HHsearch alignment for GI: 254780648 and conserved domain: TIGR00092

>TIGR00092 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 This is a family of conserved hypothetical proteins found in both prokaryotes and eukaryotes. While the function of these proteins is not known, the crystal structure of P44681 from SWISSPROT from Haemophilus influenzae has been determined . This protein consists of three domains: an N-terminal domain which has a mononucleotide binding fold typical for the P-loop NTPases, a central domain which forms an alpha-helical coiled coil, and a C-terminal domain composed of a six-stranded half-barrel curved around an alpha helix. The central and C-terminal domains are topologically similar to RNA-binding proteins, while the N-terminal region contains the features typical of GTP-dependent molecular switches. The purified protein was capable of binding both double-stranded nucleic acid and GTP. It was suggested, therefore, that this protein might be part of a nucleoprotein complex and could function as a GTP-dependent translation factor.; GO: 0005525 GTP binding.
Probab=100.00  E-value=1.7e-36  Score=241.04  Aligned_cols=169  Identities=28%  Similarity=0.441  Sum_probs=134.0

Q ss_pred             EEEEECCCCCCCEEEEEECCCCC-HHHHHHHCCCEECCEEEEECCE------------------EEEEECCCCCCCCCCC
Q ss_conf             12442167775303541014540-1212110000001026632986------------------8998226421247311
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKP-KIADYPFTTLYPNLGIVKEGYK------------------EFILADIPGIIKNAHQ  222 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~-kIa~ypFTT~~P~lGvv~~~~~------------------~~~i~D~PGlIegA~~  222 (335)
T Consensus         5 aGIVGLpNVGKSTlF~AiT~~~~ge~ANYPFaTIePn~g~V~vpd~RLd~La~i~k~~k~evptt~~fvDIAGLvkGAS~   84 (390)
T TIGR00092         5 AGIVGLPNVGKSTLFNAITNLQLGEAANYPFATIEPNTGVVNVPDPRLDKLAEIYKPEKVEVPTTLEFVDIAGLVKGASK   84 (390)
T ss_pred             CCCEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHCCCEEECCEEEEEEEECCCCCCCCC
T ss_conf             65300687605579999982667776688876516764446258853334776406420411404899862234100015


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCC----------CHHHHHHHHHHHHHHHHHH------------------------
Q ss_conf             677512344333335788752022221----------1013466678998777667------------------------
Q gi|254780648|r  223 GAGIGDRFLKHTERTHVLLHIVSALEE----------NVQAAYQCILDELSAYNSE------------------------  268 (335)
Q Consensus       223 ~~glG~~FLrhIer~~vLl~VVD~s~~----------d~~~~~~~I~~EL~~y~~~------------------------  268 (335)
T Consensus        85 GeGLGN~FLanIReVd~I~hVVRCF~d~~I~HV~G~VDPV~D~evI~~EL~LaDle~~~~~~E~~~~~i~~~~k~a~~~D  164 (390)
T TIGR00092        85 GEGLGNQFLANIREVDAICHVVRCFEDDDIIHVEGKVDPVRDLEVINNELILADLEFVEKILERLEKRIGKVKKKAKEGD  164 (390)
T ss_pred             CCCCHHHHHHCCCCCCCCEEEEEEEECCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             78723344310320331047886330773588517517623268888888888899999999999999997404231003


Q ss_pred             -------------------------------------------HCCCCEEEEEECC--CCCC--HHHHHHHHHHHHHHC-
Q ss_conf             -------------------------------------------5059889999746--5899--889999999999862-
Q gi|254780648|r  269 -------------------------------------------LRKKIEIVGLSQI--DTVD--SDTLARKKNELATQC-  300 (335)
Q Consensus       269 -------------------------------------------L~~Kp~IIVlNKi--Dl~~--~e~~~~~~~~l~~~~-  300 (335)
T Consensus       165 K~~K~E~~lL~~~~~~L~~g~~~~~~~dhl~~~E~~~iks~~lLT~KP~l~~~NVsE~D~~~~~N~~~~~~~e~~~~~~~  244 (390)
T TIGR00092       165 KEAKEELALLEKILEGLENGQMVRHVGDHLTEEELKIIKSLNLLTAKPILYLANVSEDDLVNLDNKYLLRVKEIAAKQKP  244 (390)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHCCHHHHHHHEEECCCHHCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             77888899999999998638843310234588899999862212100140543168110036788378999999972389


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             994899988878899999999999998545
Q gi|254780648|r  301 GQVPFEFSSITGHGIPQILECLHDKIFSIR  330 (335)
Q Consensus       301 ~~~vi~ISA~tg~GI~eL~~~I~e~L~~~r  330 (335)
T Consensus       245 ~~~~~~vsa~~E~~L~eL~~~~~~~f~~~l  274 (390)
T TIGR00092       245 GDKVIPVSAALESELSELDDEERQDFLKEL  274 (390)
T ss_pred             CCEEEEEEHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             972888668788887438864247999860