HHsearch alignment for GI: 254780648 and conserved domain: KOG0076

>KOG0076 consensus.
Probab=99.40  E-value=3.7e-13  Score=99.59  Aligned_cols=156  Identities=20%  Similarity=0.212  Sum_probs=113.6

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHH---H--HHHHCCCEECCEEEEECCEEEEEECCCCCCCCCCCCCCCHHHHHHHH--
Q ss_conf             1244216777530354101454012---1--21100000010266329868998226421247311677512344333--
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKI---A--DYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHT--  234 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kI---a--~ypFTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~~~glG~~FLrhI--  234 (335)
T Consensus        20 vlIlgldnAGKttfLe~~Kt~~~~~~~~l~~~ki~~tvgLnig~i~v~~~~l~fwdlgGQ------------e~lrSlw~   87 (197)
T KOG0076          20 VLILGLDNAGKTTFLEALKTDFSKAYGGLNPSKITPTVGLNIGTIEVCNAPLSFWDLGGQ------------ESLRSLWK   87 (197)
T ss_pred             HEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHHEECCCCEEECCEEECCCEEEEEECCCH------------HHHHHHHH
T ss_conf             002424457852089887778876516888888101224031316412541677886780------------87899999


Q ss_pred             ---HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHH--HHC---CCCEEE
Q ss_conf             ---335788752022221101346667899877766750598899997465899889999999999--862---994899
Q gi|254780648|r  235 ---ERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELA--TQC---GQVPFE  306 (335)
Q Consensus       235 ---er~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~--~~~---~~~vi~  306 (335)
T Consensus        88 ~yY~~~H~ii~viDa~~~eR~~~~~t~~~~v~~-~E~leg~p~L~lankqd~q~~~~~~El~~~~~~~e~~~~rd~~~~p  166 (197)
T KOG0076          88 KYYWLAHGIIYVIDATDRERFEESKTAFEKVVE-NEKLEGAPVLVLANKQDLQNAMEAAELDGVFGLAELIPRRDNPFQP  166 (197)
T ss_pred             HHHHHHCEEEEEECCCCHHHHHHHHHHHHHHHH-HHHHCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             999972634776417777888887999999998-7876287154340043303056689898774266536886576442


Q ss_pred             EECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             988878899999999999998545
Q gi|254780648|r  307 FSSITGHGIPQILECLHDKIFSIR  330 (335)
Q Consensus       307 ISA~tg~GI~eL~~~I~e~L~~~r  330 (335)
T Consensus       167 vSal~gegv~egi~w~v~~~~kn~  190 (197)
T KOG0076         167 VSALTGEGVKEGIEWLVKKLEKNV  190 (197)
T ss_pred             CHHHHCCCHHHHHHHHHHHHHHCC
T ss_conf             145405567788999999986236