HHsearch alignment for GI: 254780648 and conserved domain: cd03237

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=95.38  E-value=0.074  Score=31.06  Aligned_cols=35  Identities=31%  Similarity=0.540  Sum_probs=25.9

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCEEEEECCEE
Q ss_conf             1244216777530354101454012121100000010266329868
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKE  207 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lGvv~~~~~~  207 (335)
T Consensus        28 v~liGpNGaGKSTLlk~l~Gl-----------l~p~~G~I~~~g~~   62 (246)
T cd03237          28 IGILGPNGIGKTTFIKMLAGV-----------LKPDEGDIEIELDT   62 (246)
T ss_pred             EEEECCCCCHHHHHHHHHHCC-----------CCCCCCEEEECCCC
T ss_conf             999979997699999999778-----------78886079989820