BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780646|ref|YP_003065059.1| 50S ribosomal protein L21 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780646|ref|YP_003065059.1| 50S ribosomal protein L21 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 206 bits (524), Expect = 7e-56, Method: Compositional matrix adjust. Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAVGKDEHLSVGTPRVEGAYVE 60 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAVGKDEHLSVGTPRVEGAYVE Sbjct: 1 MFAIIEHGGKQSRVSATDTITVEKIVAKDGDNIRFDNVLAVGKDEHLSVGTPRVEGAYVE 60 Query: 61 AEVVKQLRTKKVVVFKKRRRQNYRRTHGHRQEMTVVRITSIVT 103 AEVVKQLRTKKVVVFKKRRRQNYRRTHGHRQEMTVVRITSIVT Sbjct: 61 AEVVKQLRTKKVVVFKKRRRQNYRRTHGHRQEMTVVRITSIVT 103 >gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Score = 23.9 bits (50), Expect = 0.63, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Query: 15 SATDTITVEKIVAKDGDNIRFDNVLAVGKDEHLSVG 50 SA D T++ + G+N + DN + +G + H+ G Sbjct: 231 SAIDRGTIDDTII--GENTKIDNQVQIGHNVHIGCG 264 >gi|254781213|ref|YP_003065626.1| head-to-tail joining protein, putative [Candidatus Liberibacter asiaticus str. psy62] Length = 556 Score = 21.9 bits (45), Expect = 2.6, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Query: 19 TITVEKIVAKDGDNI---RFDNVLAVGKDEHLSV 49 T TV++IV+K GD + + + LA ++E ++ Sbjct: 180 TFTVDQIVSKWGDKVLSSKMKSALARNENERFTI 213 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 21.6 bits (44), Expect = 3.4, Method: Composition-based stats. Identities = 5/15 (33%), Positives = 13/15 (86%) Query: 81 QNYRRTHGHRQEMTV 95 Q+Y+++H H++E+ + Sbjct: 124 QDYKQSHQHKEEVAL 138 >gi|254780454|ref|YP_003064867.1| DNA polymerase III subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 385 Score = 20.8 bits (42), Expect = 6.3, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 19/44 (43%) Query: 29 DGDNIRFDNVLAVGKDEHLSVGTPRVEGAYVEAEVVKQLRTKKV 72 DG+ + NV+ D+ L V + A ++ +R + V Sbjct: 243 DGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAV 286 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.133 0.363 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,181 Number of Sequences: 1233 Number of extensions: 1906 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 103 length of database: 328,796 effective HSP length: 62 effective length of query: 41 effective length of database: 252,350 effective search space: 10346350 effective search space used: 10346350 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 32 (16.9 bits)