RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780646|ref|YP_003065059.1| 50S ribosomal protein L21 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >d2qamr1 b.155.1.1 (R:1-103) Ribosomal protein L21p {Escherichia coli [TaxId: 562]} Length = 103 Score = 112 bits (281), Expect = 1e-26 Identities = 43/101 (42%), Positives = 63/101 (62%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAVGKDEHLSVGTPRVEGAYVE 60 M+A+ + GGKQ RVS T+ +EK+ G+ + F VL + E + +G P V+G ++ Sbjct: 1 MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMIANGEEVKIGVPFVDGGVIK 60 Query: 61 AEVVKQLRTKKVVVFKKRRRQNYRRTHGHRQEMTVVRITSI 101 AEVV R +KV + K RRR++YR+ GHRQ T V+IT I Sbjct: 61 AEVVAHGRGEKVKIVKFRRRKHYRKQQGHRQWFTDVKITGI 101 >d2j01v1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} Length = 101 Score = 104 bits (262), Expect = 2e-24 Identities = 45/101 (44%), Positives = 58/101 (57%), Gaps = 2/101 (1%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAVGKDEHLSVGTPRVEGAYVE 60 MFAI++ GGKQ RV + VEK+ A+ G + +L G E VGTP VEGA V Sbjct: 1 MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGG--EKTVVGTPVVEGASVV 58 Query: 61 AEVVKQLRTKKVVVFKKRRRQNYRRTHGHRQEMTVVRITSI 101 AEV+ R KK++V K + + YRR GHRQ T + I I Sbjct: 59 AEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEI 99 >d2zjro1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]} Length = 94 Score = 91.0 bits (226), Expect = 2e-20 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 3/97 (3%) Query: 5 IEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAVGKDEHLSVGTPRVEGAYVEAEVV 64 I+ GGKQ RVS D I VE + + GD + + G+ V+AEVV Sbjct: 1 IQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTV---FGEDAGKYTVQAEVV 57 Query: 65 KQLRTKKVVVFKKRRRQNYRRTHGHRQEMTVVRITSI 101 + R KK+ + K + YRR GHRQ T ++I I Sbjct: 58 EHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGI 94 >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 Score = 31.5 bits (71), Expect = 0.022 Identities = 11/41 (26%), Positives = 20/41 (48%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 I+E +++ A + TV+ I+ + G + FD L V Sbjct: 38 TLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVV 78 >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Score = 26.6 bits (59), Expect = 0.54 Identities = 4/41 (9%), Positives = 13/41 (31%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 + +++ + + V +I+ +G L Sbjct: 34 VLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLIT 74 >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Score = 25.9 bits (57), Expect = 0.82 Identities = 6/39 (15%), Positives = 16/39 (41%) Query: 3 AIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 +E V A V+++ GD ++ +++ + Sbjct: 35 ITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMI 73 >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Score = 25.5 bits (56), Expect = 1.2 Identities = 6/41 (14%), Positives = 15/41 (36%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 + IE V A+ ++ ++ +G + +L Sbjct: 35 VLVEIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGR 75 >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Score = 25.5 bits (56), Expect = 1.3 Identities = 3/41 (7%), Positives = 11/41 (26%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 ++ +++ ++K+ D L Sbjct: 37 SICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVD 77 >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Score = 24.4 bits (53), Expect = 2.8 Identities = 9/41 (21%), Positives = 15/41 (36%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 + IE V A + +IV +GD + +L Sbjct: 34 LIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGK 74 >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Score = 24.0 bits (52), Expect = 4.1 Identities = 9/39 (23%), Positives = 15/39 (38%) Query: 3 AIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 +E V A V+++ K GD I ++ V Sbjct: 36 ITLETDKATMDVPAEVAGVVKEVKVKVGDKISEGGLIVV 74 >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Score = 23.7 bits (51), Expect = 4.5 Identities = 8/39 (20%), Positives = 19/39 (48%) Query: 3 AIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAV 41 ++E ++ ++A VEK++ K+ D ++ L Sbjct: 37 LVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIK 75 >d2qkwa1 a.8.8.1 (A:29-129) Avirulence protein AvrPto {Pseudomonas syringae [TaxId: 317]} Length = 101 Score = 23.6 bits (50), Expect = 5.1 Identities = 12/50 (24%), Positives = 24/50 (48%) Query: 31 DNIRFDNVLAVGKDEHLSVGTPRVEGAYVEAEVVKQLRTKKVVVFKKRRR 80 DN+ +L+V S G PR + +V ++ + LR + ++ +R Sbjct: 1 DNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQR 50 >d1j1ta_ b.29.1.18 (A:) Alginate lyase {Alteromonas sp. [TaxId: 232]} Length = 228 Score = 22.4 bits (47), Expect = 9.9 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 16/67 (23%) Query: 8 GGKQ--SRVSATDTITVEKIVAKDGDNIRFDNVLA--------------VGKDEHLSVGT 51 GGK S+ A+DT T+ K+ D D F++ +A G +E ++GT Sbjct: 78 GGKTIISQHHASDTGTISKVYVSDTDESGFNDSVANNGIFDVYVRLRNTSGNEEKFALGT 137 Query: 52 PRVEGAY 58 + Sbjct: 138 MTSGETF 144 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.133 0.363 Gapped Lambda K H 0.267 0.0639 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 367,798 Number of extensions: 15263 Number of successful extensions: 47 Number of sequences better than 10.0: 1 Number of HSP's gapped: 45 Number of HSP's successfully gapped: 22 Length of query: 103 Length of database: 2,407,596 Length adjustment: 64 Effective length of query: 39 Effective length of database: 1,528,876 Effective search space: 59626164 Effective search space used: 59626164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.1 bits)