYQKQIRHLHVAGDSPTINAAAAELQRGLSGLLNKPIVARDEKLKDYSLVIGT 73 >d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Score = 25.0 bits (53), Expect = 1.9 Identities = 7/25 (28%), Positives = 11/25 (44%) Query: 57 AQKELQSFIHITPKNRRDKLSDILG 81 A + + + H TP L +LG Sbjct: 9 AFRRIAPYTHRTPLLTSRLLDGLLG 33 >d1slqa_ f.47.1.1 (A:) VP4 membrane interaction domain {Rhesus rotavirus [TaxId: 10969]} Length = 270 Score = 24.7 bits (54), Expect = 2.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 27 GSFTLIDDIPSGNDFKTIGAQS 48 G F+LI +PS +D++T S Sbjct: 214 GRFSLISLVPSNDDYQTPITNS 235 >d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Score = 24.1 bits (51), Expect = 3.2 Identities = 4/25 (16%), Positives = 10/25 (40%) Query: 57 AQKELQSFIHITPKNRRDKLSDILG 81 A + ++ F + TP ++ Sbjct: 11 ASERIKKFANKTPVLTSSTVNKEFV 35 >d1l8na2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 139 Score = 24.2 bits (52), Expect = 3.7 Identities = 10/50 (20%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Query: 69 PKNRRDKLSDILGFGEMTSLKTALRELQQSLQS---RKPNMVSAAMDPLK 115 + R + +I+ + A+ ELQ+ L+S +P +V + Sbjct: 13 DQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETAN 62 >d1u04a1 b.34.14.1 (A:2-323) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]} Length = 322 Score = 22.8 bits (49), Expect = 8.7 Identities = 7/57 (12%), Positives = 19/57 (33%), Gaps = 16/57 (28%) Query: 59 KELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLK 115 KE+ + + P+ R++ L + + S + + ++ K Sbjct: 282 KEILEYTKLMPEERKEL----------------LENILAEVDSDIIDKSLSEIEVEK 322 >d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Score = 22.9 bits (49), Expect = 9.0 Identities = 14/88 (15%), Positives = 34/88 (38%), Gaps = 14/88 (15%) Query: 8 EFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHI 67 ++D EK + ++P +G + L+ + V+ KE+ + Sbjct: 23 MWVD----RYLAFTEEKA----MGMTNLP------AVGRKPLDLYRLYVSVKEIGGLTQV 68 Query: 68 TPKNRRDKLSDILGFGEMTSLKTALREL 95 + +L+ L G +S ++L++ Sbjct: 69 NKNKKWRELATNLNVGTSSSAASSLKKQ 96 >d1x9ya2 d.17.1.4 (A:41-211) Staphopain B, prodomain {Staphylococcus aureus [TaxId: 1280]} Length = 171 Score = 22.6 bits (48), Expect = 9.2 Identities = 13/59 (22%), Positives = 25/59 (42%), Gaps = 9/59 (15%) Query: 20 QMHEKGEGSFTLIDDIPSGNDFKTI---GAQSLEFFYPVVAQKELQSFIHITPKNRRDK 75 + G + L G FK G + ++YPV+ ++ + ++PKN+ D Sbjct: 33 KQSNAKTGKYEL------GEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDL 85 >d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Score = 22.8 bits (49), Expect = 9.8 Identities = 7/41 (17%), Positives = 16/41 (39%), Gaps = 11/41 (26%) Query: 57 AQKELQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQ 97 A + L +F ++ + LK L+++Q+ Sbjct: 19 AVQYLNTFYGCPKESCN-----------LFVLKDTLKKMQK 48 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.134 0.372 Gapped Lambda K H 0.267 0.0590 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 419,714 Number of extensions: 17155 Number of successful extensions: 47 Number of sequences better than 10.0: 1 Number of HSP's gapped: 47 Number of HSP's successfully gapped: 16 Length of query: 121 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 46 Effective length of database: 1,377,846 Effective search space: 63380916 Effective search space used: 63380916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.2 bits)