HHsearch alignment for GI: 254780648 and conserved domain: cd00154

>cd00154 Rab Rab family. Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide di
Probab=99.69  E-value=7.9e-17  Score=121.83  Aligned_cols=152  Identities=20%  Similarity=0.238  Sum_probs=104.3

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECC--EEEEECCE--EEEEECCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             1244216777530354101454012121100000010--26632986--8998226421247311677512344333335
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNL--GIVKEGYK--EFILADIPGIIKNAHQGAGIGDRFLKHTERT  237 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~l--Gvv~~~~~--~~~i~D~PGlIegA~~~~glG~~FLrhIer~  237 (335)
T Consensus         3 i~vvG~~~vGKTsli~~~~~~~f-~~~~~-~Tig~d~~~~~~~~~~~~~~l~iwDt~G~e~----~~~l~~~---~~~~~   73 (159)
T cd00154           3 IVLIGDSGVGKTSLLLRFVDGKF-DENYK-STIGVDFKSKTIEIDGKTVKLQIWDTAGQER----FRSITPS---YYRGA   73 (159)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCC-CCCCC-CCCCEEEEEEEEEECCEEEEEEEEECCCCHH----HHHHHHH---HHHHC
T ss_conf             99999699689999999970999-99848-8666479999999999999999997898265----7788999---97541


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH-HHHHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             788752022221101346667899877766750598899997465899889-9999999998629948999888788999
Q gi|254780648|r  238 HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDT-LARKKNELATQCGQVPFEFSSITGHGIP  316 (335)
Q Consensus       238 ~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~-~~~~~~~l~~~~~~~vi~ISA~tg~GI~  316 (335)
T Consensus        74 d~~ilv~d~~~~~Sf~~~~~~~~~i~~~~~--~~~~iilvgnK~DL~~~~~v~~~~~~~~a~~~~~~~~e~SAk~~~~i~  151 (159)
T cd00154          74 HGAILVYDITNRESFENLDKWLKELKEYAP--ENIPIILVGNKIDLEDQRQVSTEEAQQFAKENGLLFFETSAKTGENVE  151 (159)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHHHCC--CCCCEEEEEECCCCHHCCCCCHHHHHHHHHHCCCEEEEECCCCCCCHH
T ss_conf             275672448988999999999999998689--888269999745630116899999999999869979998768881989


Q ss_pred             HHHHHHHH
Q ss_conf             99999999
Q gi|254780648|r  317 QILECLHD  324 (335)
Q Consensus       317 eL~~~I~e  324 (335)
T Consensus       152 ~~F~~i~~  159 (159)
T cd00154         152 ELFQSLAE  159 (159)
T ss_pred             HHHHHHHC
T ss_conf             99999869