>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation. It is expressed ubiquitously, with elevated levels in muscle and brain. Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth. TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell. TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb. The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb. Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le

Probab=99.62 E-value=2.3e-15 Score=113.01 Aligned_cols=160 Identities=15% Similarity=0.170 Sum_probs=107.3 Q ss_pred EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECC-EEEEECC--EEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHH Q ss_conf 1244216777530354101454012121100000010-2663298--689982264212473116775123443333357 Q gi|254780648|r 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNL-GIVKEGY--KEFILADIPGIIKNAHQGAGIGDRFLKHTERTH 238 (335) Q Consensus 162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~l-Gvv~~~~--~~~~i~D~PGlIegA~~~~glG~~FLrhIer~~ 238 (335) T Consensus 4 IvlvGd~~VGKTsli~r~~~~~f-~~~y~-~Ti~~~~~k~i~~~~~~~~l~iwDtaG~e~----~~~~~~~---~~~~a~ 74 (180) T cd04137 4 IAVLGSRSVGKSSLTVQFVEGHF-VESYY-PTIENTFSKIIRYKGQDYHLEIVDTAGQDE----YSILPQK---YSIGIH 74 (180) T ss_pred EEEECCCCCCHHHHHHHHHCCCC-CCCCC-CCCCCCCCEEEEECCEEEEEEEEECCCCCC----CCHHHHH---HHHHCC T ss_conf 99999899889999999970978-99858-812441137999999999999998998701----0066799---986355 Q ss_pred HHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH-HHHHHHHHHHCCCCEEEEECCCCCCHHH Q ss_conf 887520222211013466678998777667505988999974658998899-9999999986299489998887889999 Q gi|254780648|r 239 VLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTL-ARKKNELATQCGQVPFEFSSITGHGIPQ 317 (335) Q Consensus 239 vLl~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~-~~~~~~l~~~~~~~vi~ISA~tg~GI~e 317 (335) T Consensus 75 ~~ilvydvt~~~Sf~~~~~~~~~~~~~~~-~~~~piilVgNK~DL~~~r~V~~~e~~~~a~~~~~~f~EtSAk~g~nV~e 153 (180) T cd04137 75 GYILVYSVTSRKSFEVVKVIYDKILDMLG-KESVPIVLVGNKSDLHTQRQVSTEEGKELAESWGAAFLESSARENENVEE 153 (180) T ss_pred EEEEEEECCCHHHHHHHHHHHHHHHHHHC-CCCCCEEEEEECCCCHHHCCCCHHHHHHHHHHCCCEEEEECCCCCCCHHH T ss_conf 78999743887889999999999999758-88886797765346244078899999999998399899977688919899 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999999985452 Q gi|254780648|r 318 ILECLHDKIFSIRG 331 (335) Q Consensus 318 L~~~I~e~L~~~r~ 331 (335) T Consensus 154 ~F~~l~~~i~k~~~ 167 (180) T cd04137 154 AFELLIEEIEKVEN 167 (180) T ss_pred HHHHHHHHHHHHHC T ss_conf 99999999988638

HHsearch alignment for GI: 254780648 and conserved domain: cd04137