RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780645|ref|YP_003065058.1| hypothetical protein CLIBASIA_02660 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >3oby_A Protein pelota homolog; SM fold, hydrolase; 2.90A {Archaeoglobus fulgidus} Length = 352 Score = 28.8 bits (64), Expect = 0.30 Identities = 18/65 (27%), Positives = 26/65 (40%), Gaps = 5/65 (7%) Query: 26 DLNHIRQIINEGDFKSAAVKMRILVESFLRKLSEKESISIPGSIKARKNCWNLSTSTGAY 85 DL H+R II +GD A K LR E ++ + I+ K + Sbjct: 24 DLWHLRFIIEKGDVVFATTKRASQSSDKLRSDKEMVTVRL--GIEVEKVEF---HRFANR 78 Query: 86 LRIRG 90 LR+ G Sbjct: 79 LRVSG 83 >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding, GET5, GET4; 1.99A {Saccharomyces cerevisiae} Length = 312 Score = 27.5 bits (61), Expect = 0.75 Identities = 15/72 (20%), Positives = 26/72 (36%), Gaps = 3/72 (4%) Query: 18 KENLGLQKDLNHIRQIINEGDFKSAAVKMRILVESFLRKLSEKESISI--PGSIK-ARKN 74 L K L I GD+ A +R + ++R S + +I + G++ + Sbjct: 8 AVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAK 67 Query: 75 CWNLSTSTGAYL 86 T YL Sbjct: 68 QGGSGTDLIFYL 79 >1hw4_A TS, thymidylate synthase; methyltransferase; HET: CME; 2.06A {Homo sapiens} SCOP: d.117.1.1 Length = 355 Score = 26.1 bits (57), Expect = 2.1 Identities = 9/35 (25%), Positives = 17/35 (48%) Query: 7 PPSKKSKGAQVKENLGLQKDLNHIRQIINEGDFKS 41 PP+ + + A+ + G + L I+ I+ G K Sbjct: 56 PPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKD 90 >2a3l_A AMP deaminase, AMPD; atampd, AT2G38280, adenosine 5'-monophosphate deaminase, coformycin 5'-phosphate, structural genomics; HET: CF5; 3.34A {Arabidopsis thaliana} SCOP: c.1.9.1 Length = 701 Score = 25.7 bits (56), Expect = 2.8 Identities = 7/30 (23%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 25 KDLNHIRQIINEGDFKSAAVK-MRILVESF 53 DL+H+ ++I G+ ++ + + +L + F Sbjct: 192 TDLHHVLKVIAAGNIRTLCHRRLVLLEQKF 221 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 24.8 bits (53), Expect = 5.0 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Query: 39 FKSAAVKMRILVESFLRKLSEKES---ISIPGSIK 70 FK V+ IL ESF+ +S + IS G IK Sbjct: 1066 FKDEPVQNDILQESFINTMSAWVNMLLISSSGPIK 1100 >1nm8_A Carnitine O-acetyltransferase; two equally sized domains, anti-parallel beta-strand; 1.60A {Homo sapiens} SCOP: c.43.1.3 c.43.1.3 PDB: 1s5o_A* 2h3u_A* 2h3p_A* 1t7q_A* 1t7n_A 1t7o_A* 1ndb_A 1ndf_A* 1ndi_A* 2h3w_A* Length = 616 Score = 24.2 bits (52), Expect = 7.3 Identities = 8/33 (24%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Query: 54 LRKLSEKESISIPG----SIKARKNCWNLSTST 82 L+ + ++ +S P + A ++LSTS Sbjct: 502 LKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQ 534 >3dma_A Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis} Length = 343 Score = 23.9 bits (50), Expect = 9.1 Identities = 4/22 (18%), Positives = 9/22 (40%) Query: 44 VKMRILVESFLRKLSEKESISI 65 V + ++ F + + I I Sbjct: 5 VIAQAHIDHFTKWFERADKIVI 26 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.316 0.131 0.371 Gapped Lambda K H 0.267 0.0548 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 736,683 Number of extensions: 26837 Number of successful extensions: 90 Number of sequences better than 10.0: 1 Number of HSP's gapped: 90 Number of HSP's successfully gapped: 16 Length of query: 91 Length of database: 5,693,230 Length adjustment: 58 Effective length of query: 33 Effective length of database: 4,287,078 Effective search space: 141473574 Effective search space used: 141473574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.4 bits)