HHsearch alignment for GI: 254780648 and conserved domain: cd03233

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.04  E-value=0.009  Score=36.64  Aligned_cols=31  Identities=23%  Similarity=0.240  Sum_probs=23.6

Q ss_pred             EEEEEEEEECEEEEECCCCCCCEEEEEECCC
Q ss_conf             9999976301124421677753035410145
Q gi|254780648|r  152 IWLKLKLIADIGIIGLPNAGKSTFLASVTRA  182 (335)
Q Consensus       152 ~~lelk~iaDVglVG~PNaGKSTLln~ls~a  182 (335)
T Consensus        26 is~~i~~Gei~~llG~nGsGKSTLl~~l~G~   56 (202)
T cd03233          26 FSGVVKPGEMVLVLGRPGSGCSTLLKALANR   56 (202)
T ss_pred             EEEEECCCEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             0889809849999989999889999998378