HHsearch alignment for GI: 254780648 and conserved domain: cd01864

>cd01864 Rab19 Rab19 subfamily. Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.60  E-value=8.6e-16  Score=115.54  Aligned_cols=154  Identities=12%  Similarity=0.108  Sum_probs=105.8

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECC--EEEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             1244216777530354101454012121100000010--2663298--68998226421247311677512344333335
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNL--GIVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLKHTERT  237 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~l--Gvv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLrhIer~  237 (335)
T Consensus         6 iv~lGd~~vGKTsli~r~~~~~f-~~~~~-~Ti~~~~~~k~i~~~~~~~~l~iwDtaG~e~----~~~l~~~---~~~~a   76 (165)
T cd01864           6 IILIGDSNVGKTCVVQRFKSGTF-SERQG-NTIGVDFTMKTLEIEGKRVKLQIWDTAGQER----FRTITQS---YYRSA   76 (165)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCC-CCCCC-CCCCEEEEEEEEEECCEEEEEEEEECCCCCC----CCCCCHH---HEECC
T ss_conf             99999999589999999964999-99879-9754378999999999999999998999834----4535075---52215


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH-HHHHHHHHHHCCCC-EEEEECCCCCCH
Q ss_conf             7887520222211013466678998777667505988999974658998899-99999999862994-899988878899
Q gi|254780648|r  238 HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTL-ARKKNELATQCGQV-PFEFSSITGHGI  315 (335)
Q Consensus       238 ~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~-~~~~~~l~~~~~~~-vi~ISA~tg~GI  315 (335)
T Consensus        77 ~~~ilvydit~~~Sf~~~~~w~~~i~~~~~--~~~~iilVGNK~DL~~~r~V~~~~~~~~a~~~~~~~~~E~SAk~~~nV  154 (165)
T cd01864          77 NGAIIAYDITRRSSFESVPHWIEEVEKYGA--SNVVLLLIGNKCDLEEQREVLFEEACTLAEKNGMLAVLETSAKESQNV  154 (165)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHHCC--CCCCEEEEEECCCHHHHCCCCHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             666997138998999999999999998769--998438887723768628999999999999839976999788858198


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254780648|r  316 PQILECLHDKI  326 (335)
Q Consensus       316 ~eL~~~I~e~L  326 (335)
T Consensus       155 ~e~F~~la~~i  165 (165)
T cd01864         155 EEAFLLMATEL  165 (165)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999849