>TIGR00450 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 The GTP-binding domain of all TrmE/ThdF orthologues is found in the C-terminal portion of the molecule. The N-terminal half can be removed without affecting the GTP-binding/hydrolysis function of the GTP-binding domain. The last four amino acids of all orthologues of ThdF/TrmE are highly conserved, being either CIGK or CLGK. This matches the Caax (where 'a' represents an aliphatic amino acid, and 'x' represents any amino acid) motif for isoprenylation that anchors small GTP-binding proteins to cell membranes in eukaryotic cells. However, protein isoprenylation has never been shown to occur in bacteria. Interestingly, biochemical experiments have shown that the Escherichia coli TrmE protein peripherally associates with the membrane fraction . Although the biochemical properties of TrmE have been investigated for the E. coli and Thermotoga maritima proteins, nothing is known about the relationship of this protein to tRNA modification. Orthologues of TrmE are present in eukaryotes and bacteria, but are not present in archaea. In Saccharomyces cerevisiae, Mss1p is a nuclear-encoded mitochondrial protein that is the yeast orthologue of TrmE. Mss1p interacts with the 15S rRNA of the yeast mitochondria, which is equivalent to the 16S rRNA of bacteria. Subsequent analysis of the S. cerevisiae MTO1 gene suggests that MSS1 and MTO1 act together in a pathway involved in optimizing mitochondrial protein synthesis. TrmE may play a role in tRNA processing and may be directly or indirectly involved in regulating ribosome function.; GO: 0003924 GTPase activity, 0005525 GTP binding, 0006400 tRNA modification, 0005622 intracellular.

Probab=99.88 E-value=8.7e-24 Score=164.04 Aligned_cols=162 Identities=21% Similarity=0.239 Sum_probs=115.5 Q ss_pred ECEEEEECCCCCCCEEEEEECCC-CCHHHHHHHCCCEECCEEEEECCEEEEEECCCCCCCCCCCCCCCHHH-HHHHHHHH Q ss_conf 01124421677753035410145-40121211000000102663298689982264212473116775123-44333335 Q gi|254780648|r 160 ADIGIIGLPNAGKSTFLASVTRA-KPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDR-FLKHTERT 237 (335) Q Consensus 160 aDVglVG~PNaGKSTLln~ls~a-k~kIa~ypFTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~~~glG~~-FLrhIer~ 237 (335) T Consensus 226 ~k~ai~G~~NvGKSSLLNa~l~~DrAiVS~~kGtTRD~vE~~~~L~G~~~~~lDTAGiR~~~~~~E~~GiekS~~~i~~A 305 (473) T TIGR00450 226 FKLAIVGKPNVGKSSLLNALLKQDRAIVSDIKGTTRDVVEGDFELNGILVKLLDTAGIREHADKVERLGIEKSFKAIKQA 305 (473) T ss_pred CEEEEECCCCCCHHHHHHHHHHCCCEEEECCCCCCCCEEEEEEEECCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHC T ss_conf 47999647887578999987622870552766883204420577746789985146751020046677689989998605 Q ss_pred HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHH-HHHHHHHHHHHHCCCCEEEEECCCCCCHH Q ss_conf 78875202222110134666789987776675059889999746589988-99999999998629948999888788999 Q gi|254780648|r 238 HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSD-TLARKKNELATQCGQVPFEFSSITGHGIP 316 (335) Q Consensus 238 ~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e-~~~~~~~~l~~~~~~~vi~ISA~tg~GI~ 316 (335) T Consensus 306 ~LVi~~~D~~~~~~~ddf~li~~~-~-----k~~k~~~~V~NK~DL~~nkr~~~--~~~~~~~~~~~~~~~~~~-~~~~~ 376 (473) T TIGR00450 306 DLVIYVLDASQPLTKDDFELIITL-N-----KKKKPLILVLNKIDLAINKRKLE--LEFLVSELKLTVLLLSAK-QLKIK 376 (473) T ss_pred CEEEEEEECCCCCCHHHHHHHHHH-H-----HCCCCEEEEECCCCCCCHHHHHH--HHHHCCHHHHHHHHHHHH-HCCCH T ss_conf 734788874789881058999997-3-----21797799973501650023444--444131134578899887-30656 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999999998545 Q gi|254780648|r 317 QILECLHDKIFSIR 330 (335) Q Consensus 317 eL~~~I~e~L~~~r 330 (335) T Consensus 377 ~~~d~L~~~i~~~~ 390 (473) T TIGR00450 377 ALVDLLTQKINAFY 390 (473) T ss_pred HHHHHHHHHHHHHH T ss_conf 67999999999874

HHsearch alignment for GI: 254780648 and conserved domain: TIGR00450