HHsearch alignment for GI: 254780648 and conserved domain: cd01871

>cd01871 Rac1_like Rac1-like subfamily. The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1. While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively. Rac1 stimulates the formation of actin lamellipodia and membrane ruffles. It also plays a role in cell-matrix adhesion and cell anoikis. In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis. Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation. In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis. Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=99.51  E-value=5.8e-14  Score=104.49  Aligned_cols=151  Identities=19%  Similarity=0.157  Sum_probs=100.6

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCE-EEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHH--HHHH
Q ss_conf             12442167775303541014540121211000000102-663298--689982264212473116775123443--3333
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLG-IVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLK--HTER  236 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lG-vv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLr--hIer  236 (335)
T Consensus         4 ivlvGd~~VGKTsli~r~~~~~f-~~~~~-~Ti~~~~~~~i~~~~~~v~l~iwDtaGqe~---------~~~~~~~~~~~   72 (174)
T cd01871           4 CVVVGDGAVGKTCLLISYTTNAF-PGEYI-PTVFDNYSANVMVDGKPVNLGLWDTAGQED---------YDRLRPLSYPQ   72 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCC-CCCCC-CEEEEEEEEEEEECCEEEEEEEECCCCCCC---------CHHHHHHHHHH
T ss_conf             99989999869999999973999-99868-837887679999999999999986999724---------06788998740


Q ss_pred             HHHHHHHCCCCCCCHHHHHH-HHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHH-------------HHHHHHHHCC-
Q ss_conf             57887520222211013466-67899877766750598899997465899889999-------------9999998629-
Q gi|254780648|r  237 THVLLHIVSALEENVQAAYQ-CILDELSAYNSELRKKIEIVGLSQIDTVDSDTLAR-------------KKNELATQCG-  301 (335)
Q Consensus       237 ~~vLl~VVD~s~~d~~~~~~-~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~-------------~~~~l~~~~~-  301 (335)
T Consensus        73 a~~~ilvydi~~~~SF~~i~~~w~~~i~~~~~---~~piiLVGnK~DL~~~~~~~~~~~~~~~~~vs~~eg~~~a~~~~~  149 (174)
T cd01871          73 TDVFLICFSLVSPASFENVRAKWYPEVRHHCP---NTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGA  149 (174)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHHHHCC---CCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHCCC
T ss_conf             66899998679878899999999999998588---999798747301310045677886514677589999999987599


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9489998887889999999999999
Q gi|254780648|r  302 QVPFEFSSITGHGIPQILECLHDKI  326 (335)
Q Consensus       302 ~~vi~ISA~tg~GI~eL~~~I~e~L  326 (335)
T Consensus       150 ~~f~EtSAk~~~nV~e~F~~lir~i  174 (174)
T cd01871         150 VKYLECSALTQKGLKTVFDEAIRAV  174 (174)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHC
T ss_conf             7899918788959799999999519