HHsearch alignment for GI: 254780648 and conserved domain: COG0050

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis].
Probab=97.77  E-value=6.2e-05  Score=49.73  Aligned_cols=150  Identities=24%  Similarity=0.278  Sum_probs=80.3

Q ss_pred             EEEECEEEEECCCCCCCEEEEEECCCCCH-----------HHHHH-----HCCCEECCEEEEECCEEEEEECCCCC----
Q ss_conf             76301124421677753035410145401-----------21211-----00000010266329868998226421----
Q gi|254780648|r  157 KLIADIGIIGLPNAGKSTFLASVTRAKPK-----------IADYP-----FTTLYPNLGIVKEGYKEFILADIPGI----  216 (335)
Q Consensus       157 k~iaDVglVG~PNaGKSTLln~ls~ak~k-----------Ia~yp-----FTT~~P~lGvv~~~~~~~~i~D~PGl----  216 (335)
T Consensus        10 kphVNigtiGHvdHGKTTLtaAit~~la~~~~~~~~~y~~id~aPeEk~rGITIntahveyet~~rhyahVDcPGHaDYv   89 (394)
T COG0050          10 KPHVNVGTIGHVDHGKTTLTAAITTVLAKKGGAEAKAYDQIDNAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYV   89 (394)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCHHHHCCCEECCCEEEEECCCCEEEECCCCCHHHHH
T ss_conf             87147878614247635289999999986324010333443048267645725401005886388148861689748999


Q ss_pred             ---CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEE-EEEECCCCCCHHHHHHH
Q ss_conf             ---24731167751234433333578875202222110134666789987776675059889-99974658998899999
Q gi|254780648|r  217 ---IKNAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEI-VGLSQIDTVDSDTLARK  292 (335)
Q Consensus       217 ---IegA~~~~glG~~FLrhIer~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~I-IVlNKiDl~~~e~~~~~  292 (335)
T Consensus        90 KNMItgAaqmD--------------gAILVVsA~dG-pmPqT--rEHiLl--arq-vGvp~ivvflnK~Dmvdd~ellel  149 (394)
T COG0050          90 KNMITGAAQMD--------------GAILVVAATDG-PMPQT--REHILL--ARQ-VGVPYIVVFLNKVDMVDDEELLEL  149 (394)
T ss_pred             HHHHHHHHHCC--------------CCEEEEECCCC-CCCCC--HHHHHH--HHH-CCCCEEEEEEECCCCCCCHHHHHH
T ss_conf             98764077537--------------62899984789-99860--564201--234-288579999742236686899999


Q ss_pred             H----HHHHHHCC-----CCEEEEECCCC-CC-------HHHHHHHHHHHH
Q ss_conf             9----99998629-----94899988878-89-------999999999999
Q gi|254780648|r  293 K----NELATQCG-----QVPFEFSSITG-HG-------IPQILECLHDKI  326 (335)
Q Consensus       293 ~----~~l~~~~~-----~~vi~ISA~tg-~G-------I~eL~~~I~e~L  326 (335)
T Consensus       150 VemEvreLLs~y~f~gd~~Pii~gSal~ale~~~~~~~~i~eLm~avd~yi  200 (394)
T COG0050         150 VEMEVRELLSEYGFPGDDTPIIRGSALKALEGDAKWEAKIEELMDAVDSYI  200 (394)
T ss_pred             HHHHHHHHHHHCCCCCCCCCEEECHHHHHHCCCCCHHHHHHHHHHHHHHCC
T ss_conf             999999999973999877633411233310377216789999999998548