BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780647|ref|YP_003065060.1| 50S ribosomal protein L27 [Candidatus Liberibacter asiaticus str. psy62] (90 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780647|ref|YP_003065060.1| 50S ribosomal protein L27 [Candidatus Liberibacter asiaticus str. psy62] Length = 90 Score = 182 bits (461), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 90/90 (100%), Positives = 90/90 (100%) Query: 1 MAHKKSGGSTQNGRDSAGQRLGLKKSGGQSVIAGNIIIRQRGTRYHPGLNVGLGKDHTIY 60 MAHKKSGGSTQNGRDSAGQRLGLKKSGGQSVIAGNIIIRQRGTRYHPGLNVGLGKDHTIY Sbjct: 1 MAHKKSGGSTQNGRDSAGQRLGLKKSGGQSVIAGNIIIRQRGTRYHPGLNVGLGKDHTIY 60 Query: 61 ALVDGHVRFFKKFSKGRAYVSVIPKIEDTQ 90 ALVDGHVRFFKKFSKGRAYVSVIPKIEDTQ Sbjct: 61 ALVDGHVRFFKKFSKGRAYVSVIPKIEDTQ 90 >gi|254780376|ref|YP_003064789.1| flagellar basal body P-ring protein [Candidatus Liberibacter asiaticus str. psy62] Length = 369 Score = 22.3 bits (46), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 53 LGKDHTIYALVDGHVRFFKKFSKGRA 78 LG D IYA+ G V F KG++ Sbjct: 130 LGADGNIYAVAQGSVVVSGLFVKGQS 155 >gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62] Length = 581 Score = 22.3 bits (46), Expect = 1.7, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Query: 62 LVDGHVRFFKKFSKGRAYVSVIP 84 L DGH R+ KFS ++++P Sbjct: 278 LSDGHARYQAKFSANE--ITILP 298 >gi|254780627|ref|YP_003065040.1| chromosomal replication initiation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Score = 21.2 bits (43), Expect = 3.3, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 50 NVGLGKDHTIYALVDGHVR 68 +VGLGK H + A+ + ++ Sbjct: 204 SVGLGKTHLLQAIANASIK 222 >gi|255764513|ref|YP_003065530.2| glutamyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 20.8 bits (42), Expect = 4.6, Method: Composition-based stats. Identities = 6/24 (25%), Positives = 14/24 (58%) Query: 62 LVDGHVRFFKKFSKGRAYVSVIPK 85 ++D H+ ++G ++S +PK Sbjct: 203 VIDDHLMKITHVARGEEWISSVPK 226 >gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 12 NGRDSAGQRLGLKKSGGQ 29 NG D+ GLK SGG+ Sbjct: 481 NGYDTVVGERGLKLSGGE 498 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.137 0.397 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,143 Number of Sequences: 1233 Number of extensions: 2395 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 90 length of database: 328,796 effective HSP length: 58 effective length of query: 32 effective length of database: 257,282 effective search space: 8233024 effective search space used: 8233024 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)