HHsearch alignment for GI: 254780648 and conserved domain: PTZ00327

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional.
Probab=99.39  E-value=9.7e-13  Score=97.07  Aligned_cols=154  Identities=20%  Similarity=0.203  Sum_probs=96.7

Q ss_pred             ECEEEEECCCCCCCEEEEEECCCCCHH---------------HHHHH------------CC---------CEECCEEEEE
Q ss_conf             011244216777530354101454012---------------12110------------00---------0001026632
Q gi|254780648|r  160 ADIGIIGLPNAGKSTFLASVTRAKPKI---------------ADYPF------------TT---------LYPNLGIVKE  203 (335)
Q Consensus       160 aDVglVG~PNaGKSTLln~ls~ak~kI---------------a~ypF------------TT---------~~P~lGvv~~  203 (335)
T Consensus        38 vNIGtiGHVDHGKTTLvkALTgv~t~r~~eE~~RgiTI~LGya~~kiykc~~~~~p~~y~~~~s~~~~~~~c~~c~~~~t  117 (460)
T PTZ00327         38 INIGTIGHVAHGKSTVVKALSGVKTVRFHREKVRNITIKLGYANAKIYKCTKCPPPACYKSYPSSKPDNPQCPGCGHKMT  117 (460)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCHHHCHHHHHCCCEEEECCCCEEEECCCCCCCCCCEECCCCCCCCCCCCCCCCCCCC
T ss_conf             18988746289899999998677501065678758721205433011136567763101014666655544555565431


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCHHHHHHHH----HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             9868998226421247311677512344333----335788752022221101346667899877766750598899997
Q gi|254780648|r  204 GYKEFILADIPGIIKNAHQGAGIGDRFLKHT----ERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLS  279 (335)
Q Consensus       204 ~~~~~~i~D~PGlIegA~~~~glG~~FLrhI----er~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlN  279 (335)
T Consensus       118 ~~Rh~s~VDcPGH-----~------~l~~nmi~Ga~~mD~aiLvvaa~eg~P~pQT---~EHl~~~-~~~gi~~~iv~~n  182 (460)
T PTZ00327        118 LKRHVSFVDCPGH-----D------ILMATMLNGAAVMDAALLLIAANESCPQPQT---SEHLAAV-EIMKLKHIIILQN  182 (460)
T ss_pred             CCEEEEEEECCCH-----H------HHHHHHHHCHHHCCEEEEEEECCCCCCCCHH---HHHHHHH-HHHCCCEEEEEEC
T ss_conf             2204899868987-----9------9999987476337679999986888876468---9999999-9728971999953


Q ss_pred             CCCCCCHHHHHHHHHHHHHHC------CCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             465899889999999999862------9948999888788999999999999985
Q gi|254780648|r  280 QIDTVDSDTLARKKNELATQC------GQVPFEFSSITGHGIPQILECLHDKIFS  328 (335)
Q Consensus       280 KiDl~~~e~~~~~~~~l~~~~------~~~vi~ISA~tg~GI~eL~~~I~e~L~~  328 (335)
T Consensus       183 K~DlV~~e~~~~~~~ei~~~l~~t~~~~~PIIpvSA~~~~nid~L~~~i~~~ip~  237 (460)
T PTZ00327        183 KIDLIKEVQALDQYEEIRNFIDGTIAENAPIIPISAQLKYNIDVLLEYICTQIPI  237 (460)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEECCHHHCCCHHHHHHHHHHHCCC
T ss_conf             5445588999999999999852576779998756544505879999999975899