HHsearch alignment for GI: 254780648 and conserved domain: TIGR03348

>TIGR03348 VI_IcmF type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems.
Probab=97.92  E-value=3e-05  Score=51.67  Aligned_cols=119  Identities=20%  Similarity=0.240  Sum_probs=66.6

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCC---CEECCEE---EEE---CCEEEEEECCCCCC---C-CCCCCCCCHH
Q ss_conf             12442167775303541014540121211000---0001026---632---98689982264212---4-7311677512
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTT---LYPNLGI---VKE---GYKEFILADIPGII---K-NAHQGAGIGD  228 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT---~~P~lGv---v~~---~~~~~~i~D~PGlI---e-gA~~~~glG~  228 (335)
T Consensus       114 YlviG~~gsGKTt~l~~Sg------l~fPl~~~~~~~~~~g~ggt~~cdwwft~~AVliDtaGry~~Q~~~~~~d~~~W~  187 (1169)
T TIGR03348       114 YLVIGPPGSGKTTLLQNSG------LKFPLAERLGAAALRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSDPEEDAAAWL  187 (1169)
T ss_pred             EEEECCCCCCHHHHHHHCC------CCCCCCCCCCHHHCCCCCCCCCCCEEEECCEEEEECCCCEECCCCCCHHHHHHHH
T ss_conf             8997899986689998379------9887741001122158899855571652787999479760268886400189999


Q ss_pred             HHHHHHHHHH------HHHHHCCCCC------CCHHHHHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCH
Q ss_conf             3443333357------8875202222------1101346667899877766750-5988999974658998
Q gi|254780648|r  229 RFLKHTERTH------VLLHIVSALE------ENVQAAYQCILDELSAYNSELR-KKIEIVGLSQIDTVDS  286 (335)
Q Consensus       229 ~FLrhIer~~------vLl~VVD~s~------~d~~~~~~~I~~EL~~y~~~L~-~Kp~IIVlNKiDl~~~  286 (335)
T Consensus       188 ~fL~lLkk~R~r~piNGvil~is~~~Ll~~~~~~~~~~a~~lr~Rl~El~~~lg~~~PVYv~~TK~Dll~G  258 (1169)
T TIGR03348       188 GFLGLLRKHRRRQPLNGVVVTVSLADLLTADPAERKAHARAIRQRLQELREQLGARFPVYLVLTKADLLAG  258 (1169)
T ss_pred             HHHHHHHHCCCCCCCCEEEEEEEHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHC
T ss_conf             99999986489899876899978999747899999999999999999999982998775998664012306