HHsearch alignment for GI: 254780648 and conserved domain: PTZ00132

>PTZ00132 GTP-binding nuclear protein; Provisional.
Probab=99.66  E-value=2.1e-16  Score=119.26  Aligned_cols=152  Identities=12%  Similarity=0.115  Sum_probs=109.9

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCE------EEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             12442167775303541014540121211000000102------663298--6899822642124731167751234433
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLG------IVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLKH  233 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lG------vv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLrh  233 (335)
T Consensus         9 IvllGd~~VGKTsLi~r~~~~~F-~~~y-----~pTig~d~~~~~~~~~~~~i~l~IwDTaGqe----~f~sl~~~y---   75 (209)
T PTZ00132          9 LILVGDGGVGKTTFVKRHLTGEF-EKKY-----IATLGVEVHPLKFYTNRGKICFNVWDTAGQE----KFGGLRDGY---   75 (209)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCC-CCCC-----CCCCCEEEEEEEEEECCEEEEEEEEECCCCC----CCCCCCCHH---
T ss_conf             99999999678999999971996-9987-----7760279899999999999999999899974----455665144---


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             33357887520222211013466678998777667505988999974658998899999999998629948999888788
Q gi|254780648|r  234 TERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGH  313 (335)
Q Consensus       234 Ier~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~~~~~~vi~ISA~tg~  313 (335)
T Consensus        76 yr~a~~~ilVfDit~~~SF~~l~~W~~ei~~~~~---~ipivLVGNK~DL~~r~V~~~~-~~~a~~~~~~f~EtSAKtg~  151 (209)
T PTZ00132         76 YIKGQCAIIMFDVTSRITYKNVPNWHRDITRVCE---NIPIVLVGNKVDVKDRQVKAKQ-ITFHRKKNLQYYDISAKSNY  151 (209)
T ss_pred             HCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCC---CCCEEEEEECCCCCCCCCCHHH-HHHHHHCCCEEEEEECCCCC
T ss_conf             2489889998437887899999999999998689---9878999762322413557999-99999879989997268993


Q ss_pred             CHHHHHHHHHHHHHHHH
Q ss_conf             99999999999998545
Q gi|254780648|r  314 GIPQILECLHDKIFSIR  330 (335)
Q Consensus       314 GI~eL~~~I~e~L~~~r  330 (335)
T Consensus       152 NV~e~F~~Lar~il~~~  168 (209)
T PTZ00132        152 NFEKPFLWLARRLANDP  168 (209)
T ss_pred             CHHHHHHHHHHHHHCCC
T ss_conf             97999999999984799