HHsearch alignment for GI: 254780648 and conserved domain: cd04103

>cd04103 Centaurin_gamma Centaurin gamma. The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains. Centaurin gamma contains an additional GTPase domain near its N-terminus. The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism. Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP. Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments. A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues.
Probab=99.44  E-value=2.8e-13  Score=100.30  Aligned_cols=150  Identities=15%  Similarity=0.143  Sum_probs=101.8

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCEEEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12442167775303541014540121211000000102663298--6899822642124731167751234433333578
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLKHTERTHV  239 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lGvv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLrhIer~~v  239 (335)
T Consensus         3 ivllGd~~VGKTsl~~Rf~~~~F-~~~~~-pt~~~~~~~~~vdg~~~~l~i~DTaG~~~---------~~~~---~~ada   68 (158)
T cd04103           3 LGIVGNLQSGKSALVHRYLTGSY-VQLES-PEGGRFKKEVLVDGQSHLLLIRDEGGAPD---------AQFA---SWVDA   68 (158)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCC-CCCCC-CCCCEEEEEEEECCEEEEEEEEECCCCCC---------HHHH---CCCCE
T ss_conf             99999699879999999980947-87444-66441799999999999999995899834---------3332---14998


Q ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH---HHHHHHHHHHHC-CCCEEEEECCCCCCH
Q ss_conf             8752022221101346667899877766750598899997465899889---999999999862-994899988878899
Q gi|254780648|r  240 LLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDT---LARKKNELATQC-GQVPFEFSSITGHGI  315 (335)
Q Consensus       240 Ll~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~---~~~~~~~l~~~~-~~~vi~ISA~tg~GI  315 (335)
T Consensus        69 ~ilVydit~~~SF~~v~~~~~~i~~~~-~~~~ipiilvGnK~dl~~~~~r~V~~~e~~~~a~~~~~~~f~EtSAk~~~NV  147 (158)
T cd04103          69 VIFVFSLENEASFQTVYNLYHQLSSYR-NISEIPLILVGTQDAISESNPRVIDDARARQLCADMKRCSYYETCATYGLNV  147 (158)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHHHC-CCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHCCCCEEEEEECCCCCCH
T ss_conf             999998898889999999999999855-9789968999877003657761479999999998569988999017999598


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254780648|r  316 PQILECLHDKI  326 (335)
Q Consensus       316 ~eL~~~I~e~L  326 (335)
T Consensus       148 ~~~F~~~~~~i  158 (158)
T cd04103         148 ERVFQEAAQKI  158 (158)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999639