HHsearch alignment for GI: 254780648 and conserved domain: COG0481

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane].
Probab=98.84  E-value=1.2e-08  Score=72.20  Aligned_cols=156  Identities=25%  Similarity=0.244  Sum_probs=88.6

Q ss_pred             EECEEEEECCCCCCCEEEEEE---CCCC------CHHHH------HHHCCCEECCEEEEE-----CCEEEEEECCCCCCC
Q ss_conf             301124421677753035410---1454------01212------110000001026632-----986899822642124
Q gi|254780648|r  159 IADIGIIGLPNAGKSTFLASV---TRAK------PKIAD------YPFTTLYPNLGIVKE-----GYKEFILADIPGIIK  218 (335)
Q Consensus       159 iaDVglVG~PNaGKSTLln~l---s~ak------~kIa~------ypFTT~~P~lGvv~~-----~~~~~~i~D~PGlIe  218 (335)
T Consensus         9 IRNFsIIAHIDHGKSTLaDRlle~t~~~~~Rem~~Q~LDsMdiERERGITIKaq~v~l~Yk~~~g~~Y~lnlIDTPGHVD   88 (603)
T COG0481           9 IRNFSIIAHIDHGKSTLADRLLELTGGLSEREMRAQVLDSMDIERERGITIKAQAVRLNYKAKDGETYVLNLIDTPGHVD   88 (603)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEEECCCCEEEEEECCCCCCCC
T ss_conf             23227999842782048899999846767678888752213467662845873278999994799779999727998443


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             73116775123443333357887520222211013466678998777667505988999974658998899999999998
Q gi|254780648|r  219 NAHQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELAT  298 (335)
Q Consensus       219 gA~~~~glG~~FLrhIer~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~  298 (335)
T Consensus        89 FsY-------EVSRSLAACEGalLvVDAsQG--veA-QTlAN~YlAle~~L---eIiPViNKIDLP~Adp-ervk~eIe~  154 (603)
T COG0481          89 FSY-------EVSRSLAACEGALLVVDASQG--VEA-QTLANVYLALENNL---EIIPVLNKIDLPAADP-ERVKQEIED  154 (603)
T ss_pred             EEE-------EEHHHHHHCCCCEEEEECCCC--HHH-HHHHHHHHHHHCCC---EEEEEEECCCCCCCCH-HHHHHHHHH
T ss_conf             677-------761337637771899987655--378-89999999987696---7997532256887897-899999998


Q ss_pred             HCC---CCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             629---948999888788999999999999985
Q gi|254780648|r  299 QCG---QVPFEFSSITGHGIPQILECLHDKIFS  328 (335)
Q Consensus       299 ~~~---~~vi~ISA~tg~GI~eL~~~I~e~L~~  328 (335)
T Consensus       155 ~iGid~~dav~~SAKtG~gI~~iLe~Iv~~iP~  187 (603)
T COG0481         155 IIGIDASDAVLVSAKTGIGIEDVLEAIVEKIPP  187 (603)
T ss_pred             HHCCCCCCCEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             709895200467634689979999999962898