>cd04106 Rab23_lke Rab23-like subfamily. Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina. Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system. GTPase activating proteins (GAPs) interact with G

Probab=99.58 E-value=3.5e-15 Score=111.88 Aligned_cols=152 Identities=16% Similarity=0.222 Sum_probs=106.0 Q ss_pred EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECC--E--EEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHHHHH Q ss_conf 1244216777530354101454012121100000010--2--663298--689982264212473116775123443333 Q gi|254780648|r 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNL--G--IVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLKHTE 235 (335) Q Consensus 162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~l--G--vv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLrhIe 235 (335) T Consensus 3 ivvlGd~~VGKTsLi~r~~~~~f-~~~y~-~Tig~~~~~k~i~~~~~~~~v~l~iwDtaG~e~----~~~l~~---~~~~ 73 (162) T cd04106 3 VIVVGNGNVGKSSMIQRFVKGIF-TKDYK-KTIGVDFLEKQIFLRQSDEDVRLMLWDTAGQEE----FDAITK---AYYR 73 (162) T ss_pred EEEECCCCCCHHHHHHHHHHCCC-CCCCC-CCCCCEEEEEEEEECCCCEEEEEEEEECCCCCC----CCCCHH---HHHH T ss_conf 99999999889999999984968-98768-855625788789986799799999997899701----341524---5612 Q ss_pred HHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH-HHHHHHHHHHCCCCEEEEECCCCCC Q ss_conf 357887520222211013466678998777667505988999974658998899-9999999986299489998887889 Q gi|254780648|r 236 RTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTL-ARKKNELATQCGQVPFEFSSITGHG 314 (335) Q Consensus 236 r~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~-~~~~~~l~~~~~~~vi~ISA~tg~G 314 (335) T Consensus 74 ~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~---~~piilVgNK~DL~~~r~V~~~e~~~~a~~~~~~~~E~SAk~~~n 150 (162) T cd04106 74 GAQACILVFSTTDRESFEAIESWKEKVEAECG---DIPMVLVQTKIDLLDQAVITNEEAEALAKRLQLPLFRTSVKDDFN 150 (162) T ss_pred HHCCEEEEEECCCHHHHHHHHHHHHHHHHHCC---CCCEEEEECCHHHHHCCCCCHHHHHHHHHHCCCEEEEECCCCCCC T ss_conf 30312688406988999999999999997669---962999840544410177899999999998698799986888829 Q ss_pred HHHHHHHHHHH Q ss_conf 99999999999 Q gi|254780648|r 315 IPQILECLHDK 325 (335) Q Consensus 315 I~eL~~~I~e~ 325 (335) T Consensus 151 V~e~F~~la~k 161 (162) T cd04106 151 VTELFEYLAEK 161 (162) T ss_pred HHHHHHHHHHH T ss_conf 89999999960

HHsearch alignment for GI: 254780648 and conserved domain: cd04106