HHsearch alignment for GI: 254780648 and conserved domain: PRK00741

>PRK00741 prfC peptide chain release factor 3; Provisional.
Probab=99.13  E-value=2.4e-10  Score=82.50  Aligned_cols=113  Identities=19%  Similarity=0.221  Sum_probs=70.0

Q ss_pred             EEEEECEEEEECCCCCCCEEEEEE-------CCC-CC--------HHHHHH------HCCCEECCEEEEECCEEEEEECC
Q ss_conf             976301124421677753035410-------145-40--------121211------00000010266329868998226
Q gi|254780648|r  156 LKLIADIGIIGLPNAGKSTFLASV-------TRA-KP--------KIADYP------FTTLYPNLGIVKEGYKEFILADI  213 (335)
Q Consensus       156 lk~iaDVglVG~PNaGKSTLln~l-------s~a-k~--------kIa~yp------FTT~~P~lGvv~~~~~~~~i~D~  213 (335)
T Consensus         7 i~~~RniaIi~H~dAGKTTLtE~lL~~~GaI~~~G~V~~~~~~~~~~sD~~~~E~~RgiSI~ssv~~~e~~~~~iNliDT   86 (526)
T PRK00741          7 VAKRRTFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGRHATSDWMEMEKQRGISVTSSVMQFPYRDCLINLLDT   86 (526)
T ss_pred             HHCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEEC
T ss_conf             76117799993789898999999997467524484663146788646788588997596486151778678989999909


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHH----HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             421247311677512344333335----788752022221101346667899877766750598899997465899
Q gi|254780648|r  214 PGIIKNAHQGAGIGDRFLKHTERT----HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVD  285 (335)
Q Consensus       214 PGlIegA~~~~glG~~FLrhIer~----~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~  285 (335)
T Consensus        87 PGh-----------~DF~~e~~raL~a~D~Av~Vida~~G-Ve~qTe~~w~~~~~-----~~iP~i~FINKmDR~~  145 (526)
T PRK00741         87 PGH-----------EDFSEDTYRTLTAVDSALMVIDAAKG-VEPQTRKLMEVCRL-----RDTPIFTFINKLDRDG  145 (526)
T ss_pred             CCC-----------HHHHHHHHHHHHHHCEEEEEEECCCC-CCHHHHHHHHHHHH-----CCCCEEEEEECCCCCC
T ss_conf             894-----------67789999999873759999977755-23336899999886-----3998899996567678