>cd04124 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share 98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b

Probab=99.68 E-value=2.1e-16 Score=119.30 Aligned_cols=154 Identities=16% Similarity=0.085 Sum_probs=109.6 Q ss_pred EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCE--EEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHHHHHHH Q ss_conf 12442167775303541014540121211000000102--663298--68998226421247311677512344333335 Q gi|254780648|r 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLG--IVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLKHTERT 237 (335) Q Consensus 162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lG--vv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLrhIer~ 237 (335) T Consensus 3 ivllGd~~VGKTsli~r~~~~~f-~~~~~-~Tig~~~~~~~~~~~~~~~~l~iwDtaG~e----~f~~~~~~---y~~~a 73 (161) T cd04124 3 IILLGDSAVGKSKLVERFLMDGY-EPQQL-STYALTLYKHNAKFEGKTILVDFWDTAGQE----RFQTMHAS---YYHKA 73 (161) T ss_pred EEEECCCCCCHHHHHHHHHHCCC-CCCCC-CCCCEEEEEEEEEECCEEEEEEEEECCCCC----CCCHHHHH---HHCCC T ss_conf 99999899678999999980977-99726-654157999999999999999999799984----34324699---73568 Q ss_pred HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH Q ss_conf 78875202222110134666789987776675059889999746589988999999999986299489998887889999 Q gi|254780648|r 238 HVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQCGQVPFEFSSITGHGIPQ 317 (335) Q Consensus 238 ~vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l~~~~~~~vi~ISA~tg~GI~e 317 (335) T Consensus 74 ~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~---~~p~ilVgNK~DL~~~--~~~~~~~~a~~~~~~f~etSAk~g~nV~e 148 (161) T cd04124 74 HACILVFDVTRKITYKNLSKWYEELREYRP---EIPCIVVANKIDLDPS--VTQKKFNFAEKHNLPLYYVSAADGTNVVK 148 (161) T ss_pred CEEEEEEECCCHHHHHHHHHHHHHHHHHCC---CCCEEEEEECCCCCCH--HHHHHHHHHHHCCCEEEEEECCCCCCHHH T ss_conf 767999968977889999999999998686---9989999997117742--58999999998699199990783809799 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999854 Q gi|254780648|r 318 ILECLHDKIFSI 329 (335) Q Consensus 318 L~~~I~e~L~~~ 329 (335) T Consensus 149 ~F~~l~~~~i~~ 160 (161) T cd04124 149 LFQDAIKLAVSY 160 (161) T ss_pred HHHHHHHHHHHC T ss_conf 999999999844

HHsearch alignment for GI: 254780648 and conserved domain: cd04124