>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

Probab=99.78 E-value=4.3e-19 Score=135.55 Aligned_cols=152 Identities=19% Similarity=0.200 Sum_probs=101.4 Q ss_pred EEEEECCCCCCCEEEEEECCCCCHHHHHHHCCCEECCEEEEECCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHH Q ss_conf 12442167775303541014540121211000000102663298689982264212473116775123443333357887 Q gi|254780648|r 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVLL 241 (335) Q Consensus 162 VglVG~PNaGKSTLln~ls~ak~kIa~ypFTT~~P~lGvv~~~~~~~~i~D~PGlIegA~~~~glG~~FLrhIer~~vLl 241 (335) T Consensus 3 ililG~~~sGKTsll~~l~~~~~-~~~~--pT~g~~~~~~~~~~~~l~iwD~~G~----~~~r~l~~~---Y~~~a~~iI 72 (159) T cd04150 3 ILMVGLDAAGKTTILYKLKLGEI-VTTI--PTIGFNVETVEYKNISFTVWDVGGQ----DKIRPLWRH---YFQNTQGLI 72 (159) T ss_pred EEEECCCCCCHHHHHHHHHCCCC-CCCC--CCCCCCEEEEEECCEEEEEEECCCC----CCCCHHHHH---HCCCCCEEE T ss_conf 99999999998999999972996-7758--9687017999989899999978997----214656786---476873899 Q ss_pred HHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHH----HHHCCCCEEEEECCCCCCHHH Q ss_conf 5202222110134666789987776675059889999746589988999999999----986299489998887889999 Q gi|254780648|r 242 HIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNEL----ATQCGQVPFEFSSITGHGIPQ 317 (335) Q Consensus 242 ~VVD~s~~d~~~~~~~I~~EL~~y~~~L~~Kp~IIVlNKiDl~~~e~~~~~~~~l----~~~~~~~vi~ISA~tg~GI~e 317 (335) T Consensus 73 ~VvD~sd~~~~~~~~~~l~~~l~-~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gv~e 151 (159) T cd04150 73 FVVDSNDRERIGEAREELQRMLN-EDELRDAVLLVFANKQDLPNAMSAAEVTDKLGLHSLRNRNWYIQATCATSGDGLYE 151 (159) T ss_pred EEEECCCHHHHHHHHHHHHHHHC-CHHHCCCEEEEEEECCCCCCCCCHHHHHHHHCHHHHHCCCEEEEEEECCCCCCHHH T ss_conf 99977777899999999999962-35336982999997566778989999999968666637985999826867939899 Q ss_pred HHHHHHH Q ss_conf 9999999 Q gi|254780648|r 318 ILECLHD 324 (335) Q Consensus 318 L~~~I~e 324 (335) T Consensus 152 ~f~WL~~ 158 (159) T cd04150 152 GLDWLSN 158 (159) T ss_pred HHHHHHC T ss_conf 9999855

HHsearch alignment for GI: 254780648 and conserved domain: cd04150