RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780645|ref|YP_003065058.1| hypothetical protein CLIBASIA_02660 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|149985 pfam09127, Leuk-A4-hydro_C, Leukotriene A4 hydrolase, C-terminal. Members of this family adopt a structure consisting of two layers of parallel alpha-helices, five in the inner layer and four in the outer, arranged in an antiparallel manner, with perpendicular loops containing short helical segments on top. They are required for the formation of a deep cleft harbouring the catalytic Zn2+ site in Leukotriene A4 hydrolase. Length = 143 Score = 27.2 bits (61), Expect = 0.98 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 53 FLRKLSEKESISIPGSIKARKNCWNLSTSTGAYLRIR 89 FL +L E++ + +KA + LS S A +R R Sbjct: 39 FLDRLLEEKPLP-LEQVKALDEVYKLSNSKNAEIRFR 74 >gnl|CDD|129217 TIGR00111, pelota, probable translation factor pelota. This model describes the Drosophila protein Pelota, the budding yeast protein DOM34 which it can replace, and a set of closely related archaeal proteins. Members contain a proposed RNA binding motif. The meiotic defect in pelota mutants may be a complex result of a protein translation defect, as suggested in yeast by ribosomal protein RPS30A being a multicopy suppressor and by an altered polyribosome profile in DOM34 mutants rescued by RPS30A. This family is homologous to a family of peptide chain release factors. Pelota is proposed to act in protein translation. Length = 351 Score = 26.3 bits (58), Expect = 1.6 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Query: 26 DLNHIRQIINEGDFKSAAVKMRILVESFLRKLSEKESISIPGSIKARKNCWNLSTSTGAY 85 DL H+ QII +GD + A K R +R K+++ + I+ +++ T Sbjct: 24 DLWHLYQIIEKGDVEFAFTKRRTQDLDKIRSDKSKDTVKL--GIEVESVEFDMKTE---R 78 Query: 86 LRIRG 90 LR +G Sbjct: 79 LRYKG 83 >gnl|CDD|185041 PRK15083, PRK15083, PTS system mannitol-specific transporter subunit IICBA; Provisional. Length = 639 Score = 25.8 bits (57), Expect = 2.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 12 SKGAQVKENLGLQKDLNHIRQII 34 SKGA + DL+H+R+II Sbjct: 360 SKGASPLAAGDVTNDLSHVRKII 382 >gnl|CDD|181878 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed. Length = 777 Score = 25.5 bits (57), Expect = 2.8 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 18/49 (36%) Query: 47 RILVESFLRKLSEKESISIP----GSIK--ARKNCWNLSTSTGAYLRIR 89 R+L+E LS IS+P G K A +TGAY RIR Sbjct: 323 RMLMEC----LSVGRGISLPSNSTGGAKLAAL--------ATGAYARIR 359 >gnl|CDD|184338 PRK13805, PRK13805, bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional. Length = 862 Score = 24.4 bits (54), Expect = 6.4 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Query: 49 LVESFLRKLSE-KESISIPGSIKA 71 VES ++ + E K + IP SIK Sbjct: 794 KVESLIKAIEELKAELGIPMSIKE 817 >gnl|CDD|149560 pfam08547, CIA30, Complex I intermediate-associated protein 30 (CIA30). This protein is associated with mitochondrial Complex I intermediate-associated protein 30 (CIA30) in human and mouse. The family is also present in Schizosaccharomyces pombe which does not contain the NADH dehydrogenase component of complex I, or many of the other essential subunits. This means it is possible that this family of protein may not be directly involved in oxidative phosphorylation. Length = 161 Score = 24.5 bits (54), Expect = 7.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 70 KARKNCWNLSTSTGAYLRIRG 90 K RK +LS TG LR++G Sbjct: 56 KNRKPPLDLSGYTGLELRVKG 76 >gnl|CDD|177973 PLN02339, PLN02339, NAD+ synthase (glutamine-hydrolysing). Length = 700 Score = 23.9 bits (52), Expect = 9.8 Identities = 10/27 (37%), Positives = 12/27 (44%) Query: 8 PSKKSKGAQVKENLGLQKDLNHIRQII 34 P K G ENL LQ IR ++ Sbjct: 466 PRYKVDGGSNAENLALQNIQARIRMVL 492 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.131 0.371 Gapped Lambda K H 0.267 0.0706 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,363,804 Number of extensions: 68756 Number of successful extensions: 148 Number of sequences better than 10.0: 1 Number of HSP's gapped: 148 Number of HSP's successfully gapped: 14 Length of query: 91 Length of database: 5,994,473 Length adjustment: 59 Effective length of query: 32 Effective length of database: 4,719,601 Effective search space: 151027232 Effective search space used: 151027232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.1 bits)