HHsearch alignment for GI: 254780648 and conserved domain: PRK12298

>PRK12298 obgE GTPase ObgE; Reviewed.
Probab=100.00  E-value=0  Score=898.17  Aligned_cols=332  Identities=47%  Similarity=0.823  Sum_probs=324.7

Q ss_pred             CCEEEEEEEEEEECCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHCCCCEECCCCCCCCCCCCCC
Q ss_conf             92114999999836999841452566777999998888898652999966898721554146542056786654221335
Q gi|254780648|r    1 MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFRYQQHFKAQHGEKGMKRNRSG   80 (335)
Q Consensus         1 m~f~D~~~i~~~~G~GG~G~~sf~r~k~~~~g~p~gg~GG~Gg~v~~~~~~~~~~l~~~~~~~~~~A~~G~~G~~~~~~G   80 (335)
T Consensus         1 mkFvD~~~I~v~aG~GG~G~vsFrReK~vp~GGPdGGdGG~GG~V~~~~d~~l~tL~~~~~~~~~~A~~G~~G~~~~~~G   80 (380)
T PRK12298          1 MKFVDEAKIRVEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDVYLEADENLNTLIDYRFERHFRAERGENGRGRDCTG   80 (380)
T ss_pred             CCCEEEEEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEEECCCCHHHHCCCCCEEECCCCCCCCCCCCCC
T ss_conf             96458999999955897853444133367779999988977788999980992745660687679827999998666848


Q ss_pred             CCCCCEEEECCCCCEEEECCCCEEEEEEECCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEE
Q ss_conf             44461199828332357325882664561268455522677776344332676676761013677530268999997630
Q gi|254780648|r   81 AKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPGGNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIA  160 (335)
Q Consensus        81 ~~g~d~~i~vP~GT~v~~~~~~~~~~dl~~~~~~~~~~~GG~GG~GN~~f~s~~n~~P~~~~~G~~G~~~~~~lelk~ia  160 (335)
T Consensus        81 ~~G~D~~i~VP~GT~V~d~~t~e~i~dl~~~g~~~lva~GG~GG~GN~~Fkss~n~aPr~~~~G~~Ge~~~l~LELKliA  160 (380)
T PRK12298         81 KRGEDLTLKVPVGTRVIDADTGEVIGDLTEHGQRLLVAKGGWHGLGNTRFKSSVNRAPRQKTPGTPGEERELKLELKLLA  160 (380)
T ss_pred             CCCCCEEEEECCCCEEEECCCCCEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEC
T ss_conf             99998799948988788779993999836699589997578787675212465668984446998865899999999751


Q ss_pred             CEEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCEEEEEC-CEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             11244216777530354101454012121100000010266329-86899822642124731167751234433333578
Q gi|254780648|r  161 DIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEG-YKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHV  239 (335)
Q Consensus       161 DVglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lGvv~~~-~~~~~i~D~PGlIegA~~~~glG~~FLrhIer~~v  239 (335)
T Consensus       161 DVGLvG~PNAGKSTll~~iS~AkPKIAdYpFTTL~PnLGvV~~~~~~~fviADIPGLIeGAs~G~GLG~~FLrHieRt~~  240 (380)
T PRK12298        161 DVGLLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPNLGVVRVDDERSFVIADIPGLIEGAAEGAGLGIRFLKHLERCRV  240 (380)
T ss_pred             CCCEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCE
T ss_conf             65146369886108998855589754788753368746799946986699987775557755587728999999875358


Q ss_pred             HHHHCCCC---CCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCC--CEEEEECCCCCC
Q ss_conf             87520222---2110134666789987776675059889999746589988999999999986299--489998887889
Q gi|254780648|r  240 LLHIVSAL---EENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQ--VPFEFSSITGHG  314 (335)
Q Consensus       240 Ll~VVD~s---~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~~~~~--~vi~ISA~tg~G  314 (335)
T Consensus       241 LlhviD~s~~~~~dp~~~~~~i~~EL~~Y~~~L~~kp~iiv~NK~Dl~~~~e~~~~~~~~~~~~~~~~~v~~ISA~tgeG  320 (380)
T PRK12298        241 LLHLIDIAPIDGSDPVENARIIVNELEKYSPKLAEKPRWLVFNKIDLLDEEEAEERAKEIVEALGWEGPVYLISAASGEG  320 (380)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCC
T ss_conf             99999688777519999999999999985976605987999988548997999999999999708888879997876879


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999854523
Q gi|254780648|r  315 IPQILECLHDKIFSIRGE  332 (335)
Q Consensus       315 I~eL~~~I~e~L~~~r~e  332 (335)
T Consensus       321 ~~~L~~~i~~~l~~~~~~  338 (380)
T PRK12298        321 TKELCWDLMTFIEENPAE  338 (380)
T ss_pred             HHHHHHHHHHHHHHCCCC
T ss_conf             999999999999867243