BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780641|ref|YP_003065054.1| hypothetical protein CLIBASIA_02640 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780641|ref|YP_003065054.1| hypothetical protein CLIBASIA_02640 [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Score = 251 bits (641), Expect = 3e-69, Method: Compositional matrix adjust. Identities = 121/121 (100%), Positives = 121/121 (100%) Query: 1 MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKE 60 MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKE Sbjct: 1 MQISAKIEFLDGQKYTIARQMHEKGEGSFTLIDDIPSGNDFKTIGAQSLEFFYPVVAQKE 60 Query: 61 LQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGT 120 LQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGT Sbjct: 61 LQSFIHITPKNRRDKLSDILGFGEMTSLKTALRELQQSLQSRKPNMVSAAMDPLKKCVGT 120 Query: 121 R 121 R Sbjct: 121 R 121 >gi|254780578|ref|YP_003064991.1| phosphatidylserine synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 298 Score = 24.6 bits (52), Expect = 0.53, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 74 DKLSDILGFGEMTSLKTALRELQQS 98 D L+D++ FG SL T + L+Q+ Sbjct: 116 DSLADVINFGVAPSLVTYIAVLRQA 140 >gi|254780617|ref|YP_003065030.1| F0F1 ATP synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Score = 23.1 bits (48), Expect = 1.4, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 64 FIHITPKNRRDKLSDILGFGEMTSL 88 ++H R K+SD LG G +T+L Sbjct: 300 YLHSRLLERAAKMSDALGAGSLTAL 324 >gi|254780891|ref|YP_003065304.1| hypothetical protein CLIBASIA_03940 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 22.3 bits (46), Expect = 2.6, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 13/61 (21%) Query: 12 GQKYTIARQMHEKGEGSFTL------------IDDIPSGNDFKTIGAQSLEFFYPVVAQK 59 G K TI+ Q K E F+L I GN TI + ++F+Y ++ Sbjct: 133 GGKVTISVQ-DSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAH 191 Query: 60 E 60 E Sbjct: 192 E 192 >gi|255764470|ref|YP_003064828.2| integral membrane protein TerC [Candidatus Liberibacter asiaticus str. psy62] Length = 523 Score = 22.3 bits (46), Expect = 3.0, Method: Compositional matrix adjust. Identities = 12/45 (26%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 34 DIPSGNDFKTIGAQSLEFFYPVVAQKELQSFIHITPKNRRDKLSD 78 DIP G + +IG + F+ VA++ + ++P R + +D Sbjct: 212 DIPKGYLYASIGFSGIIEFFNQVARRNREQL--MSPSRLRARTAD 254 >gi|254780420|ref|YP_003064833.1| carbamoyl phosphate synthase small subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 21.9 bits (45), Expect = 3.2, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 12/23 (52%) Query: 66 HITPKNRRDKLSDILGFGEMTSL 88 H+T RRD I +GE TS Sbjct: 176 HVTVSQRRDWSEKIWKWGEETSF 198 >gi|254780250|ref|YP_003064663.1| 50S ribosomal protein L24 [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Score = 20.8 bits (42), Expect = 8.2, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 2 QISAKIEFLDGQKYTIARQMHE 23 Q+ F+DG+K IA++ E Sbjct: 77 QVRVGFSFVDGKKIRIAKRSGE 98 >gi|254780698|ref|YP_003065111.1| D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 336 Score = 20.4 bits (41), Expect = 9.8, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 1 MQISAKIEFLDGQKYTIARQMHEKGEGSFTLID 33 +Q+ KI FL ++A ++H K + S +ID Sbjct: 28 IQLMGKILFLSIIMISMASELHAKPKYSSIVID 60 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.134 0.372 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,368 Number of Sequences: 1233 Number of extensions: 2510 Number of successful extensions: 13 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 9 length of query: 121 length of database: 328,796 effective HSP length: 64 effective length of query: 57 effective length of database: 249,884 effective search space: 14243388 effective search space used: 14243388 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 33 (17.3 bits)