HHsearch alignment for GI: 254780648 and conserved domain: PRK05703

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=97.73  E-value=3.2e-05  Score=51.50  Aligned_cols=137  Identities=20%  Similarity=0.328  Sum_probs=68.8

Q ss_pred             EEEEECCCCCCCEEEEEEC------CCCCHHHHHHHCCCEE--------------CCEE----E-----------EECCE
Q ss_conf             1244216777530354101------4540121211000000--------------1026----6-----------32986
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVT------RAKPKIADYPFTTLYP--------------NLGI----V-----------KEGYK  206 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls------~ak~kIa~ypFTT~~P--------------~lGv----v-----------~~~~~  206 (335)
T Consensus       213 valVGPTGVGKTTTiAKLAA~~~l~~~~~kV~---lIT~DtyRigA~eQLk~Ya~ilgvp~~v~~~~~~l~~al~~~~~~  289 (412)
T PRK05703        213 VALVGPTGVGKTTTLAKLAARYALEEGKDKVA---LITLDTYRIGAVEQLKTYAKIMGIPVKVAYDPKELAKALEQLANC  289 (412)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEE---EEEECCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHCCC
T ss_conf             99988888756769999999999972998179---998376777799999999997197379847999999999871589


Q ss_pred             EEEEECCCCCCCCCCCCCCC---HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             89982264212473116775---123443333357887520222211013466678998777667505988999974658
Q gi|254780648|r  207 EFILADIPGIIKNAHQGAGI---GDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDT  283 (335)
Q Consensus       207 ~~~i~D~PGlIegA~~~~gl---G~~FLrhIer~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl  283 (335)
T Consensus       290 dlILIDTaG~s---~~d~~~~~eL~~~~~~~~~~~-~~LVlsat~~-----~~dl~~i~~~f~~---~~~~~lI~TKlDE  357 (412)
T PRK05703        290 DLILIDTAGRS---QRDPRLISELKALIENSKPID-VYLVLSATTK-----YRDLKDIVKHFSR---LPLDGLILTKLDE  357 (412)
T ss_pred             CEEEEECCCCC---CCCHHHHHHHHHHHHHCCCCC-EEEEECCCCC-----HHHHHHHHHHHCC---CCCCEEEEEEECC
T ss_conf             97999689889---789999999999986248871-8999759899-----8999999998467---9998799971128


Q ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHH
Q ss_conf             99889999999999862994899988878899999
Q gi|254780648|r  284 VDSDTLARKKNELATQCGQVPFEFSSITGHGIPQI  318 (335)
Q Consensus       284 ~~~e~~~~~~~~l~~~~~~~vi~ISA~tg~GI~eL  318 (335)
T Consensus       358 t~--~~G~il~~-~~~~~lplsy~t--~GQ~VPeD  387 (412)
T PRK05703        358 TS--SLGSILSL-LIESGLPISYLT--DGQRVPDD  387 (412)
T ss_pred             CC--CCCHHHHH-HHHHCCCEEEEE--CCCCCHHH
T ss_conf             99--86299999-999887969994--69997243