HHsearch alignment for GI: 254780648 and conserved domain: cd04116

>cd04116 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47). Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs. Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=99.60  E-value=1.8e-15  Score=113.66  Aligned_cols=152  Identities=13%  Similarity=0.100  Sum_probs=103.9

Q ss_pred             EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCE------EEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             12442167775303541014540121211000000102------663298--6899822642124731167751234433
Q gi|254780648|r  162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLG------IVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLKH  233 (335)
Q Consensus       162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lG------vv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLrh  233 (335)
T Consensus         8 ivvlGd~~VGKTsli~r~~~~~f~-~~~-----~~Tig~~~~~k~i~~~~~~v~l~iwDtaG~e----~~~~l~~~---~   74 (170)
T cd04116           8 VILLGDGGVGKSSLMNRYVTNKFD-TQL-----FHTIGVEFLNKDLEVDGHFVTLQIWDTAGQE----RFRSLRTP---F   74 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCC-CCC-----CCCCEEEEEEEEEEECCEEEEEEEEECCCCC----CCCCCHHH---H
T ss_conf             999999997899999999739899-988-----8876079899999999999999999899972----43524176---6


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH--HHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEEECC
Q ss_conf             3335788752022221101346667899877766--7505988999974658998899999999998629-948999888
Q gi|254780648|r  234 TERTHVLLHIVSALEENVQAAYQCILDELSAYNS--ELRKKIEIVGLSQIDTVDSDTLARKKNELATQCG-QVPFEFSSI  310 (335)
Q Consensus       234 Ier~~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~--~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~~~~-~~vi~ISA~  310 (335)
T Consensus        75 ~~~a~~~ilvydit~~~Sf~~~~~w~~~~~~~~~~~~~~~~piilvgnK~Dl~~r~v~~~e~~~~a~~~~~~~~~E~SAk  154 (170)
T cd04116          75 YRGSDCCLLTFAVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVVLGNKNDIPERQVSTEEAQAWCRENGDYPYFETSAK  154 (170)
T ss_pred             EECCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHCCCCHHHHHHHHHHCCCCEEEEECCC
T ss_conf             00477339999788879999999999999997144578884099996111130378899999999998599789998888


Q ss_pred             CCCCHHHHHHHHHHHH
Q ss_conf             7889999999999999
Q gi|254780648|r  311 TGHGIPQILECLHDKI  326 (335)
Q Consensus       311 tg~GI~eL~~~I~e~L  326 (335)
T Consensus       155 ~g~nV~~~F~~l~~~i  170 (170)
T cd04116         155 DATNVAAAFEEAVRRV  170 (170)
T ss_pred             CCCCHHHHHHHHHHCC
T ss_conf             8818899999999539