HHsearch alignment for GI: 254780648 and conserved domain: PRK13546

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional.
Probab=97.22  E-value=0.0013  Score=41.64  Aligned_cols=54  Identities=30%  Similarity=0.378  Sum_probs=35.5

Q ss_pred             EEEEEEEEECEEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCEEEEECCEEEEEECCCCC
Q ss_conf             99999763011244216777530354101454012121100000010266329868998226421
Q gi|254780648|r  152 IWLKLKLIADIGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGI  216 (335)
Q Consensus       152 ~~lelk~iaDVglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lGvv~~~~~~~~i~D~PGl  216 (335)
T Consensus        43 Vsf~i~~GEivgllG~NGaGKSTLlk~I~Gl-----------~~P~~G~I~~~G~i~~~~~~~~l   96 (264)
T PRK13546         43 ISLKAYEGDVIGLVGINGSGKSTLSNIIGGS-----------LSPTVGKVDRNGEVSVIAISAGL   96 (264)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHHHHHCC-----------CCCCCCEEEECCEEEEEEECCCC
T ss_conf             0788859989999989986199999999679-----------88887479999887488503565